The invention discloses a kit for detecting a swine trichina worm antibody by a polypeptide antigen and a detection method of the kit. The kit comprises the polypeptide antigen, a coating solution, apolypeptide antigen coated elisa plate, an antibody diluent, a PBST washing solution, positive serum, negative serum, confining liquid, a horseradish peroxidase labeled rabbit anti-swine IgG secondaryantibody, substrate color developing liquid TMB and terminating liquid, wherein the specific polypeptide antigen is TEp1 and has the sequence of SWDEVFDEAHTKRKKGGGGSGGGGSFDEAHTKRKKFYPTPGGGGSGGGGTKRKKFYPTPHSSIKGQGQGQGFYPTPHSSIKIPMMT. According to the kit for detecting the swine trichina worm antibody by the polypeptide antigen, disclosed by the invention, the operating method is simple, the detecting speed is high, the polypeptide antigen TEp1 is used as a coating antigen, the efficiency of bonding with a target antibody is high, the specificity is good, the polypeptide antigen TEp1 is simplein preparation method and ingredient, and the cost of swine trichina worm detection is reduced.