US11648505B2
A portable oxygen concentrator includes at least one separation mechanism and an oxygen storage tank, where the separation mechanism is connected to the oxygen storage tank and includes an air bag and a molecular sieve tank that is filled with a molecular sieve for adsorption. The air bag has an air inlet and an air outlet. The air bag is connected to the molecular sieve tank through a valve group, which includes a first single valve and a second single valve. The air bag is connected to the molecular sieve tank through the first single valve. Each of the two ends of the molecular sieve tank has at least one gas outlet. When an inner space of the air bag is compressed and expanded once, the molecular sieve in the molecular sieve tank adsorbs and desorbs once.
US11648502B2
A cylindrical filter device of the present invention includes a wavy filter screen, a sealing device, and a connecting device. The wavy filter screen includes a first flexible side strip, a second flexible side strip opposite to the first flexible side strip, and a plurality of wavy structures disposed between the first flexible side strip and the second flexible side strip. The wavy filter screen wraps to form a cylindrical structure with respect to an axis. The opposite ends of the cylindrical structure are respectively wrapped to form a first opening and a second opening by the first flexible side strip and the second flexible side strip. The sealing device is disposed at the first opening and has a first groove. The first flexible side strip is able to engage with the first groove with its elasticity and makes the first opening be sealed by the sealing device. The connecting device is disposed at the second opening. The connecting device has a second groove and a port. The second flexible side strip is able to engage with the second groove with its elasticity and makes the second opening communicate with the port.
US11648500B2
The present disclosure provides a valve (123), comprising a channel body (1231) defining a bent channel space, an elastically flexible membrane (1233), which separates a control space (Sc) from a flow space (Sf) in the channel space, a control connection (1232), providing a fluid connection to the control space (Sc), The control space (Sc) is provided at a radially outermost portion (Co) of the channel space, as per a channel bending radius (Ro), such that the membrane (1233) is flexible between an open position, whereby a cross section of the flow space (Sf) is substantially that of the channel, and a closed position, whereby the membrane substantially seals against a radially innermost portion (Ci) of the channel, as per the channel bending radius (Ri). Use of the valve in a separator is disclosed, as well as a separator comprising such valve and a method of cleaning a separator body.
US11648495B1
A backwash filtration system comprising a backwash discharge port, a sedimentation collection and separation system, and a final filtration chamber. The backwash discharge port is coupled with a pool filter system and is configured to pass backwashed water from the pool filter system to the sedimentation collection and separation system. The sedimentation collection and separation system has a plurality of sedimentation chambers that are vertically stacked and a plurality of baffles configured to reduce the migration of sediment within the sedimentation chambers. A path for water flow passes down sequentially through each of the sedimentation chambers. The final filtration chamber receives the backwashed water from the sedimentation collection and separation system, filters the backwashed water through a final filtration medium, and passes the filtered water to a water return line of the pool filter system or to a pool of water.
US11648487B2
An automatic bubble blowing apparatus wearable on the head and having an inflatable ornamental skin. The inflatable ornamental skin is a non-tooled component which can be manufactured to have a variety of festive appearances. The apparatus has straps which can be used to secure the apparatus to the head of a user. Alternatively, the automatic bubble blowing apparatus can be utilized on a horizontal surface, such as a table, with the straps hidden under the apparatus. The automatic bubble blowing apparatus includes a power source, a surfactant solution reservoir, a fan for creating an air stream out an exit aperture, a mechanism for creating a surfactant film across the exit aperture, and an on-off switch which controls both power to the fan and sealing and unsealing of the exit aperture.
US11648486B2
A transformable toy including a main body and a transformation inducing unit, wherein the main boy includes a body part; at least one first body portion; at least one pressing part; and a locking part to fix the body part and the first body portion to the main body. When the locking part is unlocked by an operation of the transformation inducing unit, the first body portion and the one pressing part are moved away from the body part such that the toy transforms from a first shape into a second shape in which at least a portion of the main body is caused to be floating from a floor by the pressing part.
US11648482B2
In a network match puzzle game, players participate through wireless communication over the Internet. A game management system is provided for a puzzle game in which players alternately put blocks of different shapes in unoccupied space on a game board of a predetermined shape within a predetermined allotted time, and sets competition schedule information including match start times of all matches of a tournament up to a final match, each match start time being calculated by using a game time per match based on a maximum turn number and the allotted time, the maximum turn number being set for each game board or for each shape and/or number of the blocks. The game management system provides the competition schedule information, receives a competition entry request, and sets pairings in the tournament. The game management system establishes a game session and performs game control, and simultaneously starts control of games.
US11648480B2
Systems and methods are provided for enhanced pose generation based on generative modeling. An example method includes accessing an autoencoder trained based on poses of real-world persons, each pose being defined based on location information associated with joints, with the autoencoder being trained to map an input pose to a feature encoding associated with a latent feature space. Information identifying, at least, a first pose and a second pose associated with a character configured for inclusion in an in-game world is obtained via user input, with each of the poses being defined based on location information associated with the joints and with the joints being included on a skeleton associated with the character. Feature encodings associated with the first pose and the second pose are generated based on the autoencoder. Output poses are generated based on transition information associated with the first pose and the second pose.
US11648475B2
Embodiments of this application disclose an object control method performed by an electronic device. The method includes: detecting a first operation triggered in a client, the client displaying a virtual scene, and the first operation being used for instructing a target object in the virtual scene to move from one side of a target obstacle to the other side of the target obstacle; determining a target action to be performed by the target object, the target action being determined according to attributes of the target obstacle, and the target action being a crossing type or climbing type action performed by the target object to move from one side of the target obstacle to the other side of the target obstacle; and controlling, in the virtual scene, the target object to perform the target action.
US11648473B2
In a virtual reality environment a user's movements are coupled, meaning the user cannot walk and look in different directions. Discloses are methods and systems for soft decoupling the movements of the user in a virtual reality environment, enabling the user to look and walk in different directions simulating real-world interactions. The soft decoupling is performed by receiving acceleration and orientation data from sensors attached to the user. A heading and a heading delta based on a ratio are calculated. The calculated heading and a velocity are translated into soft decoupling inputs for the virtual reality environment.
US11648460B1
A memory puzzle is provided that may include one or more levels of rotatable level housing, a number of puzzle spaces disposed on the rotatable level housings, and a piston for indicating that a portion of the puzzle has been solved, wherein the piston raises to a high level as levels of the puzzle are solved, wherein the puzzle is solved when a code is achieved by rotating the rotatable level housings in a specific pattern.
US11648447B2
Embodiments provide a lacrosse head having a pocket stringing system that includes attachment members that allow for rapid, direct attachment of a pocket to the head. A lacrosse head may include cleats protruding from the sidewalls at a rearward portion of the pocket area nearest the juncture, sidewall hooks protruding from the sidewalls at a forward portion of the pocket area forward of the rearward portion, and scoop hooks protruding in the forward direction from the front face of the scoop. Each cleat may have a rearwardly-projecting arm and a forwardly-projecting arm. Each sidewall hook may have a rearwardly-projecting arm. A first scoop hook may tension a pocket toward a first sidewall hook on a first sidewall, and a second scoop hook may tension the pocket toward a second sidewall hook on a second sidewall, so as to form a ball channel in the pocket.
US11648442B2
This present invention relates to a multifunctional leg strengthening device for users to strengthen the lower extremities. The multifunctional leg strengthening device includes a resistance band that is removably attached to an exercise ball, such that the resistance band can be easily held by the user's hand while holding the exercise ball between the calves or thighs for performing leg strengthening exercises. The innovative multifunctional leg strengthening device may comprise a rigid or flexible resistance band. Also, the band may feature a pocket to accommodate the rigid stick or rod inside the pocket. The rigid stick design helps accommodate those with decreased lower body strength, thereby ensuring the muscles can be strengthened and rehabilitated.
US11648437B1
A multipurpose fitness block suitable for a variety of upper body and lower body exercises is presented. The multipurpose fitness block contains a block body, a plurality of weight inserts, a carrying handle, and a plurality of attachment elements. The block body contains a plurality of handling channels and a plurality of weight holders. The plurality of weight holders is distributed about the block body. The plurality of handling channels is distributed about the block body. The plurality of weight inserts is connected along the plurality of weight holders. The carrying handle is connected adjacent to the block body. The plurality of attachment elements is distributed about the block body.
US11648432B2
This disclosure addresses an exercise device adapted to enable the user to perform a salmon ladder exercise. The ladder includes a frame with at least one pair of support protrusions that receive an exercise bar. A bearing surface that receives the shaft of a catch array rotatably mounted in the frame. The device further includes a braking mechanism that applies a variable suppression force to the catch array shaft, the variable suppression adjusting the force required to rotate the catch array shaft in the bearing surface.
US11648427B2
The present invention relates to a fire-protection-collar element (10) for forming a fire-protection collar (35) for closing through-passages in walls (38), ceilings and/or floors in the event of a fire. The present invention also relates to a method for forming a fire-protection collar (35) for closing through-passages in walls (38), ceilings and/or floors in the event of a fire.
US11648417B2
An apparatus for tissue regeneration is provided. The apparatus comprises means for generating at least one laser pulse comprising a wavelength; and means for directing the at least one laser pulse onto a tissue surface of a human or animal body, wherein the means for generating comprises control means to ensure that a sum of the pulse energies of the at least one laser pulse is selected so that the corresponding fluence on the tissue surface heats the tissue surface up to a maximal temperature Tmax between 70° C. and a tissue boiling temperature Tb. Further, the means for generating of the apparatus are adapted so that a delivery time ted of the at least one laser pulse (during which the second half of the pulse energy is delivered) is sufficiently short so that, given the wavelength and thus a corresponding penetration depth δ of the at least one laser pulse, a thermal exposure time texp of the tissue surface is shorter than 900 microseconds. Here, the thermal exposure time texp of the tissue surface is defined as a time interval in which the temperature of the tissue surface is above To+(Tmax−To)/2, wherein To defines the initial temperature of the tissue surface, before the laser pulse arrives.
US11648415B2
A therapeutic device, for human hair and skincare, comprises a gripping unit a functional unit including a first functional module and a second functional module, the first functional module including a first plate and a second functional module including a second plate, wherein a second surface of the second plate is oriented in an opposite direction to a first surface of the first plate, a plurality of teeth oriented in the direction of the orientation of the first surface, the plurality of teeth including a plurality of respective primary Light Emitting Diodes (LEDs), a plurality of secondary LEDs provided on the second plate and oriented in the direction of the orientation of the second surface and a sensor unit configured to determine hair distribution data on a body portion of a user.
US11648414B2
Provided are systems and methods for decalcifying aortic valves and/or other valves, blood vessels, and/or cardiac tissues in a mammalian (e.g., a human) patient (e.g., a patient having or suspected of having calcific aortic valve disease (CAVD)). A transcatheter (aortic) valve decalcification system/method can include applying one or more pulsed magnetic fields to the calcium deposit(s) within a valve or other vessel or tissue within the patient. The system can include a catheter having pulsed magnetic field ribbons disposed therein, and the catheter can be provided to the patient.
US11648413B2
The present invention relates to a method and apparatus for simulating the vagus nerve. The apparatus for stimulating the vagus nerve includes: a magnetic field generation unit generating a magnetic field in a form of pulse, which stimulates a preset area including the vagus nerve of a user by an electric current applied to a coil; a power supply unit applying the electric current to the coil; and a control unit controlling an intensity of the electric current applied to the coil, and a pulse width and a peak interval of the magnetic field, wherein the magnetic field has a peak intensity that is set using a biomagnetic signal of the use. According to the present invention, the body function may be improved using the pulsed magnetic field with the intensity close to the biomagnetic signals.
US11648410B2
A neurostimulator implant includes an insulating member and an elongate circuitry unit. The circuitry unit includes (a) a first electrode, disposed on an outer surface of a first end portion of the circuitry unit; (b) a second electrode, disposed on an outer surface of a second end portion of the circuitry unit; and (c) circuitry, disposed inside the circuitry unit, and configured to be wirelessly powered to drive an electrical current between the first and second electrodes. The circuitry unit is disposed alongside a medial part of the insulating member, bulging away from the insulating member to define a generally arced portion of the implant. Lateral parts of the insulating member extend laterally outward from the medial part to define lateral zones laterally beyond the circuitry unit. The second side of the insulating member defines a generally flat side of the implant. Other embodiments are also described.
US11648408B2
A method of manufacturing a filtered feedthrough assembly for use with an implantable medical device. The method may include gold brazing an insulator to a flange at first braze joint, and gold brazing a plurality of feedthrough wire to the insulator at second braze joints. The method may further include applying a first non-conductive epoxy to the first braze joint, and applying a second non-conductive epoxy to the second braze joint. The method may further include grit blasting a face of the flange, applying a conductive epoxy to the face of the flange, and attaching an EMI filter to the conductive epoxy such that it is grounded to the flange via the conductive epoxy and not via the first braze joint or the second braze joints.
US11648407B2
An implantable system including an atrial leadless pacemaker (aLP) and a ventricular leadless pacemaker (vLP), and methods for use therewith, are configured or used to terminate a pacemaker mediated tachycardia (PMT). In an embodiment, in response to the aLP detecting a PMT, the aLP initiates a PMT PA interval, and the aLP does not inform the vLP, via an i2i communication, of an atrial sensed event that caused the PMT to be detected, thereby preventing the vLP from initiating a PV interval during the PMT PA interval. The aLP selectively terminates the PMT PA interval. Additionally, the aLP informs the vLP, via an i2i communication, of an intrinsic atrial event being detected during the PMT PA interval, or of an atrial paced event being performed in response to the PMT PA interval expiring without an intrinsic atrial event being detected during the PMT PA interval.
US11648406B2
Systems, methods, and interfaces are described herein for identification of effective electrodes to be used in sensing and/or therapy. Two or more portions of a signal monitored using an electrode may be compared to determine whether the electrode is effective. The two or more portions may correspond to the same portion or window of a cardiac cycle. Further, signals from a first electrode and from a second electrode located proximate the first electrode may be compared to determine whether one or both of the electrodes are effective.
US11648399B2
An example of an apparatus for percutaneously delivering neurostimulation energy to a patient and sensing from the patient using a test device placed externally to the patient is provided. The apparatus may include a stimulation lead, a sensing reference electrode, a sensing wire, and a connection system. The stimulation lead may be configured to be percutaneously introduced into the patient to place the one or more electrodes in the patient. The sensing reference electrode may be configured to be placed in the patient. The sensing wire may be connected to the sensing reference electrode and configured to be percutaneously introduced into the patient to place the sensing reference electrode in the patient. The connection system may be configured to mate the lead connector and the wire connector and to provide electrical connections between the lead connector and the test device and between the wire connector and the test device.
US11648397B1
Systems and methods for cardiac pacing are provided, where a pacing lead is placed at or near the bundle of His. A method for pacing a heart of a patient comprises: introducing a sheath to vasculature of the patient; steering the sheath within a coronary sinus in the heart to lodge a distal end of the sheath to a target location proximal to the bundle of His above a septum separating a left ventricle and a right ventricle of the heart; advancing a pacing lead through a lumen of the sheath to the target location; coupling the pacing lead to cardiac tissue at the target location; removing the sheath; and electrically pacing the bundle of His using the pacing lead.
US11648393B2
An inflow cannula for an implantable blood pump having an impeller defining a plurality of flow channels, the inflow cannula includes a proximal end a distal end proximate the impeller, the distal end including a protuberance extending outward from the inflow cannula.
US11648390B2
An intravascular blood pump having a drive section (11), a catheter (14) fastened to the drive section proximally and a pump section (12) fastened to the drive section distally possesses an electric motor (21) whose motor shaft (25) is mounted in the drive section (11) with two radial sliding bearings (27, 31) and an axial sliding bearing (40). During operation, purge fluid is conveyed through the bearing gap of the axial sliding bearing (40) and further through the radial sliding bearing (31) at the distal end of the drive section (11). The purge fluid is highly viscous, for example 20% glucose solution.
US11648387B2
Apparatus and methods are described, including a blood pump that includes a catheter, a proximal impeller disposed on the catheter inside a proximal impeller housing, and which is configured to pump blood by rotating inside the proximal impeller housing. A distal impeller is disposed on the catheter inside a distal impeller housing, distally to the proximal impeller, and the distal impeller is configured to pump blood by rotating inside the distal impeller housing. A tubular element is disposed between the proximal impeller housing and the distal impeller housing, the tubular element being configured to have a tubular configuration during rotation of the proximal and distal impellers. Other applications are also described.
US11648373B2
A processing system includes methods to promote sleep. The system may include a monitor such as a non-contact motion sensor from which sleep information may be determined. User sleep information, such as sleep stages, hypnograms, sleep scores, mind recharge scores and body scores, may be recorded, evaluated and/or displayed for a user. The system may further monitor ambient and/or environmental conditions corresponding to sleep sessions. Sleep advice may be generated based on the sleep information, user queries and/or environmental conditions from one or more sleep sessions. Communicated sleep advice may include content to promote good sleep habits and/or detect risky sleep conditions. In some versions of the system, any one or more of a bedside unit 3000 sensor module, a smart processing device, such as a smart phone or smart device 3002, and network servers may be implemented to perform the methodologies of the system.
US11648367B2
A nebulizer device aerosolizes (or vaporizes) liquid drawn from a liquid reservoir via a fluid flow path into a nebulization chamber. An inlet port is coupled to an external air supply and leads through a check valve and Venturi nozzle (e.g. a duckbill valve) into the chamber to direct an air stream across an opening of the fluid flow path. A discharge port leads from the chamber to a user mask, mouthpiece or canula, where the aerosol or vapor mixture can be inhaled. A filtered outlet port isolates exhaled material from the external environment. Multiple discrete heating elements may be placed around the fluid flow path to preheat the liquid. If the liquid is sufficiently volatile, heating may vaporize the material which can condense back into an aerosol after mixing with the air stream. A set of check valves direct one-way fluid flow and prevent leakage or spillage of material from the device.
US11648359B2
Pressure conditioning systems for supplying insufflation gas to an open-ended body conduit such as a rectal cavity during a transanal minimally invasive surgery (TAMIS) procedure can reduce billowing of walls of the body conduit. A pressure conditioning system can include a pressure storage component, an accumulator, and a flow restrictor. The pressure storage component can include a variable volume reservoir that is biased to a relatively low volume state. The flow restrictor can include insufflation tubing with a restrictor plate having a relatively low diameter orifice. The pressure storage component, accumulator, and flow restrictor can be fluidly connected in various orders in series or as side branches from a gas flow conduit. Despite a pulsed or otherwise discontinuous insufflation gas flow and leakage and absorption from the body conduit, the pressure conditioning system can maintain a constant pressure within the body conduit.
US11648346B2
Systems and methods for intelligently delivering fluid to a targeted tissue are described. The systems and methods may include directing a pump to distribute fluid to a targeted tissue and receiving one or more signals from an intracorporeal sensing system, where the one or more signals correspond to one or more sensed feedback parameters at the targeted tissue. The systems and methods may also include determining whether the one or more sensed feedback parameters are within an acceptable range. If the one or more sensed feedback parameters are not within the acceptable range, the systems and methods may include determining an adjusted velocity for the plunger necessary to adjust the pressure of the fluid in the pump so that the one or more sensed feedback parameters move within the acceptable range and directing the pump to distribute the fluid at the adjusted velocity.
US11648340B2
An extracorporeal circulation apparatus has a blood reservoir temporarily storing blood and a presence information acquisition unit to detect presence or absence of blood at respective wall locations in a two-dimensional array. A control unit determines the position of a blood surface on the basis of consecutive elements in the array having detected blood along at least one of a first direction parallel to the blood surface and a second direction perpendicular to the blood surface.
US11648338B2
Various embodiments disclosed relate to drug-coated balloon catheters for treating strictures in body lumens and methods of using the same. A drug-coated balloon catheter for delivering a therapeutic agent to a target site of a body lumen stricture includes an elongated balloon having a main diameter. The balloon catheter includes a coating layer overlying an exterior surface of the balloon. The coating layer includes one or more water-soluble additives and an initial drug load of a therapeutic agent.
US11648334B2
A bone gel composition consists of cortical bone. The cortical bone is made from cut pieces freeze-dried then ground into particles and demineralized then freeze-dried. A volume of the particles is placed in a solution of sterile water to create a mixture, the water volume being at least twice the particle volume, the mixture is autoclaved under heat and pressure to form a gelatin, the resulting bone gel is formed into sheets having a thickness (t).
US11648331B2
Systems, apparatus and methods for disinfection of airflow. An apparatus for disinfecting air-conditioned airflow in a confined space includes: a modular housing; and a disinfection chamber enclosed within the housing. The disinfection chamber includes a plurality of disinfection sheets. Each disinfection sheet comprises a plurality of ultraviolet (UV) light sources. The airflow is configured to be routed along a serpentine pathway within the housing to expose microorganisms in the airflow to far UV-C light emitted by the UV light sources for an extended and optimal duration.
US11648330B2
The disclosure herein concerns a method including receiving at a computer at least one target value of a scent parameter for an environment that is remote from the computer, receiving at the computer a sensed parameter of the environment, and controlling, via the computer, diffusion of a liquid from a source of the liquid in fluid communication with at least one scent diffusion device to achieve the target value of the scent parameter, wherein controlling includes setting or adjusting an operation parameter of the at least one scent diffusion device in response to the sensed parameter.
US11648328B2
A device for production and use of a disinfectant. The device may be used to disinfect materials or objects exposed to viruses and/or bacteria. In particular, the device is capable of converting at least one first reagent such as an alcohol and at least one second reagent including an oxidant into an active disinfectant agent. A catalytic system is incorporated into the reaction vessel to produce the active disinfectant as needed for the disinfection process.
US11648325B1
The present application relates to a field of sterilization and disinfection, and in particular, relates to a sterilization equipment and a sterilization process. A sterilization equipment includes a rotatable table, a heat transmission pipe, a suction pipe, a pretreatment gas pipe and a protective gas pipe; a plurality of working station modules are provided on the rotatable table; a heating pipe is provided inside the working station module and configured for communicating with the heat transmission pipe; a material port, a suction port, a first gas inlet, a second gas inlet and a reagent port are defined in the working station module; when the rotatable table is rotated, the working station module is moved to a feeding station, a pretreatment station, a pre-sterilization station, a reagent adding station, a sterilization station, a cleaning station and a discharging station in turn.
US11648324B2
Compounds are provided having the following structure: or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, wherein R1, R2, R3, L1, L2, G1, G2 and G3 are as defined herein. Use of the compounds as a component of lipid nanoparticle formulations for delivery of a therapeutic agent, compositions comprising the compounds and methods for their use and preparation are also provided.
US11648301B2
In one aspect, the present invention provides a method for treating cancer comprising tumor cell vaccination in combination with hematopoietic and immune cell transplantation. In some embodiments, the method involves autologous tumor cell vaccination prior to autologous hematopoietic and immune cell transplantation. In another aspect, the present invention provides a method of purifying tumor cells from a subject in preparation for vaccination.
US11648294B2
The present invention relates to compositions and methods for modulating immune responses using at least one CRACC composition comprising an adenoviral vector comprising at least one CRACC fusion. Such CRACC compositions may be combined with a number of other therapeutic agents which target modulating immune responses, as well as, treatments that include immune events.
US11648289B2
The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.
US11648283B2
A method of extracting a C. yanhusuo plant comprising the steps of harvesting and drying the plant; extracting the alkaloids from the plant in a solvent; filtering the solvent—C. yanhusuo plant mixture to remove the solvent and extracted alkaloids from a spent plant matter; drying the spent plant matter; purifying and separating the extracted alkaloids from the solvent; and mixing the purified alkaloids back into the dried spent plant matter. Also, products of the method include vaporizing liquids, medicinal compositions, kief compositions, rolling papers, and filters for tobacco and vaporizing equipment comprising the mixture of the purified alkaloids and the dried spent plant matter produced according to the method. Further, a C. yanhusuo plant having a total alkaloid content of about 3%, of which 97% of the total alkaloid content is bulbocapnine and tetrahydropalmatine (THP).
US11648282B2
Disclosed is a composition for promoting absorption of a poorly water-soluble phytochemical which can significantly improve the intake of a phytochemical into a body, especially a migration speed and/or a migration amount of the phytochemical into a blood. A polysaccharide-containing lactic acid bacterial product, which is produced by Lactobacillus delbrueckii ssp. bulgaricus OLL1251, can significantly enhance the intake of a phytochemical into a body, especially a migration speed and/or a migration amount of the phytochemical into a blood. Thus, the composition for promoting absorption of a phytochemical according to the present invention includes, as an active ingredient, the polysaccharide-containing lactic acid bacterial product. Furthermore, the composition for promoting absorption of a phytochemical is useful as a food additive composition. In addition, a food, or a beverage, or a food or beverage composition to which the composition for promoting absorption of a phytochemical is added can obtain an effect of promoting absorption of phytochemical.
US11648274B2
The present invention provides a chimeric polypeptide comprising: an antigen-binding domain which constitutively binds to an ectodomain of a first chain of a cytokine receptor; a transmembrane domain; and an endodomain from a second chain of the cytokine receptor which chimeric polypeptide, when expressed in a cell, binds to the endogenous first chain of the cytokine receptor causing constitutive cytokine signalling.
US11648270B2
The present invention relates generally to the treatment of PML by infusion of activated and expanded autologous lymphocytes.
US11648267B2
Disclosed herein are methods and compositions for inactivating CCR-5 genes, using zinc finger nucleases (ZFNs) comprising a zinc finger protein and a cleavage domain or cleavage half-domain. Polynucleotides encoding ZFNs, vectors comprising polynucleotides encoding ZFNs, such as adenovirus (Ad) vectors, and cells comprising polynucleotides encoding ZFNs and/or cells comprising ZFNs are also provided.
US11648260B2
The present invention provides pharmaceutical compositions comprising membrane vesicles, including extracellular vesicles including those referred to as exosomes, loaded with an exogenous Phosphatase and tensin homolog (PTEN) inhibitor. Methods of treating neurological diseases, disorders or conditions using the extracellular vesicles are provided. Isolated extracellular vesicles loaded with an exogenous Phosphatase and tensin homolog (PTEN) inhibitor are provided as well.
US11648257B2
Pharmaceutical carriers capable of pH dependent reconstitution and methods for making and using same
Disclosed herein are novel drug carriers including a non-aqueous pH dependent release system and a non-aqueous pH dependent reassembly/assembly and reabsorption/absorption system. The carriers are capable of pH dependent release of biologically active agents and assembly or reassembly when the carrier transitions from a low pH environment, to a high pH environment and back to a low pH environment.
US11648253B2
Disclosed herein, in part, are heteroaromatic compounds and methods of use in treating neuropsychiatric disorders, e.g., schizophrenia and major depressive disorder. Pharmaceutical compositions and methods of making heteroaromatic compounds are provided. The compounds are contemplated to modulate the NMDA receptor.
US11648249B2
The invention relates to stable pharmaceutical compositions comprising the compound of the below formula, or pharmaceutically acceptable salts, solvates, hydrates or morphological forms thereof
US11648243B2
Provided herein are compounds of the Formula I: or pharmaceutically acceptable salt or solvate thereof, wherein A, B, X1, X2, X3, X4, Ring D, E, Ra, Rb, n and m have the meanings given in the specification, which are inhibitors of RET kinase and are useful in the treatment and prevention of diseases which can be treated with a RET kinase inhibitor, including RET-associated diseases and disorders.
US11648235B1
Methods of treating glioblastoma are provided comprising: administering a therapeutically effective amount of azeliragon, or a pharmaceutically acceptable salt thereof, and co-administering an effective amount of radiation therapy (RT), to a patient who has been diagnosed with glioblastoma. In another aspect, methods are provided for treating grade I, grade II, and grade III gliomas, the method comprising administering a therapeutically effective amount of azeliragon, or a pharmaceutically acceptable salt thereof, and co-administering an effective amount of radiation therapy (RT), to a patient who has been diagnosed with glioma.
US11648232B2
The present invention relates to carbamoyl phenylalaninol compounds and methods of using the same to treat disorders. The invention further relates to the development of methods for treating excessive sleepiness in a subject, e.g., due to narcolepsy or obstructive sleep apnea, with the surprising outcome that “normal” levels of wakefulness are achieved based on standard objective and subjective sleepiness tests.
US11648230B2
A method for reducing macrophage migration inhibitory factor (MIF or MMIF) cytokine or its biological activity, including the step of administering an isothiocyanate functional surfactant to a patient having a disease or condition wherein MIF cytokine or its biological activity is implicated in the disease or condition. In one embodiment, the protonated form of the isothiocyanate functional surfactant is represented by the following chemical structure:
US11648228B2
The present invention provides a method of suppressing hunger by lowering plasma ghrelin levels comprising administration of a compound to a human or animal body, wherein the compound is selected from: (i) (R)-3-hydroxybutyrate; (ii) an ester of (R)-3-hydroxybutyrate; and (iii) an oligomer of (R)-3-hydroxybutyrate moieties; or a pharmaceutically acceptable salt or solvate thereof. The invention also provides a method of administering such a compound in a dosage effective to reduce hunger in order that a cosmetically beneficial loss or maintenance of body weight occurs, wherein in the method, plasma ghrelin levels are lowered. The aforementioned compound is also provided for use in a method of treatment of the human or animal body wherein the compound is administered and hunger is suppressed by lowering of plasma ghrelin levels. The compound is particularly useful for subjects having conditions associated with overeating, such as overweight, obese, severely obese patients or diabetic patients.
US11648223B2
Disclosed herein are methods for treating cancer comprising administering at least one immune checkpoint inhibitor and at least one Retinoic Acid Receptor or Retinoid X Receptor active agent.
US11648218B1
Systems and methods for treating a fibrous mass, such as one of a plantar fibroma or related type, are disclosed. In one exemplary implementation, a method may comprise identifying a location of the fibrous mass and non-surgically delivering electromagnetic energy to the fibrous mass. Embodiments may include delivering the energy via an Nd:Yag laser at various specified parameters, such as duration, pulse count, and tissue depth, among others.
US11648210B2
The present disclosure provides compositions which shown preferential targeting or delivery of a nucleic acid composition to a particular organ. In some embodiments, the composition comprises a steroid or sterol, an ionizable cationic lipid, a phospholipid, a PEG lipid, and a permanently cationic lipid which may be used to deliver a nucleic acid.
US11648208B2
Provided are a nanocomposite including a nano-drug delivery system; and a ginseng extract or a ginsenoside isolated therefrom, and a preparation method thereof, in which the nanocomposite may be used for the prevention or treatment of cancer and inflammatory diseases. The metal nanocomposite of the present invention may be prepared in a uniform size without using an additional reducing agent or stabilizing agent in a significantly shortened time, as compared with known metal nanoparticles. Further, since the metal nanocomposite has high solubility in water and high targeting ability for cancer cells, it can be advantageously developed as drugs. Further, the metal nanocomposite exhibits high anti-cancer and anti-inflammatory activities, and thus may be usefully applied to prevention or treatment of cancer and inflammatory diseases. Furthermore, the metal nanocomposite exhibits anti-microbial activity, biofilm-degrading activity, and anti-coagulant activity, and thus may be applied to a variety of industrial fields.
US11648196B2
The invention relates to a cosmetic active ingredient comprising at least one extract of Avena strigosa and at least one extract of Ononis spinosa. The invention also relates to a composition including it, a method for obtaining it and the use of this cosmetic active ingredient, in particular for its anti-graying effect on the hair.
US11648194B2
Disclosed is a topical skin composition. The composition can include water, caprylic/capric triglyceride, Butyrospermum parkii (shea) butter, Helianthus annuus (sunflower) seed oil, cetyl alcohol, glyceryl stearate, and beeswax.
US11648190B2
The present invention provides calcium carbonate-based oral care compositions, in particular toothpastes comprising a thickening system comprising 0.2-0.5 wt. % xanthan gum and 0.2-0.5 wt. % synthetic polyacrylic acid polymer, as well as methods of using these compositions.
US11648188B1
An aerosol cosmetic composition is provided that includes an oil soluble gloss enhancing film forming component, a solvent, a colorant, a propellant, and useful for application to hair or skin. An aerosol dispensing system and a method of preparing an aerosol sprayable color composition are also provided.
US11648183B2
The disclosure relates to a metering apparatus for free-flowing material and to a method for operating such a metering apparatus. The metering apparatus has a metering duct having a closed cross section and further has a rotary drive (M). The metering duct is wound in the form of a screw with a vertical longitudinal axis. The free-flowing material is fed to the metering duct. The metering duct is set via the rotary drive (M) in an oscillating rotary motion about its longitudinal axis with individual rotary strokes, wherein, with each rotary stroke, a partial quantity of the free-flowing material falls out of a lower discharge opening of the metering duct.
US11648177B2
The invention pertains to a container for storing medical and/or pharmaceutical products. The container includes a plastic container body including a side wall, a base and an opening defining the storage volume, an active insert, placed inside the container body and including a tubular side wall of length L, extending from a lower extremity to an upper extremity, and an empty interstice between the side wall of the active insert and the side wall of the container body. This container is an improved container for the storage of medical and/or pharmaceutical products.
US11648173B2
A physical therapy massage ball device includes an elongated tubular sleeve having a massage ball receiving cavity defined between the ends of the sleeve, at least one massage ball, and generally two to six massage balls, received within the massage ball receiving cavity, and a pair of handles extending from each end of the massage ball receiving cavity. The massage ball receiving cavity may include an opening for the user to selectively add or remove massage balls from the massage ball receiving cavity. The tubular sleeve may be formed from elastic material such as spandex and be used to form both the massage ball receiving cavity and the handles.
US11648172B2
Compression garment systems and methods may deliver fluid to one or more fluid cells using a target pressure and an adjustable manifold pressure that may be adjusted to, for example, deliver an amount of fluid to the one or more fluid cells to achieve the desired target pressure. Further, the compression garment systems and methods may provide a graphical user interface depicting a human-shaped graphical element and a compression therapy graphical indication about the human-shaped graphical element. The compression therapy graphical indication may indicate, or show, where on the human-shaped graphical element the compression therapy may be delivered to. Still further, the compression garment systems and methods may include or use a communication interface to determine or identify a compression garment to be used therewith. The identity of the compression garment can be used to configure compression therapy for the compression garment.
US11648168B2
A moving image recording system includes an information processor and a station to and from which the information processor is attachable and detachable. The station includes: a connection unit configured to be connected to the information processor and transmit and receive data to and from the information processor; an acquisition unit configured to acquire subject identification information for identifying a subject of an image; and a control unit configured to send the subject identification information, acquired by the acquisition unit, to the information processor via the connection unit. The information processor includes: a connection unit configured to be connected to the station and transmit and receive data to and from the station; an imaging unit configured to take an image of the subject; a storage unit configured to store a moving image taken by the imaging unit; and a recording controller configured to receive the subject identification information from the station via the connection unit, and write the moving image of the subject, taken by the imaging unit, into the storage unit while associating the moving image with the subject identification information thus received.
US11648167B2
In an illustrative embodiment, an adjustable cradle assembly for adjusting a head position of a patient relative to a patient platform includes a base portion with a pair of vertical support members and a cradle portion. The vertical support members may each include at least one position aperture for setting a vertical height of the cradle portion relative to the base portion. The cradle portion may include a channel for receiving a head fixation ring. The cradle portion may include at least one set of adjustment connection points for aligning with position apertures of each vertical support member. The cradle may be pivotably connected to the vertical support members such that a pitch angle of a head position of a patient secured in the head fixation apparatus may be adjusted. A set of adjustment mechanisms may releasably secure the cradle to the base at a selected lateral and/or pitch position.
US11648160B2
A wheelchair lift with low energy consumption includes a platform assembly to receive a wheelchair. The wheelchair lift includes a hydraulic drive system to move the platform assembly between an entry level position and a ground level position. The wheelchair lift includes a fluid circuit being embodied to transport a hydraulic fluid from a tank using a pump driven by an electric motor to the hydraulic drive system to raise the platform assembly from the ground level position to the entry level position. The fluid circuit is further embodied to transport the hydraulic fluid from the hydraulic drive system via the pump to the tank, when lowering the platform assembly from the entry level position to the ground level position.
US11648153B2
Elasticized absorbent articles containing weakened elasticized portions and methods of manufacture are disclosed. A method comprises applying a first amount of adhesive to a first portion of at least one of the first web of material and the elastic strand, applying a second amount of adhesive to a second portion of at least one of the first web of material and the elastic strand, covering the elastic strand with either the first surface of the first web of material or a first surface of a second web of material to form an elasticized web. The elasticized web comprises a heavy bonding region and a light bonding region, wherein the heavy bonding region comprises a greater area density of adhesive than the light bond region. Finally, the method may further comprise partially weakening the waist panel elastic strand at least at one location within the second region.
US11648145B2
The removable restraint ring receptacle comprises a base for attachment to a furniture piece. The base adapted to receive a ligature resistant fastener. A restraint ring engaged by the fastener. The ligature resistant fastener may be a ball pin lock having a conical or rounded head. The head bearing against the restraint ring. The ligature resistant fastener further comprising a collar adapted to extend from the head to the base. The collar comprising a tapered outside surface adapted to span the gap between the head and the base when the ring is removed thereby providing a tapered protrusion to prevent the attachment of a ligature or snagging of clothes.
US11648143B2
A brace for aligning and protecting a patella. The brace includes a mounting component for mounting the brace to the leg of the user. The brace also includes a first attachment component attached to the mounting component and a second attachment component superposed on the first attachment component. An alignment component for aligning the patella is releasably attached to the mounting component by the first attachment component. A cushioning component for cushioning the patella is releasably attached to the mounting component by the second attachment component. A cryotherapy or thermal therapy component can alternatively be releasably attached to the mounting component by the second attachment component instead of the cushioning component depending on the needs of the user.
US11648142B2
An orthopedic device comprises a body having a monolithic structure and arranged to form a closed circumference in a secured configuration, the body having a predetermined shape in an unsecured configuration. The body is formed continuously without interruption from at least one polymeric material. A method for making the orthopedic device includes providing a schematic including a model representing a body part for which the orthopedic device is intended, providing at least one array of coordinates and indicia corresponding to the coordinates proximate to the model at a plurality of locations along the model, and providing a scale set corresponding to the coordinates. The dimensions obtained from measuring the body part may be used to form a custom-shaped orthopedic device.
US11648139B2
Delivery systems for expandable elements, such as stents or scaffolds having spikes, flails, or other protruding features for penetrating target tissue and/or delivering drugs within a human patient are described along with associated methods for using such systems. The delivery systems can be provided with a stent that is positioned over an inflatable balloon for expansion and delivery of the stent to a target delivery location. By positioning the stent over and about the inflatable balloon, the stent is ready to be expanded by the balloon immediately upon unsheathing with respect to the outer shaft. Additionally or alternatively, a stent can be positioned in an axially offset arrangement with respect to a balloon to reduce the need for space required by overlapping components.
US11648127B2
An orthopaedic surgical instrument system includes a first broach including a first end configured to be separately secured to a handle and a tapered body having a plurality of cutting teeth defined therein, and a second broach including a first end configured to be separately secured to the handle in place of the first broach, a first tapered body extending distally from a second end positioned opposite the first end, and a second tapered body extending distally from the first tapered body. The tapered body of the first broach and the first tapered body of the second broach have a first outer geometry and the second tapered body has a second outer geometry different from the first outer geometry.
US11648126B1
A method and system for femoral condylar resection arthroplasty (FCRA) of the knee, which preserves the undamaged meniscus, whether by arthroscopy or arthrotomy, and only replaces the damaged area of the femoral condyle. In one embodiment, both the distal and posterior femoral condyle are replaced with a two piece femoral two-piece distal and posterior femoral condyle component. This two piece component has a metal piece and a plastic piece removably attached in a tongue and groove arrangement. This arrangement allows the plastic piece to be removed when converting the FCRA into a unicompartmental arthroplasty.
US11648125B2
The present invention relates to a prosthesis, such as a megaprosthesis, for a joint replacement or any segmental bone deficit. In particular, the present invention relates to a stem for a prosthesis having threads on at least part of an outer surface thereof. A prosthesis, such as a megaprothesis, is also provided. The prosthesis contains the threaded stem and a modular body engaged to the stem. The modular body contains a bone replace segment or a replacement joint, such as replacement knee joint, hip joint, shoulder joint, wrist joint, ankle joint, elbow joint, joints of the hand, joints of the foot, etc.
US11648121B2
Delivery devices and methods for delivering a stented prosthesis to a target site are disclosed. Disclosed delivery devices include a handle assembly including an actuator, an inner shaft assembly interconnected to the handle assembly, and are configured to releasably retain the stented prosthesis to the delivery device with at least one elongate tension member. The delivery devices further include a tension management device that is configured to limit the amount of tension that can be applied via the actuator to the at least one tension member. Certain embodiments are configured to apply different tension limits to different tension members that are controlled by a one or more actuators. Other various embodiments include one or more tension adjustors to selectively adjust one or more tension limits.
US11648103B2
The invention relates to an artificial vascular graft comprising a primary scaffold structure encompassing an inner space of the artificial vascular graft, said primary scaffold structure having an inner surface facing towards said inner space and an outer surface facing away from said inner space, a coating on said inner surface, wherein a plurality of grooves is comprised in said coating of said inner surface. The primary scaffold structure comprises further a coating on said outer surface. The primary scaffold structure and the coating on said inner surface and on said outer surface are d designed in such a way that cells, in particular progenitor cells, can migrate from the periphery of said artificial vascular graft through said outer surface of said coating, said primary scaffold structure and said inner surface to said inner space, if the artificial vascular graft is used as intended. The invention relates further to a method for providing said graft.
US11648101B2
Embodiments related to surgical anchors are described. In some embodiments, a surgical anchor may include a selectively removable blocker which may prevent one or more barbs of the surgical anchor from engaging with adjacent tissue until the selectively removable blocker is removed.
US11648099B2
An actuator (12) for a personal care appliance (10) having an eccentric core (21) to preload the actuator (12) to prevent rattling caused by detrimental reactionary forces. The eccentric core (21) includes a pole assembly (24) radially extending from a spindle 22 having at least a first set (25-1) and a second set (25-2) of pole members. The first set (25-1) has a greater length as measured from the center of the spindle 22 than the second set (24-2), reducing the magnet gap on one side of the spindle (22) to create an eccentric core and preload the actuator (12). Alternatively, the preload can be mechanically created by a set of bearings (28) disposed within housing (18) of the actuator 12, where the bearings (28) have a centerline (A3) offset from the principal axis (A1) of the housing (18).
US11648096B2
A method for the computer-aided editing of a digital 3D model (1) of a dental object using digital tools (T1, T2, T3) provides for the identification of different dental-specific regions (R1, R2, R3) of the 3D model (1) that are affected by the tool (T1, T2, T3) in different ways, for computation of the effect on the whole 3D model and for display thereof as a proposal model (2) together with the 3D model (1). The proposal model (2) is then rejected or accepted in part or in full. If it is accepted in part, at least one subregion of the 3D model (1) is selected as a region (10) and a result model (6) is formed from the 3D model (1) and the proposal model (2) by virtue of the 3D model (1) being taken as the starting point for replacing the selected region (10) or at least a central portion of the selected region (10) with a corresponding region of the proposal model (2) or approaching the latter using a strength factor (S).
US11648095B2
An intra-oral scanning device includes a light source and an optical system, and communicates with a display system. The device has a reduced form factor as compared to prior devices, and it provides for more efficient transmission and capture of images.
US11648091B2
Multilayer polymer sheets are provided, as well as related methods, systems, and appliances.
US11648086B2
Methods of fabricating orthodontic appliances are provided. In some embodiments, a method includes determining an appliance geometry for an orthodontic appliance. The appliance geometry can include a plurality of power arms including a first power arm having a first connection point for connecting to a shell, and a second power arm having a second connection point for connecting to the shell or a tooth. The appliance geometry can also include an elongate connecting structure coupled to the first and second power arms, and an elongate counter-force connector coupled to the first power arm and extending toward the second power arm. The elongate connecting structure and the elongate counter-force connector can be coupled to the first power arm at respective locations separate from the first connection point. The elongate connecting structure can be coupled to the second power arm at a location separate from the second connection point.
US11648079B2
An apparatus for surgical lighting is disclosed. The apparatus includes a light emitting element formed with a light source encapsulated within an outer layer. The outer layer includes a biocompatible material. A power supply is coupled to the light source. The apparatus includes an actuating mechanism that controls power from the power supply to the light source to emit light along a surgical area. The light emitting element provides enhanced illumination and other surgical advantages.
US11648076B2
Systems and methods for controlling an elongate device include a console. The console includes a first recess and a removable first input control for controlling motion of the medical device. The console also may include one or more first sensors located about the first recess that detect motion of the first input control and detect operator contact with the first input control. The console also may include an integrated display screen arranged to display status information for the medical device. In some embodiments, the first input control controls an insertion depth or steering of the medical device, and may be in the form of a scroll wheel forming a part of a removable control assembly.
US11648073B2
A method of operating a robotic control system comprising a master apparatus in communication with a plurality of input devices having respective handles capable of translational and rotational movement and a slave system having a tool positioning device corresponding to each respective handle and holding a respective tool having an end effector whose position and orientation is determined in response to a position and orientation of a corresponding handle. The method involves producing desired new end effector positions and orientations of respective end effectors in response to current positions and orientations of corresponding handles, using the desired new end effector positions and orientations to determine distances from each point of a first plurality of points along a first tool positioning device to each point of a plurality of points along at least one other tool positioning device, and determining and notifying that any of the distances meets a proximity criterion.
US11648069B2
The disclosure relates to a system for tracking the position of a target object. A marker arranged on the target object and an additional control marker are tracked by a tracking device secured to the robot arm. The control marker is arranged in a known specified three-dimensional positional relationship with the tracking device. During the tracking of the position of the target object, the specified three-dimensional positional relationship between the tracking device and the control marker is measured. In the event of a difference between the measured and the real specified three-dimensional positional relationship, a corresponding signal is generated depending on the difference.
US11648067B2
A medical manipulator according to one or more embodiments may include: a first manipulator arm with multi-degree of freedom that holds a medical tool at a distal end portion thereof; a second manipulator arm with multi-degree of freedom that holds a medical tool at a distal end portion thereof; an arm base that holds base end portions of the first and second manipulator arms; a movement mechanism configured to move the base end portion of the first manipulator arm with respect to the arm base to change a distance between the base end portion of the first manipulator arm and the base end portion of the second manipulator arm; and a positioner configured to move the arm base and position the arm base in place.
US11648062B2
A system for controlling ablation treatment and visualization is disclosed where the system comprises a tissue ablation instrument having one or more deployable stylets and a first electromagnetic sensor and an ultrasound imaging instrument which may be configured to generate an ultrasound imaging plane and further having a second electromagnetic sensor. An electromagnetic field generator may also be included which is configured for placement in proximity to a patient body and which is further configured to generate an output indicative of a position the first and second electromagnetic sensors relative to one another. Also included is a console in communication with the ablation instrument, ultrasound imaging instrument, and electromagnetic field generator, wherein the console is configured to generate a representative image of the tissue ablation instrument oriented relative to the ultrasound imaging plane and an ablation border or cage based upon a deployment position of the one or more stylets.
US11648057B2
A catheter system for treating a treatment site within or adjacent to a vessel wall or a heart valve, includes a light source, a balloon, a light guide and an optical analyzer assembly. The light source generates first light energy. The balloon is positionable substantially adjacent to the treatment site. The balloon has a balloon wall that defines a balloon interior that receives a balloon fluid. The light guide receives the first light energy and guides the first light energy in a first direction from a guide proximal end toward a guide distal end positioned within the balloon interior. The optical analyzer assembly optically analyzes a second light energy from the light guide that moves in a second direction that is opposite the first direction. The optical analyzer assembly includes a safety shutdown system to inhibit the first light energy from being received by the guide proximal end of the light guide.
US11648050B2
An instrument for coagulation and dissection of biological tissue including a tool with coagulation electrodes and at least one cutting electrode. The electrodes are actuated via an operating circuit including an evaluation circuit, to which an external apparatus delivers an evaluation signal with first and second half-waves having opposite polarities. During at least one first half-wave, the evaluation circuit checks whether a first switch or a second switch are actuated on the instrument. Depending on the evaluation result, a triggering signal is transmitted to a switching unit. Depending on the triggering signal, the switching unit is switched into a first or second switching state. In the second switching state, no voltage suitable for dissection and no current suitable for dissection, respectively, is applied to the cutting electrode. In the first switching state, a voltage suitable for dissection or a current suitable for dissection is applied to the cutting electrode.
US11648042B2
A method, system and device for securing conductive material on catheter elements for tissue sensing and cryogenic ablation. This may be used to deposit or embed conductive material onto or within polymeric materials. The method of manufacturing a balloon with conductive material may include extruding a polymeric material where the polymeric material includes embedded electrically conductive material. At least a portion of the polymeric material may be removed to expose at least a portion of the embedded electrically conductive material. The benefits may include allowing local bipolar recordings, contact assessment and ice thickness, and compatibility with 3-dimensional electroanatomical mapping systems.
US11648037B2
A “vascular-safe” pedicle screw and extension-ready spinal support system. The pedicle screw includes a self-tapping flute that recessed into a threaded shaft to define terminations of the threads at a face of said self-tapping flute. The terminations are curved to define a convex profile that extends from a root to a crest of the threads at said face of said self-tapping flute. The curved terminations tend to push soft tissue aside as opposed to slicing or tearing through the soft tissue, so that the self-tapping flute is less likely to slice into vascular vessels. The distal portion of the pedicle screw may also include depressions that reduce the circumferential contact area of the pedicle screw in the direction of rotation, which increases the applied pressure to the soft tissue for a given applied rotational force. The increased pressure augments penetration of the pedicle screw through tissue without resort to sharp cutting edges.
US11648035B2
A plurality of three-dimensional fixator graphical representations may include graphical indications of a strut swap range. A plurality of replaced strut graphical representations may change from a first rendering state in a swap start fixator graphical representation to a second rendering state in a swap end fixator graphical representation. A plurality of replacement graphical representations may change from the second rendering state in the swap start fixator graphical representation to the first rendering state in the swap end fixator graphical representation. In some examples, the plurality of replaced strut graphical representations may gradually fade out from a swap start stage to a swap end stage, and the plurality of replacement strut graphical representations may gradually fade in from a swap start stage to a swap end stage. Additionally, a treatment plan including at least one interfamily strut swap may be generated for manipulating a fixator to correct a deformity.
US11648033B2
The present invention comprises methods and devices for providing contrast medium for sonography of structures such as ducts and cavities. The invention provides for creation of detectable acoustic variations between two generated phases of a gas and a liquid to make a contrast medium. Sonography is the primary means of imaging but other conventional detection means may also be employed with the present invention.
US11648032B2
The present disclosure refers to an implant needle (1) for introducing an implant into a body of a patient, comprising a receiving portion configured to receive an implant and provided in a hollow needle main body (2), and a taper-shaped tip portion (3). The taper-shaped tip portion (3) is further comprising: a first slant surface (14a) contiguous to a first outer peripheral surface (15) of the hollow needle main body (2), wherein the first slant surface (14a) is provided as a first non-cutting edge; a second slant surface (16a) contiguous to a second outer peripheral surface (17) of the hollow needle main body (2), wherein the second slant surface (16a) is provided as a second non-cutting edge; and a pair of sharpened surfaces (9a, 9b) symmetric with respect to an edge point (10) and a longitudinal axis (13) of the needle main body (2), wherein the sharpened surfaces (9a, 9b) are both provided with a cutting edge. The first slant surface (14a) comprises a first flank (14b), and the second slant surface (16a) comprises a second flank (16b), wherein the first flank (14b) is provided at a first distance from the edge point (10) and the second flank (16b) is provided at a second distance from the edge point (10) which is different from the first distance.
US11648031B2
Disclosed are steerable needles having a shaft that can be controllably buckled, a steering head positioned at a distal end of the shaft, a transmission for controlling the orientation of the steering head, and a base at the end of the shaft, the base optionally comprising a controller for controlling the transmission. Also disclosed are methods of using the disclosed steerable needles.
US11648029B2
Devices and methods may allow for the removal of material from a remote location in the vasculature. In an example of such a remote location, the device may be used in the vasculature of a lower extremity in combination with an external cuff. The external cuff may create a dam preventing material from flowing throughout the body. With the external cuff in place, the device of the present disclosure may be utilized to suction the material from the vasculature while rotating the catheter to assist in the removal of the material.
US11648022B2
A surgical instrument system comprising a handle, a shaft, and a disposable power module is disclosed. The handle comprises a motor, a control switch, and a motor-control processor which is in communication with the control switch. In various instances, the disposable power module comprises a disposable battery and a display unit configured to indicate at least one function of the surgical instrument system.
US11648017B2
A drill guide, including: frustoconical body with a first opening at a narrower distal end and second opening at a wider the proximal end; a first support with a first end connected to the frustoconical body and a second end; a zero angle guide with an opening aligned with the first opening and wherein the zero angle guide is connected to the second end of the first support.
US11648014B2
A surgical clip may include first and second leg members, each having inner surfaces. The inner surface of the first leg member may be concave and the inner surface of the second leg member may be convex. The surgical clip may include a first locking member positioned on a distal end portion of the first leg member, and a second locking member positioned on a distal end portion of the second leg member. The surgical clip may also include a third locking member position between a proximal end portion and the distal end portion of the first leg member, and a fourth locking member positioned between a proximal end portion and the distal end portion of the second leg member. The first and second locking members, and the third and fourth locking members may be configured to interact to secure the surgical clip in a closed configuration.
US11648013B2
Provided herein is an occlusion device comprising: (a) a substantially solid marker band having an inner and outer diameter, a proximal end, and a distal end; and (b) a resilient mesh body attached within the marker band, wherein the body is a length y, and wherein the body comprises a bolus of additional resilient mesh material of a length x, wherein y is greater than x, and wherein the body extends distally from the marker band having a first delivery shape and a second expandable deployed shape. Also provided herein is a kit comprising the occlusion device disclosed herein and a means for delivery thereof. Methods of manufacture and use of the occlusion device disclosed herein are also disclosed.
US11648009B2
A surgical instrument comprising a first jaw and a second jaw is disclosed. At least one of the first and second jaws comprises a proximal portion and a distal tip rotatable relative to the proximal portion.
US11647994B2
The device for the storage and traceability of biological specimens placed in holders is provided with identification information in the form of encoded data. The device includes at least one tray provided with a plurality of cells for the storage of the holders provided with storage housings for the holders, at least one apparatus for reading encoded data and determining data relative to the location of each holder within the receptacle, and a computerized processor for the data read and determined by the apparatus. The is a device for recognizing an empty housing within the receptacle defined by a detector for a physical characteristic of the bottom of the cell or an element secured to this bottom.
US11647986B2
Provided are an ultrasound diagnosis apparatus connected to wireless ultrasound probes and a method of operating the ultrasound diagnosis apparatus. The ultrasound diagnosis apparatus includes: a communicator connected with a plurality of different wireless probes through a wireless communication method by receiving pairing reception signals from the plurality of wireless ultrasound probes; a controller configured to control the communicator to wirelessly connect the ultrasound diagnosis apparatus with the plurality of wireless ultrasound probes and to wirelessly receive status information regarding the connected plurality of wireless ultrasound probes; and a display configured to display a user interface (UI) indicating the received status information regarding the plurality of wireless ultrasound probes.
US11647984B2
A gel application system includes an applicator body having a first surface, a second surface and at least one opening extending through the applicator body from the first surface to the second surface. At least one gel packet is attached to the first surface of the applicator and defines an interior volume containing gel. The interior volume of the gel packet is in fluid flow communication with the at least one opening. The at least one gel packet is made of a material that has sufficient flexibility to allow a user to squeeze and compress the interior volume and expel gel through the at least one opening, by applying a compression force on the gel packet.
US11647975B2
A radio therapy system includes a first x-ray source. The first x-ray source is configured to produce first x-ray photons in a first energy range suitable for imaging and project the first x-ray photons onto an area designated for imaging. The system includes a second x-ray source configured to produce second x-ray photons in a second energy range higher energy than the first energy range, produce third x-ray photons in a third energy range higher energy than the first energy range, project the second x-ray photons onto the area designated for imaging, and project the third x-ray photons onto an area designated for treatment. The system includes an analytical portion configured to collect and combine data to create a composite output including at least one image, the combining based in part on a spectral analysis.
US11647961B2
An electronic device and method for measuring user body information are provided. The method for measuring user body information includes detecting a contact of a user's body portion on at least two spots of a touch screen of the electronic device, upon detecting the contact of the user's body portion on the at least two spots of the touch screen, applying power to a first coil in the electronic device, and measuring the user body information using at least one of a voltage and a second current measured after a first current is induced across the user's body by a first magnetic field generated from the first coil as the power is applied.
US11647955B2
A mounting element (8) for releasably receiving a sensor (18) for transferring and/or receiving electrical currents and/or signals relating to a body of an organism, comprising a mounting element base (9) having a receiving space (17) for receiving the sensor (18), the receiving space (17) comprising a floor (19), a wall (16) disposed on the floor (19) and disposed on at least three sides, an opening (20) formed by at least one tab (21, 22), at least one clip closure (23, 24), and further comprising a cover (10) for the mounting element base (9), an at least three-sided wall being disposed on the inner side (11) thereof, the end face (30) thereof being implemented for contacting the end face (41) of the wall (16), wherein at least one counterpart (28, 29) to the at least one clip closure (23, 24) is disposed on the wall (27), and the mounting element base (9) and the cover (10) are connected to each other by a connecting element (13) such that the cover (10) is displaceable relative to the mounting element base (9), and the mounting element base (9) and the cover (10) are therefore lockable to each other by means of the at least one clip closure (23, 24) and the at least one counterpart (28, 29) and can also be opened again.
US11647945B2
An evaluating apparatus of this application includes a detector configured to detect a biological signal of a user, and a controller configured to calculate an amount of activity of the user from the biological signal, determine whether the user is sleeping during a first period by comparing the amount of activity with a low threshold, and determine whether the user is sleeping during a second period after the first period by comparing the amount of activity with a high threshold, the low threshold being lower than the high threshold.
US11647942B1
A device and method for monitoring a human heart rate to determine whether a bradyarrhythmia event has occurred and if so determined, an electrocardiogram (ECG) rhythm strip is begun to be generated on a continuous basis in real-time and wirelessly communicated to a third party such as the patient's treating physician. The method comprises a pair of sensors for detecting heart rate, each sensor in contact with a respective ear of the patient. If a bradyarrhythmia event is determined; applying an anticholinergic medication to the conjunctiva of at least one eye and releasing ammonia vapor for inhalation by the patient.
US11647940B2
Described herein are methods, devices, and systems that improve arrhythmia episode detection specificity, such as, but not limited to, atrial fibrillation (AF) episode detection specificity. Such a method can include obtaining an ordered list of R-R intervals within a window leading up to a detection of a potential arrhythmia episode, determining a measure of a dominant repeated R-R interval pattern within the window, and comparing the measure of the dominant repeated R-R interval pattern to a pattern threshold. If the measure of the dominant repeated R-R interval pattern is below the pattern threshold, that is indicative of a regularly irregular pattern being present, and there is a determination that the detection of the potential arrhythmia episode does not correspond to an actual arrhythmia episode. Such embodiments can beneficially be used to significantly reduce the number of false positive arrhythmia detections.
US11647933B2
Provided is a biological information detection device capable of restraining noise from being mixed with a signal relating to biological information. A biological information detection device includes an electrode pad that is able to detect a signal (bioelectric signal) relating to biological information of a subject (for example, a fetus in a mother's body), a connector that is connectable to the electrode pad, and a cable that is connected to the connector and is able to transmit the signal. The electrode pad and the connector are provided with fixing members and that are attachable to and detachable from each other, respectively.
US11647931B2
A physiological signal collection electrode comprising a signal collection portion, a signal output terminal and a signal transmission portion interconnecting the signal collection portion and the signal output terminal, wherein the signal collection portion comprises a signal collection pad and the signal transmission portion comprises a signal transmission pad, wherein the signal collection portion and the signal transmission portion are integrally formed into an elongate and conductive electrode pad which extends in a longitudinal direction along a longitudinal axis; wherein the signal collection portion has a signal collection surface for making abutment contact with a signal surface and the signal collection surface is parallel to the longitudinal axis; and wherein the signal output terminal is parallel to the signal collection surface, extends transversely to the longitudinal axis and protrudes above the signal collection surface.
US11647928B2
The objective of the present invention is to provide a biomagnetism measuring device with which it is possible for a magnetic sensor to be disposed in an optimal position in accordance with an object being measured. A biomagnetism measuring device (1) according to the present invention is provided with: a plurality of magnetic sensors (11) which detect biomagnetism; and a holding portion (12) in which are formed frames (13) which detachably hold the plurality of magnetic sensors (11) in such a way as to face a living body. Further, the biomagnetism measuring device (1) according to the present invention is provided with: a plurality of magnetic sensors (11) which detect biomagnetism; and a holding portion (12) in which are formed rails (16) which movably hold the plurality of magnetic sensors (11) in such a way as to face a living body.
US11647918B2
In a method and apparatus for determining an examination duration tolerable by a patient in and/or on a diagnostic examination device, the patient to be examined is observed at least in a preliminary stage of the examination concerned, during which measurement parameters are ascertained. From the measurement parameters, an algorithm determines a statement about the dwell capability of the patient in the examination device. The algorithm can be an artificial neural network.
US11647917B2
A subject support (14) is configured to dock with a medical imaging device (50) with a fixed spatial relationship between the docked subject support and the medical imaging device. A patient positioning device includes a range camera (10) that acquires a two-dimensional (2D) range image of a human imaging subject (12) disposed on a subject support (14). The range image has pixel values corresponding to distances from the range camera. An electronic processor (16) is programmed to perform a positioning method to determine a reference point on or in the human subject in a frame of reference (FS) of the subject support from the 2D range image. This reference point is translated to a frame of reference (FD) of the imaging device based on a priori known spatial relationship of the medical imaging device and the docked subject support. Using 3D models, the loading process may be simulated.
US11647905B2
A system for optical coherence tomography includes a source of optical radiation, an optical fiber, and a graded index fiber attached to a distal end of the optical fiber. The optical fiber and the graded index fiber are together configured to provide a common path for optical radiation reflected from a reference interface at a distal end of the graded index fiber and from a target.
US11647903B2
In some embodiments, techniques for using machine learning to enable visible light pupilometry are provided. In some embodiments, a smartphone may be used to create a visible light video recording of a pupillary light reflex (PLR). A machine learning model may be used to detect a size of a pupil in the video recording over time, and the size over time may be presented to a clinician. In some embodiments, a system that includes a smartphone and a box that holds the smartphone in a predetermined relationship to a subject's face is provided. In some embodiments, a sequential convolutional neural network architecture is used. In some embodiments, a fully convolutional neural network architecture is used.
US11647895B2
A protective cover set for a medical probe that includes a joint that seals both a moisture resistant probe cover and a surrounding wrapper that provides a barrier against microbial intrusion into the space between the outer wrapper and the probe cover. The sealed joint fixes the probe cover in place in relation to the outer wrapper. In some examples, the sealed joint secures a prefabricated probe cover with a three-dimensional non-planar shape in relation to the outer wrapper.
US11647893B2
An endoscope includes an insertion observation portion including a distal end portion to be inserted into a target object; an objective lens portion disposed on the distal end portion of the insertion observation portion and includes a lens; a holding member that holds the objective lens portion; a sheath that covers the objective lens portion and the holding member; and a sealing material that is disposed on an outer circumference of the objective lens portion and that shields light. A part of the sealing material is disposed on an inner side of a recessed portion of the lens and forms a diaphragm portion that widens a depth of field of the endoscope.
US11647881B2
A cleaning apparatus includes a combing unit including a series of spaced protrusions or teeth extending into a cleaning roller for preventing build up and removing debris (such as hair, string, and the like). The protrusions extend along a substantial portion of the cleaning roller and extend partially into the cleaning roller to intercept the debris as it passes around the roller. The protrusions have angled leading edges that are not aligned with a rotation center of the cleaning roller and are directed into or against a direction of rotation of the cleaning roller. The combing unit and protrusions have a shape and configuration designed to facilitate debris removal from the cleaning roller with minimal impact on the operation of the cleaning apparatus. The cleaning apparatus may include a surface cleaning head of an upright vacuum cleaner or sweeper or a robotic vacuum cleaner.
US11647874B2
A raised toilet seat has a front part (2) and two wings (3, 4) of which the ends are, before the raised seat is fitted, separated by a gap. The wings (3, 4) at their free ends bear, in the case of one of them (3), a channel section equipped with notches (9, 10), and, in the case of the other (4), an opening (12) to accept the channel section, and ridges (13, 14, 15, 16) to retain the notches (9, 10).
US11647861B2
A cooking system includes a housing defining a hollow chamber configured to receive food, a controller configured to operate the cooking system in a plurality of modes including a conductive cooking mode and a convective cooking mode, a first temperature sensor operable by the controller to detect temperature in the hollow chamber during the conductive cooking mode, and a second temperature sensor operable by the controller to detect temperature in the hollow chamber during the convective cooking mode. The controller is configured to receive an initial user input that initiates at least one of the conductive cooking mode and the convective cooking mode and switch between operation of the first temperature sensor and the second temperature sensor following the initial user input and without further user input.
US11647858B2
A garment hanger has a body for supporting a garment and an attachment mechanism for coupling the garment hanger to a garment rod. The attachment mechanism is mounted on a top central portion of the body and has a first semi-circular ring member, a second semi-circular ring member, a bracket, and a spring means. Each semi-circular ring member has a first end and a central aperture in proximity to a second end. The bracket has a central horizontal portion and two vertical portions on opposite sides of the central horizontal portion. The first and second semi-circular ring members are mounted in a mirrored direction between the two vertical portions by a shaft passing through a central aperture in each of the two semi-circular ring members. The spring means is coupled to force the first ends of the two semi-circular ring members towards each other.
US11647857B2
A drink cup includes a body formed to include an interior region providing a fluid-holding reservoir and a brim. The brim is coupled to the body to form an opening into the interior region. The body includes a floor and a side wall that extends away from the floor. The drink cup further includes a body-strengthening system coupled to the body.
US11647851B1
Disclosed is a bedding apparatus. The bedding apparatus comprising: a snuggle bedsheet adapted to fit over a mattress, wherein the snuggle bedsheet comprises: a sheet fabric adapted to cover a top portion of the mattress; an attachment fabric having a top end and a bottom end such that the top end of the attachment fabric is attached to the sheet fabric to enclose the mattress; and a spandex sheet attached at a middle area of the sheet fabric, comprising two longitudinal sides and two lateral sides, wherein the longitudinal sides are stitched to the sheet fabric and are longer than the lateral sides, wherein both lateral sides are configured to be open at all times.
US11647841B2
Modular seat assembly having a female connector that is positioned and configured to releasably connect to a corresponding male stud connector on an adjacent seat module. Each female connector includes a plate comprising a raised portion defining an upper opening leading to a downwardly angled channel extending at about 20 degrees to about 70 degrees from a vertical axis into a horizontal portion, such that each male stud connector is slidably and releasably connectable to each corresponding female connector, and such that the channel and the horizontal portion have a width that is narrower than a head of the male stud connector, but wider than a neck of the male stud connector; and wherein said male stud connector is configured to be guided downward by said channel and then loosely contained within said horizontal portion.
US11647836B2
A slide rail kit is applicable to a rack. The rack includes at least one mounting structure having a first predetermined portion and a second predetermined portion. The slide rail kit includes a rail member and a supporting bracket. The supporting bracket is arranged on the rail member and includes a first mounting feature and a second mounting feature. The first mounting feature is configured to be mounted to the first predetermined portion of the rack. The second mounting feature includes an elastic member and a mounting member arranged on the elastic member. The mounting member can be mounted to the second predetermined portion of the rack in response to an elastic force of the elastic member.
US11647832B2
A cabinet assembly including a first frame having a first open channel, a second frame spaced from the first frame with the second frame having a second open channel, and a plurality of beams extending between the first and second frames and interlocking to each of the first and second frames. Each of the beams include a bottom side, a top side opposite the bottom side, and a pair of opposing recessed portions extending from the top and bottom sides. Each of the recessed portions has an upper surface and a lower surface with the upper surface being disposed below the top side. A portion of the bottom side and the entire recessed portion is disposed within the first open channel. The top side is disposed outside the first open channel to interlock the beam to the first and second frames.
US11647828B2
A transformable floor chair has a seat and a back. The seat has straps for carrying the chair when transformed into a transportation configuration. The straps are located on the underside of the seat when in a deployed configuration. A backpack including zippered enclosure is affixed to the rear of the floor chair back. The backpack remains usable and functional when in either the transportation configuration or the deployed configuration. When transformed into the transportation configuration, the upper portion of the seat is secured to the front face of the chair back, thereby sandwiching the chair between the straps and the backpack.
US11647826B2
A hammock assembly is provided and includes, a hammock, a zipper fastening system and a cover and dual cover suspension lines. The hammock may be a bridge hammock using dual spreader bars to maintain the hammock in an expanded configuration. The dual cover suspension lines suspend the cover with a horizontal generally planar portion of the cover between the dual cover suspension lines, thereby providing an expansive canopy.
US11647824B2
Provided herein may be a cosmetic container including a main body configured to store cosmetics therein; a cover configured to open and close a first side of the main body; and a hinge part configured to hingedly connect the cover to the main body. The hinge part includes a shaft insert part protruding from an upper end of the main body, with a hinge shaft being inserted into the shaft insert part; and a shaft coupling part depressed in the cover to be at a position corresponding to the shaft insert part, and securing both ends of the hinge shaft.
US11647823B2
A cosmetic material feeding container includes a sleeve that is configured to accommodate a cosmetic material, a barrel that is engaged with the sleeve, a moving body that is accommodated in the sleeve and has a male screw on an outer periphery of the moving body, a screw in which a female screw to be screwed with the male screw is formed on an inner periphery of the screw, and a tail plug that is engaged with the barrel, relatively rotatable with the barrel, and is engaged with the screw. An enlarged diameter portion of the moving body is configured to contact with a spring portion of the screw from an inner side when the enlarged diameter portion comes to a position at which inward bending of the spring portion in a radial direction is restricted.
US11647816B2
A clasp mechanism is disclosed. Example embodiments are directed to a clasp mechanism comprising: an outer tube; an end cap attached at a top of the outer tube; an inner tube encompassed by the outer tube, the inner tube having a beveled edge at the top; a spring and a plate captured between the end cap and the beveled edge of the inner tube; a slotted end-cap at the bottom of the outer tube; and a hook configured for insertion into a slot of the slotted end-cap, to latch to the beveled edge of the inner tube, and to be held in place by the spring and plate.
US11647807B2
Climbing shoe comprising: a shoe-upper shaped to accommodate and substantially cover the entire foot of the user; a polymeric-material sole fixed to the bottom of the shoe-upper so as to cover the front part of the bottom of said shoe-upper; and a sagittal tensioning band made of elastomeric material, which connects the toe of the shoe-upper directly to the rear part of the shoe-upper, in the area above the Calcaneus of the user's foot, passing underneath the sole; the sagittal tensioning band being substantially Y-shaped, so as to extend longitudinally along the tarsus-phalangeal portion of the bottom of the shoe-upper while remaining underneath the sole, and then forking into two branches that extend obliquely along the two lateral sides of the shoe-upper, up to reach the rear part of the shoe-upper.
US11647803B2
A method of manufacturing a bra, comprising providing a first fabric layer as an outer layer, a second fabric layer as an inner layer, and a material made of thermo-adhesive polyurethane film that joins elements between the two fabric layers in a finished bra; sprinkling the first fabric layer on a side facing the second fabric layer with a reactive hotmelt polyurethane glue, which is reactivated only once; applying the thermo-adhesive polyurethane film on a side of the second fabric layer facing the first fabric layer; superimposing the two fabric layers such that the side of the first fabric layer covered with the glue faces the second layer and the thermo-adhesive polyurethane film portions applied to the second fabric layer face the first fabric layer; joining the two layers by hot-pressing with the thermo-adhesive polyurethane film portions, and reactivating the polyurethane glue to become temporarily in a liquid phase and triggering a cross-linking process causing the glue to solidify permanently.
US11647789B2
A heating wire assembly including a heating wire and a plurality of fixing screws configured to fix the heating wire. When in repair or maintenance, the plurality of fixing screws is screwed out from the heating wire thereby facilitating the replacement of the heating wire.
US11647787B2
A clearomizer, including a seal plug, an e-liquid tank, a silicone base, a first silicone seal, a steel casing, and an atomization core. The seal plug is disposed on a first end of the e-liquid tank to seal an e-liquid inlet of the e-liquid tank. The silicone base is disposed on a second end of the e-liquid tank. The first silicone seal is disposed on one end of the atomization core. The atomization core passes through the silicone base and is fixed in the e-liquid tank. The steel casing is disposed on the second end of the e-liquid tank.
US11647784B1
A cannabis storage assembly includes a cannabis grinder and a canister that is releasably engaged to the cannabis grinder such that the canister is vertically oriented on the cannabis grinder. The canister has a tunnel to insertably receive a rolled cigarette for storage. Furthermore, each of the cannabis grinder and the canister has a diameter sufficient for positioning in a cup holder in a vehicle. The canister including a plurality of storage containers each removably integrated into the canister to contain accessories for rolling cigarettes. An ashtray is positionable on the canister and a lid is positionable on the ashtray for closing the ashtray. A rolling tray, comprised of a deformable material, is provided such that the rolling tray can be rolled into a tube for storing in a respective one of the storage containers.
US11647782B2
A conical rolling paper assembly for rolling a cigarette includes a rolling paper for rolling into a cigarette for smoking. The rolling paper is pre-formed into a conical shape having a narrow end that has a diameter is less than a wide end. Moreover, the rolling paper is rollable into a cone of a pre-determined diameter for having smoking material placed therein. The wide end of is inhaled through by a user and the narrow end is ignited for smoking. A filter is insertable into the wide end when the smoking material is positioned in the cone defined by the rolling paper. The filter has an air aperture extending therethrough to be inhaled through by the user for smoking the smoking material in the rolling paper.
US11647781B2
A smoking article may include a cigarette incorporated within an electrically powered aerosol generating device that acts as a holder for that cigarette. The smoking article possesses at least one form of tobacco. The smoking article also possesses a mouth-end piece that is used by the smoker to inhale components of tobacco that are generated by the action of heat upon components of the cigarette. A representative smoking article possesses an outer housing incorporating a source of electrical power (e.g., a battery), a sensing mechanism for powering the device at least during periods of draw, and a heating device (e.g., at least one electrical resistance heating element) for forming a thermally generated aerosol that incorporates components of tobacco. During use, the cigarette is positioned within the device, and after use, the used cigarette is removed from the device and replaced with another cigarette.
US11647780B2
A system and method for applying a reduced sugar coating to a food product is provided. The system uses separate applications (simultaneous or sequential) of a non-sucrose carbohydrate syrup from a first applicator and a sucrose syrup from a second applicator. The dual applications of the syrups are applied without an active drying step between applications. The process results in a coated food product with reduced clumping and a desired crystallized appearance even with the reduced levels of sugar.
US11647768B2
A process of forming a treated clay composition, a process of decaffeination, and a treated clay composition are shown. The process of forming the treated clay composition includes providing a first solution of caffeine molecules and non-caffeine molecules, extracting the caffeine molecules to form a pretreatment solution, and bringing a clay composition into contact with the pretreatment solution to form the treated clay composition, on which at least one of the non-caffeine molecules is adsorbed. The process of decaffeination includes providing a solution of caffeine and non-caffeine molecules, and bringing the solution into contact with a treated clay composition. The treated clay composition includes organic molecules adsorbed on mineral layers of a clay. The organic molecules are non-caffeine molecules from a pretreatment solution.
US11647764B2
A confectionery item for applying an edible temporary tattoo to a person's tongue, including a release medium and an edible substrate configured to be insertable into the person's mouth, the release medium being securable to the substrate and coated with a layer of edible hardener onto which a transfer is printed, wherein the transfer is a representation formed of edible ink printed onto the layer of edible hardener and configured to be transferred to the person's tongue during contact therewith.
US11647763B2
The invention relates to a process to manufacture a water-in-oil emulsion, comprising ⋅10 to 85 wt. % of liquid oil; ⋅0.5 to 50 wt. % of fat powder comprising hardstock fat; ⋅10 to 85 wt. % of a water-phase; ⋅0.005 to 5 wt. % of lecithin; and ⋅0.01 to 5 wt. % of monoglyceride; comprising the steps of: 1. providing a solution of at most 5 wt. % of the liquid oil, based on the total amount of liquid oil, comprising at least 50 wt. % of dissolved lecithin, based on total amount of lecithin; and at least 50 wt. % of dissolved monoglyceride, based on total amount of monoglyceride; wherein the temperature of the solution is at least 50 degrees Celsius; 2. providing an oil-continuous system comprising at least 75 wt. % of the liquid oil, based on the total amount of liquid oil, wherein the system has a temperature of from 0 to 20 degrees Celsius; 3. contacting the solution provided at step ‘I’ with the system provided at step ‘2’; 4. mixing the mixture provided at step ‘3’ to provide a water-in-oil emulsion; wherein any remaining ingredients are added whole at step ‘2’, step ‘3’ or step ‘4’ or added in parts in any combination at step ‘2’, step ‘3’ and step ‘4’. The process of the invention results in water-in-oil emulsions with an improved stability and a reduced batch-to-batch variation in stability.
US11647760B2
The present invention includes a method and meat product made by contacting an emulsion with a meat product for a time sufficient to, wherein the emulsion comprises by weight: 10% to 50% water, 0.1 to 4.0% Quillaja, 0.1% to 8% meat flavoring, 60% to 85% high oleic sunflower oil, meat seasoning, 0-2.0% salt, and optionally one or more stabilizers.
US11647759B2
The present invention relates to a closed processing system for treating elongated food products, comprising: a housing bounding a process space, a transport path for displacing the elongated food products through the process space, at least one airflow generator for generating an airflow in the process space, and at least one detector for detecting process conditions in the process space, wherein the detector includes at least one pressure sensor for detecting the relative airflow pressure in the process space compared to the ambient air pressure and wherein the system is arranged to control the process conditions by adjusting the at least one airflow generator based on the detected process conditions. The present invention further relates to a method for treating elongated food products.
US11647757B2
An apparatus includes a gambrel that defines two hooks configured to support an animal carcass. A fastening system is operatively connected to the gambrel and is configured to releasably connect a bladed tool to the gambrel. In one embodiment, the fastening system includes at least one magnet that retains one or more tools with magnetic force. The apparatus provides a convenient, safe, and clean place to store tools while processing an animal carcass.
US11647755B1
An eggroll rolling machine including a conveying assembly, a pivoting assembly, and an electronic assembly. The conveying assembly includes a conveying belt and head pulleys. Head pulleys rotate to slide the conveying belt. The pivoting assembly includes a block. The block is fixed to the conveying assembly through fasteners. The electronic assembly includes a motor. The motor rotates the head pulleys to slide the conveying belt. A partially made eggroll is placed in one end of the conveying belt and slides in the conveying belt to the block. The block pushes the partially made eggroll while the eggroll slides with the conveying belt to form an eggroll.
US11647753B2
Compositions and methods for efficiently producing and delivering double stranded RNA (dsRNA) are provided. Vector constructs useful for in vitro and in vivo expression of dsRNA are described. Also described are cell expression systems for efficient and cost-effective production of dsRNA in living cells and methods and compositions for providing the expressed dsRNA to target organisms. The described compositions and methods can be used to produce RNA molecules for screening or other uses, and to amplify RNA sequences for analysis.
US11647749B2
A composition suitable for control of diseases caused by phytopathogens comprising (A) a compound of formula I wherein R1 is difluoromethyl or trifluoromethyl and X is chloro, fluoro or bromo; and (B) at least one compound selected from compounds known for their fungicidal activity; and a method of controlling diseases on useful plants, especially rust diseases on soybean plants.
US11647748B2
The present invention provides novel sulphonamide inhibitors of cystathionin gamma synthase (CGS), their use as selective and non-selective herbicides, agricultural and non-agricultural herbicides, herbicides in integrated pest management, herbicides for gardening, clearing waste ground, clearing industrial or constructions sites, clearing railways and railway embankments, pesticide, fungicide, agricultural plant stimulant or antimicrobial agent. Also provided is a method for the control of undesired vegetation or clearing areas from the undesired vegetation comprising applying to the locus of said undesired vegetation, to the undesired plants or to a habitat thereof, a herbicidally effective amount of the compound of the present invention.
US11647743B2
The claimed subject matter comprises a device to collect and preserve cells comprising of: (1) a collection container comprised of a tube having an open end and a closed end, a closure in the open end of the tube, a vacuum drawn to a predetermined level inside the container; and (2) compounds including an anticoagulant agent and a fixative agent, wherein the compounds are in a sufficient amount to preserve said cells” original morphology and antigenic sites without significant dilution of said cells, and thereby allowing said cells to be directly analyzed by a flow cytometer without further treatment. The claimed subject matter further comprises of a method of making a collection device for cells comprising of: (1) providing a tube having an open end and a closed end; (2) preloading compounds including: an anticoagulant agent, and a fixative agent into the tube, wherein the compounds are in a sufficient amount to preserve the cells” original morphology and antigenic sites without significant dilution of the cells, and thereby allowing the cells to be directly analyzed by a flow cytometer without further treatment; (3) inserting a closure into the open end of the tube; and (4) drawing a vacuum inside the tube to a predetermined level to form the collection device.
US11647725B2
A soybean cultivar designated 07160416 is disclosed. The invention relates to the seeds of soybean cultivar 07160416, to the plants of soybean cultivar 07160416, to the plant parts of soybean cultivar 07160416, and to methods for producing progeny of soybean cultivar 07160416. The invention also relates to methods for producing a soybean plant containing in its genetic material one or more transgenes and to the transgenic soybean plants and plant parts produced by those methods. The invention also relates to soybean cultivars or breeding cultivars, and plant parts derived from soybean cultivar 07160416. The invention also relates to methods for producing other soybean cultivars, lines, or plant parts derived from soybean cultivar 07160416, and to the soybean plants, varieties, and their parts derived from use of those methods. The invention further relates to hybrid soybean seeds, plants, and plant parts produced by crossing cultivar 07160416 with another soybean cultivar.
US11647718B1
A soybean cultivar designated 00340276 is disclosed. The invention relates to the seeds of soybean cultivar 00340276, to the plants of soybean cultivar 00340276, to the plant parts of soybean cultivar 00340276, and to methods for producing progeny of soybean cultivar 00340276. The invention also relates to methods for producing a soybean plant containing in its genetic material one or more transgenes and to the transgenic soybean plants and plant parts produced by those methods. The invention also relates to soybean cultivars or breeding cultivars, and plant parts derived from soybean cultivar 00340276. The invention also relates to methods for producing other soybean cultivars, lines, or plant parts derived from soybean cultivar 00340276, and to the soybean plants, varieties, and their parts derived from use of those methods. The invention further relates to hybrid soybean seeds, plants, and plant parts produced by crossing cultivar 00340276 with another soybean cultivar.
US11647708B2
An embodiment of the novel and inventive vertical hydroponic system comprises a double-sided system, each side having two sets of double-door tile panels. Each door is mounted on hinges attached at either the right or left sides of an external support frame with the doors opening out from the middle. Each door in this embodiment may support a 6×4 array of novel and inventive tiles, each tile arranged with two columns of 3 pot supports, each such tile capable of supporting 6 grow pots, for a total of 144 grow pots per door. In this embodiment all four doors can support up to 576 grow pots. However, an infinite number of tile variations are possible with the 2×3 array being just one. The doors can be opened during the growth cycle without disconnecting or interrupting the irrigation components which allows for fast and easy harvesting and maintenance. A submersible pump and its control electronics are mounted in the support framework so the system is self-contained. Scheduling software is provided via digital mobile app, which is downloadable from common app sources. The hydroponic system is interconnectible to the internet for remote maintenance and monitoring.
US11647697B2
A three-point bale spreader attachable to a tractor includes an arm capable of lifting a bale into a processing chamber. A pair of rotors with a plurality of flail knives is rotated to shred the bale. A conveyor feeds the bale into the rotating rotors, while a door can be opened to varying degrees to allow the shredded material to exit the bale spreader.
US11647696B2
The present disclosure relates to a belt as a continuous traction means for conveyor belts of bale presses, comprising at least one fabric layer embedded at least in certain regions in a polymer layer, for creating a continuous belt reinforced by at least one fabric layer. The present disclosure provide that cross-stiffening elements are embedded in the polymer layer, for increasing a transverse rigidity of the belt, whereby the cross-stiffening elements are essentially oriented in a transverse direction of the belt, and the belt exhibits, at least in the region of the cross-stiffening elements, a ratio of rigidity between the transverse rigidity and a longitudinal rigidity of at least 2:1.
US11647693B2
A stomping shoe assembly for an agricultural harvester header including a stomping shoe having a substantially planar proximal end for connecting to an agricultural harvester header, and a curved distal end for engaging crop. The assembly further includes a stalk cutter having an elongated body mounted to the stomping shoe and extending from the stomping shoe from the curved distal end to the substantially planar proximal end. Also provided is an agricultural harvester header including the stomping shoe assembly.
US11647689B2
In a fluid injection system for dispensing a solution, said fluid injection system comprises a feeder tank having a product to be dispensed therein, an inlet connection for diverting fluid from a flow line to a fluid nozzle means and an outlet connection for dispensing the solution into the flow line or onto a matter. The fluid nozzle means is in communication with the feeder tank and the inlet connection and the fluid injection system controls a flow rate of fluid at which the fluid nozzle means introduce the fluid into the feeder tank based upon characteristics comprising solubility of the product at a temperature of the fluid in the feeder tank, weight of the product to be dispensed or to be dissolved in the feeder tank, and dispensing time, and the fluid injection system controls a flow rate of the fluid nozzle means to satisfy equation: F=(W)/(T×S) wherein, F is the flow rate of the fluid nozzle means, W is weight of the product in the feeder tank, T is dispensing time and S is solubility of the product at the temperature of the fluid in the feeder tank.
US11647686B2
A self-propelled work vehicle is provided with systems and methods for communicating the presence of nearby objects to an operator. A horizontally rotatable machine frame supports a work implement which is further vertically rotatable. Various object sensors are each configured to generate object signals representative of detected objects in respective fields of vision. A controller determines a working area for the work vehicle, corresponding at least to a swing radius of the machine frame and optionally further to a swing radius of the work implement at a given orientation and/or angle of rotation. The controller determines positions of each detected object relative to the machine frame based on the object signals and known positions of the respective object sensors, and generates output signals based on the determined object positions with respect to the working area. The output signals may facilitate vehicle interventions, and/or visual alerts corresponding to bird's eye displays.
US11653582B2
An electronic chip includes memory cells made of a phase-change material and a transistor. First and second vias extend from the transistor through an intermediate insulating layer to a same height. A first metal level including a first interconnection track in contact with the first via is located over the intermediate insulating layer. A heating element for heating the phase-change material is located on the second via, and the phase-change material is located on the heating element. A second metal level including a second interconnection track is located above the phase-change material. A third via extends from the phase-change material to the second interconnection track.
US11653580B2
Disclosed is a resistive random access memory (RRAM). The RRAM includes a bottom electrode made of tungsten and a switching layer made of hafnium oxide disposed above the bottom electrode, wherein the switching layer includes a filament and one or more lateral regions including a doping material that are between a top region and a bottom region of the switching layer. The RRAM further includes a top electrode disposed above the switching layer.
US11653570B2
A piezoelectric sensor includes: a lower substrate; a plurality of sensing transistors that are disposed on the lower substrate; a lower electrode that is disposed to cover the plurality of sensing transistors; a piezoelectric material layer that is disposed on the lower electrode; and an upper electrode that is disposed on the piezoelectric material layer. The piezoelectric material layer has a first thickness in a plurality of first areas in which the plurality of sensing transistors are disposed and has a second thickness which is greater than the first thickness in a second area in which the plurality of sensing transistors are not disposed. Accordingly, it is possible to further accurately and finely detect various types of biometric information.
US11653553B2
A functional layer forming ink used in forming a functional layer of the self-luminous element by a printing method, the ink including functional material dissolved or dispersed in a mixed solvent including solvents having different boiling points. When one or more solvents are selected from the solvents of the mixed solvent in descending order of boiling point until a mass ratio of the selection to the mixed solvent is a defined ratio or more, the one or more solvents in the selection are included in a solvent group of solvents that have a contact angle of 5° or less with respect to a defined resin material.
US11653542B2
A display apparatus includes a substrate; a plurality of display units on the substrate, each including a thin film transistor including at least one inorganic layer, a passivation layer on the thin film transistor, and a display device electrically connected to the thin film transistor; and a plurality of encapsulation layers respectively encapsulating the plurality of display units. The substrate includes a plurality of islands spaced apart, a plurality of connection units connecting the plurality of islands, and a plurality of through holes penetrating through the substrate between the plurality of connection units. The plurality of display units are on the plurality of islands, respectively. The at least one inorganic layer and the passivation layer extend on the plurality of connection units. The passivation layer includes a trench exposing the at least one inorganic layer. The encapsulation layer contacts the at least one inorganic layer exposed via the trench.
US11653537B2
An electronic device including a base structure, a first pattern having at least one projection disposed on the base structure, a first conductive layer including a first portion disposed on the base structure and a second portion disposed on the first pattern and connected to the first portion, an insulating layer disposed on the first conductive layer covering the first portion and exposing the second portion, and a second conductive layer provided on the insulating layer and overlapping the first conductive layer. The second conductive layer is spaced apart from the first portion and is in contact with the second portion. Methods of manufacturing an electronic device capable of reducing the number of process steps in the manufacturing process are also disclosed.
US11653535B2
A display panel includes a substrate including a transmissive area, a first non-display area surrounding the transmissive area, and a display area at least partially surrounding the first non-display area; display elements in the display area and each including a pixel electrode; scan lines in the display area, at least one of which extending through the first non-display area and detouring along an edge of the transmissive area; a connection line in the first non-display area and at least partially overlapping at least one of the scan lines, and on a first layer that is a same layer as the pixel electrode; a first line on a second layer different from the first layer; and a second line on a third layer different from the first layer and at an opposite side with respect to the first line.
US11653533B2
A display device includes: a substrate including a display area and a peripheral area outside the display area, the display area including a first display area and a second display area; a first fan-out portion in a portion of the peripheral area outside the first display area; a second fan-out portion outside the first fan-out portion; a first power supply line in the peripheral area corresponding to one side of the display area and overlapping at least a portion of the first fan-out portion; and a second power supply line in the peripheral area outside the display area and overlapping at least a portion of the second fan-out portion.
US11653531B2
Transparent display device having display area including transmissive area and non-transmissive area
A transparent display device is disclosed, which may prevent a short circuit from occurring between first and second capacitor electrodes of a capacitor. The transparent display device includes a substrate provided with a display area including a transmissive area and a non-transmissive area, in which a plurality of subpixels are disposed, and a non-display area adjacent to the display area, a driving transistor provided in the non-transmissive area over the substrate, including an active layer, a gate electrode, a source electrode and a drain electrode, and a capacitor provided in the non-transmissive area over the substrate, including a first capacitor electrode and a second capacitor electrode. The second capacitor electrode is not overlapped with the active layer of the driving transistor.
US11653530B2
A display substrate and a display device are provided. The display substrate includes sub-pixels and a light emitting control signal line. The sub-pixel includes an organic light emitting element and a pixel circuit, the organic light emitting element includes a second electrode, the pixel circuit includes a driving transistor and a first light emitting control transistor, and the pixel circuit further includes a connection structure. In the second color sub-pixel, a first electrode of the first light emitting control transistor is electrically connected with the connection structure through a first connection hole, and the connection structure is electrically connected with the second electrode through a second connection hole, the first connection hole and the second connection hole are located on both sides of the light emitting control signal line. In the third color sub-pixel, the second electrode does not overlap with a channel of the driving transistor.
US11653527B2
An organic light emitting diode display device, including a flexible substrate; pixels on the flexible substrate, the pixels including an organic emission layer; a pixel definition layer between the pixels, the pixel definition layer including openings; an encapsulation layer covering the pixels; and a conductive light shielding member on the encapsulation layer, the conductive light shielding member not overlapped with the pixels, and overlapped with the pixel definition layer.
US11653524B2
A display device includes a substrate including a plastic layer, a barrier layer, and a display area in which an image is displayed. The display device further includes a light-emitting diode disposed in the display area, a planarization layer, and a pixel definition layer. The planarization layer and the pixel definition layer overlap the light-emitting diode. The display device further includes a thin film encapsulation layer disposed on the pixel definition layer. The thin film encapsulation layer includes at least one inorganic layer. The display device further includes an opening disposed in the display area and penetrating the substrate. The opening includes a protruded portion and a depressed portion, and the barrier layer overlaps at least one of the pixel definition layer and the planarization layer at the protruded portion.
US11653520B2
A display device includes a display module including a first non-folding area, a second non-folding area, and a folding area disposed between the first and second non-folding areas which are arranged in a first direction, a first support disposed below the first non-folding area, a second support disposed below the second non-folding area, and a hinge including a biaxial rotation shaft disposed between the first support and the second support, the biaxial rotation shaft extending in a second direction intersecting the first direction. The folding area has a curvature radius in a range of about 1.5 mm to about 5.0 mm when the display module is folded by a rotation of the first support and the second support with respect to the biaxial rotation shaft.
US11653501B2
A ferroelectric memory device, a manufacturing method of the ferroelectric memory device and a semiconductor chip are provided. The ferroelectric memory device includes a gate electrode, a ferroelectric layer, a channel layer, first and second blocking layers, and source/drain electrodes. The ferroelectric layer is disposed at a side of the gate electrode. The channel layer is capacitively coupled to the gate electrode through the ferroelectric layer. The first and second blocking layers are disposed between the ferroelectric layer and the channel layer. The second blocking layer is disposed between the first blocking layer and the channel layer. The first and second blocking layers comprise a same material, and the second blocking layer is further incorporated with nitrogen. The source/drain electrodes are disposed at opposite sides of the gate electrode, and electrically connected to the channel layer.
US11653482B2
An electronic component includes a case body, an electronic circuit, and a conductor portion. The case body is formed by fitting a first housing and a second housing. The electronic circuit board is accommodated in the case body. The conductor portion is formed to continuously extend in a circumferential direction of the electronic circuit board at a portion of the first housing where the first housing is fitted to the second housing. The conductor portion is electrically connected to a ground of the electronic circuit board.
US11653480B1
According to one aspect, an apparatus includes a first system that generates heat, and a cooling arrangement. The cooling arrangement cools the first system, and includes a coolant source and a distribution arrangement. The coolant source provides a coolant in a first state that is distributed by the distribution arrangement to absorb the heat. The cooling arrangement includes a control arrangement and a heating arrangement. The control arrangement maintains the coolant in the first state at least a set point, the set point being a temperature that is above a dew point, by determining when to activate the heating arrangement to warm the coolant in the first state and, when it is determined by the control arrangement that the heating arrangement is to be activated, activating the heating arrangement to warm the coolant in the first state to maintain the temperature of the coolant at the set point.
US11653478B1
Embodiments relate to a system, an apparatus, and a method that involve a plurality of stackable enclosure units that include inter-unit or inter-module passages for facilitating cooling of interior compartments of the units, especially server units.
US11653476B2
The embodiments herein describe technologies of cryogenic digital systems with a first component located in a first non-cryogenic temperature domain, a second component located in a second temperature domain that is lower in temperature than the first cryogenic temperature domain, and a third component located in a cryogenic temperature domain that is lower in temperature than the second cryogenic temperature domain.
US11653471B2
A heat dissipation device is provided and includes: a temperature equalizing plate unit; at least one first vapor chamber unit and at least one second vapor chamber unit disposed on an outer surface of the temperature equalizing plate unit; at least one first tower fin set disposed on the outer surface of the temperature equalizing plate unit to sleeve the first and second vapor chamber units and partially expose the second vapor chamber unit; and at least one second tower fin set disposed on a part of a surface of the first tower fin set to sleeve the exposed part of the second vapor chamber unit.
US11653470B2
A tool-free support mounting structure is provided, including a base, a handle, and a support. The handle and the support are slidably connected along a first direction; the support and the base are clamped through a limiting slot and a limiting bulge; a slot width direction of the limiting slot is consistent with the first direction, and a slot depth direction is a second direction perpendicular to the first direction; when the limiting bulge is embedded in the limiting slot, the handle and the base are clamped through a fixing slot taking a slot depth direction as the first direction, and a fixing bulge; and an opening used for guiding the fixing bulge to enter, along the second direction, is formed in a notch of the fixing slot.
US11653465B2
A housing assembly for a component includes a base portion having a holding element, a cover portion having an actuation element, and a carrier element carrying the component. The holding element holds the carrier element by engaging with the actuation element. The actuation element applies a contact force on the holding element and is adjustable with respect to the holding element in at least one direction when the holding element is engaged with the actuation element.
US11653462B2
An electronic device includes a back frame, a panel, an adhesive layer, an adhesive member, and a connecting member. The panel is arranged on the back frame. The adhesive layer is adhered to the panel. The adhesive member is adhered to the back frame. The connecting member is adhered to the adhesive layer and the adhesive member.
US11653457B2
A submersible control system with a control panel. The control panel has a frame to house electronic components. The frame has a connection opening for wiring required for an electrical connection to the electrical components. An outer door is attached to the frame to be water-tight to the frame in a closed position thereof. A conduit is sealed to be water-tight with respect to the connection opening. The conduit is filled with an epoxy for water-tight sealing an interior of the conduit to the wiring fed through the conduit. The control panel will remain water-tight for at least 24 hours after being submerged.
US11653447B2
A ceramic copper circuit board according to an embodiment includes a ceramic substrate and a first copper part. The first copper part is bonded at a first surface of the ceramic substrate via a first brazing material part. The thickness of the first copper part is 0.6 mm or more. The side surface of the first copper part includes a first sloped portion. The width of the first sloped portion is not more than 0.5 times the thickness of the first copper part. The first brazing material part includes a first jutting portion jutting from the end portion of the first sloped portion. The length of the first jutting portion is not less than 0 μm and not more than 200 μm. The contact angle between the first jutting portion and the first sloped portion is 65° or less.
US11653438B2
An EUV light source module includes an EUV vessel, a collector disposed in the EUV vessel, a droplet generator, a droplet catcher, and a droplet collecting system. The droplet generator is coupled to the EUV vessel and configured to provide a plurality of target droplets into the EUV vessel. The droplet catcher is coupled to the EUV vessel and configured to catch at least a target droplet from the EUV vessel. The droplet colleting system is coupled to the droplet catcher. The droplet collecting system includes a connecting port coupled to the droplet catcher, and a thermal insulating device surrounding the droplet catcher. The droplet generator and the droplet catcher are disposed at opposite locations in the EUV vessel.
US11653437B1
Provided is a method for making a composite structure with exposed conductive fibers. The exposed conductive fibers can be used for static dissipation. In the present method, a liquid, gum, gel, or impermeable film mask is applied to the conductive fiber material. The mask functions to prevent infiltration of curable liquid resin into the conductive fiber material. The masked conductive fiber material is incorporated into the composite structure, along with structural fiber material. The liquid resin is cured. The mask material and cured resin are removed from the masked areas, thereby exposing the conductive fiber material. The exposed conductive fiber material can collect and drain electrostatic charges. The present method can be used to make storage tanks and other objects that require electrostatic charge dissipation.
US11653435B2
Disclosed herein is system level occupancy counting in a lighting system configured to obtain an indicator data of a RF spectrum signal (signal) generated at a number of times in an area. At each respective one of the number of times, apply one of a plurality of heurist algorithm heuristic algorithm coefficients to each indicator data of the signal, based on results of the application of the heuristic algorithm coefficients, generate an indicator data metric value for each of the indicator data for the respective time. The lighting system is also configured to process each of the indicator data metric value to compute a plurality of metric values for the respective time and combine the plurality of metric values to compute an output metric value for each of a plurality of probable number of occupants in the area for the respective time. The lighting system is further configured to determine an occupancy count in the area at the respective time based on the computed output metric value.
US11653433B2
A minimum voltage detector circuit is disclosed. The circuit includes a plurality of LED strings each having a plurality of series-coupled LEDs. The minimum voltage detector circuit is configured to detect a minimum voltage from among the plurality of LED strings, and also to perform open/short detection among the plurality of LED strings. The minimum voltage detector circuit includes a plurality of voltage comparators and correspondingly coupled replica circuits. Each of the voltage comparators includes an amplifier having a first input coupled to a cathode of a last LED of one of the plurality of LED strings, an output, and a second input coupled to the output. Each voltage comparator further includes a replica circuit coupled to the amplifier. The replica circuit is configured to maintain an output transistor of the amplifier in an active state when the amplifier is in an unbalanced state.
US11653424B2
A datalogger with a temperature sensor for measuring the temperature of one or more articles during a radio frequency (RF) heating process. The datalogger may be wireless and may store temperature measurements in an internal memory and/or may wirelessly transmit temperature data in real-time. The datalogger may be specifically designed and oriented to maximize temperature measurement accuracy and minimize interference with the RF heating process.
US11653423B2
The present invention relates to an induction cooking hob (10) comprising at least one cooking zone (12) including one induction coil (14). The induction cooking hob (10) comprises at least one user interface (22) including at least one display with at least one indicator corresponding with one cooking zone (12, 28, 30, 32). The induction coil (34, 36, 38, 40) is provided for detecting at least one parameter related to the power of the electromagnetic field generated by said induction coil (34, 36, 38, 40). The induction cooking hob (10) comprises a memory for storing a maximum value of the parameter detected by the induction coil (14) of the cooking zone (12) when a cooking pot (26) is arranged upon said cooking zone (12). The indicator corresponding with the cooking zone (12) indicates a signal related to an incorrect position of the cooking pot (26), if the currently detected value of the parameter is lower than the maximum value of said parameter.
US11653416B2
Embodiments of an access point (AP) configured for extremely high throughput (EHT) operation may be configured to operate as a triggering AP for a trigger-based (TB) peer-to-peer (P2P) communication between a triggered direct (TD) station (STA) and a TD peer STA. The AP may encode a Direct Link Announcement (DiL-A) frame to schedule the TD STA for a direct link transmission to the TD peer STA. The DiL-A frame may be encoded to include a Duration/ID field. The AP may set the Duration/ID field of the DiL-A frame to a remaining duration of a transmission opportunity (TXOP) when the TD peer STA is an EHT STA that supports TB P2P operation (e.g., to allow the TD peer STA to ignore the NAV set by the DiL-A frame). The AP may set the Duration/ID field of the DiL-A frame to a response time for the TD STA to respond to the DiL-A frame when the TD Peer STA is a legacy STA (e.g., to allow the TD peer STA to set its NAV based on the response time).
US11653415B2
A communication system includes a central cloud server that predicts a first travel path of a first edge device in motion. The first edge device is communicatively coupled to a first base station via a primary wireless connectivity option. The central cloud server determines a set of alternative wireless connectivity options to be made available to first edge device in advance for predicted first travel path. Each of the set of alternative wireless connectivity options includes a different specific initial access information. The set of alternative wireless connectivity options are pre-loaded at first edge device to cause first edge device to maintain a cellular connectivity with at least one of a plurality of base stations, where one or more alternative wireless connectivity options from the set of alternative wireless connectivity options are configured to be triggered along predicted first travel path bypassing an initial access-search at first edge device.
US11653409B2
A method of operating a terminal in a wireless communication system includes receiving, from a base station, system information including information on a first discontinuous reception (DRX) cycle; transmitting, to an access and mobility management function (AMF), a request message including information on a second DRX cycle based on the first DRX cycle; receiving, from the AMF, a response message about the request message, wherein the response message includes information determined based on whether the AMF assigns the second DRX cycle; and determining a DRX cycle of the terminal based on the response message.
US11653402B2
Methods, systems, and devices for wireless communications are described. In a wireless communications system, a user equipment (UE) may determine a preference of the UE for a termination point between a core network and a radio access network (RAN), the core network and the RAN supporting communications for the UE via at least one or a first cell and a second cell each associated with a multi-connectivity mode of the UE. The UE may transmit, to a base station, an indication of the preference of the UE for the termination point. In some cases, the base station may determine the termination point based on receiving the indication of the preference of the UE, and the base station may transmit a message indicating a configuration for the multi-connectivity mode to the UE, the configuration indicating the determined termination point.
US11653394B2
This disclosure provides methods, devices and systems for synchronized channel access. Some implementations more specifically relate to facilitating coexistence among wireless communication devices that support synchronized channel access and those that do not. A group of access points may schedule periodically recurring, synchronized channel access periods by periodically transmitting quiet elements. The quiet elements establish recurring quiet periods during which legacy devices are not permitted to transmit. In some implementations, an access point may transmit one or more quiet override elements each associated with a respective quiet element and indicating to other access points supporting synchronized channel access that they are permitted to contend for access during the respective quiet period. In some other implementations of synchronized channel access, an access point supporting synchronized channel access that wins contention after one or more consecutive synchronized channel access periods during which no other synchronized access points won contention, may be entitled to an extended TXOP.
US11653388B2
Frequency division multiplex (FDM) random access configuration and selection is disclosed for new radio (NR) unlicensed (NR-U) operations. For idle mode user equipment (UEs), the network may configured multiple frequency bands for random access. The UE may then select different frequencies for random access when default frequencies experience interference. For connected mode UEs, the network may configured which of multiple configured frequency bands the connected UE may use for autonomous random access transmissions. The UE may then select any of the allowed frequency bands for autonomous random access. Contention-free random access resources may be configured on one or more of the multiple configured frequency bands. When contention-free resources are available, the UEs may initially attempt access of the contention-free resources on the default frequency band before attempting random access on other configured bands or the UE is provided a priority of bands for access by the network.
US11653384B2
Methods, systems, and devices for wireless communication are described. Generally, the described techniques provide for a base station to determine whether to perform coverage enhancement for a random access procedure and to transmit an indication to a user equipment (UE) accordingly. For example, a base station may transmit an indication of whether coverage enhancement is associated with a second random access message (e.g., a random access Message 4 (Msg4)) using a first random access message (e.g., a random access Message 2 (Msg2)). The base station may transmit, and the UE receive, the second random access message accordingly. Implementing aspects of the present disclosure may enable coverage enhancement for random access procedures in wireless communications systems.
US11653372B2
Embodiments of the present disclosure relate to a method, network device, and apparatus for transmitting a preemption indication and a method, terminal device, and apparatus for receiving a preemption indication. In an embodiment of the present disclosure, the method of transmitting a preemption indication may comprise transmitting a preemption indication to a terminal device, wherein the preemption indication indicates information on a portion of resources allocated to a first transmission which is preempted by a second transmission, and wherein the preemption indication is associated with information on structure of the current slot. In embodiments of the present disclosure, by means of information on structure of a subframe, the indication monitoring and overhead for the preemption indication can be reduced remarkably, thereby providing a much more efficient preemption indication solution.
US11653370B2
There is provided a method of transmitting and receiving user equipment management information and electronic device for performing the same. The electronic device includes a communication interface including a plurality of phase array antennas, a storage configured to store user equipment (UE) management information including information about at least one frequency band covered by each of the phase array antennas, and a controller configured to control to transmit the UE management information to a base station.
US11653369B2
In one embodiment, a method in a user equipment (UE) includes receiving broadcasted system information from a network node. The broadcasted system information may include explicit configuration information for a communications channel. The method further includes determining a configuration of the communications channel based, at least in part, on the explicit configuration information. The explicit configuration information may be used by the user equipment to override default channel configuration information. The method may further include receiving data over the communications channel.
US11653364B2
A method for providing scheduling request resources to a user equipment involves a wireless network node (e.g., an eNB) transmitting a configuration of scheduling request resources to the user equipment via radio resource control signaling, and the wireless network node enabling the scheduling request resources by transmitting a message to the user equipment via physical layer signaling. The message that enables the scheduling request resources may be transmitted as part of an uplink grant or downlink grant. In some implementations, the enabling message maps to one of several sets of scheduling request resources, which the wireless network node has previously communicated to the user equipment via radio resource control signaling. In other implementations, the selection of which set of scheduling request resources is to be enabling is made by the user equipment based on implicit signaling from the wireless node.
US11653355B2
A method for performing wireless communication by a first device includes: receiving, from a base station, downlink control information (DCI) for scheduling a sidelink (SL) resource, the DCI including information related to time between a physical sidelink feedback channel (PSFCH) resource and a physical uplink control channel (PUCCH) resource and information related to the PUCCH resource; transmitting, to a second device, a plurality of physical sidelink control channels (PSCCHs) and a plurality of physical sidelink shared channels (PSSCHs) based on the DCI; determining a plurality of PSFCH resources based on an index of a slot and a sub channel related to the plurality of PSSCHs and a source ID of the first device; receiving a plurality of pieces of SL HARQ feedback related to the plurality of PSSCHs; and transmitting, to the base station, one piece of SL hybrid automatic repeat request (HARQ) feedback on one PUCCH resource.
US11653353B2
The present invention relates to a method, device, and system for downlink data reception and HARQ-ACK transmission in a wireless communication system. According to the present invention, in the method, device, and system for downlink data reception and HARQ-ACK transmission, a first physical downlink control channel (PDCCH) for scheduling of a first physical downlink shared channel (PDSCH) is received, and a second PDCCH for scheduling of a second PDSCH is received. Thereafter, uplink control information (UCI) including a hybrid automatic repeat request (HARQ)-acknowledge (ACK) codebook for the first PDSCH and the second PDSCH is transmitted to a base station.
US11653350B2
Various aspects of the present disclosure generally relate to wireless communication. In some aspects, a base station (BS) may determine at least one of a variable random access response (RAR) window start time, a variable maximum quantity of slots for an index of a first slot of a physical random access channel occasion, or scheduling information related to one or more variable delays for an uplink transmission. The BS may transmit, to a user equipment, at least one of information that identifies the RAR window start time, information that identifies the variable maximum quantity of slots, or the scheduling information. Numerous other aspects are provided.
US11653341B2
Methods, systems, and devices for wireless communications are described that provide for frame-based initiator device operations. A wireless device may be operating within a frame-based equipment communications system, where a frame may include a channel occupancy time period and a minimum idle period. An initiating device may be configured to initiate autonomous uplink communications during the channel occupancy time period of its frame, while the device may not initiate communications during an idle period of its frame. In some cases, a frame-based equipment communications system may include more than one initiating device, where the idle periods for different initiating devices may occur at different times. In some cases, the initiating device may be configured to initiate communications during the idle period for another initiating device. This may allow the wireless system to decrease system overhead associated with a minimum idle period per frame.
US11653328B2
The present invention provides a user equipment, a method executed by a user equipment, a base station, a method executed by a base station, a mobile control entity, and a method executed by a mobile control entity. The method executed by a user equipment comprises: receiving a paging message from a base station; and determining whether to perform a downlink early data transmission (EDT) preparation operation based on downlink EDT indication information when the user equipment UE initiates an RRC connection establishment procedure or an RRC connection resume procedure based on the paging message.
US11653322B2
Provided is a method and apparatus for transmitting a reference signal. The method may comprise: determining, based on at least one of a synchronization signal (SS) block index or an index associated with a time interval, an initialization value for a reference signal associated with a physical broadcast channel (PBCH); generating, based on the initialization value, the reference signal associated with a PBCH; mapping, based on one or more of a frequency domain shift value or a time domain shift value, the generated reference signal to resource elements (REs); and transmitting, to a terminal, the mapped reference signal and the PBCH.
US11653315B2
A method and apparatus are disclosed. In an example from the perspective of a User Equipment (UE), the UE triggers a Power Headroom Report (PHR) when the UE is in Radio Resource Control (RRC) inactive state. The UE determines whether or not to cancel the PHR based upon whether or not an uplink (UL) resource for transmission in the RRC inactive state can accommodate first pending data available for transmission.
US11653313B2
The present disclosure provides a power control method in device to device (D2D) communication and a user equipment for performing the power control method. The method includes computing a power value of device to device (D2D) transmission of a user equipment performing D2D communication in a subframe in a serving cell, based on a power control adjustment state of a Long Term Evolution (LTE) wide area network (WAN) uplink channel of the user equipment and an offset or a ratio indicated by a transmit power control (TPC) command indicated in D2D grant or downlink control information (DCI) format 3/3A.
US11653309B2
Methods, systems, and devices for wireless communications are described. A user equipment (UE) may receive control signaling which indicates a resource block indicating a number of reference signal tones and data tones in an uplink transmission. In some cases, the UE may determine a first transmission power for the reference signal tones, and a second transmission power for the data tones that is different from the first transmission power. In some other cases, the UE may identify a frequency allocation for the resource block which allocates a same frequency bandwidth for the reference signal tones and the data tones, and the UE may determine a same transmission power for the reference signal tones and the data tones based on the frequency allocation. Based on the determination of transmission powers, the UE may transmit the reference signal tones and the data tones to a base station.
US11653305B2
A method for determining a sleep state, a terminal, and a readable medium. The method for determining a sleep state comprises: receiving sleep instruction information sent by a base station; and on the basis of the sleep instruction information, entering a sleep state and selecting different modes. By application of the solution, a UE can be flexibly instructed to enter a sleep state without affecting the quality of service, thereby reducing the power consumption of the UE, and achieving the purpose of power saving.
US11653304B2
Disclosed are techniques for radio frequency energy harvesting (RF-EH). In an aspect, a device (e.g., UE, BS, etc.) transmits a time division duplex (TDD) resource configuration that includes an indication of a set of symbols associated with RF-EH. The devices transmit energy on resources associated with the first set of symbols. The UE performs dedicated RF-EH on resources associated with the first of symbols (e.g., to harvest the RF energy transmitted by the device).
US11653303B2
This disclosure describes systems, methods, and devices related to service set compression. A device may determine a wake-up frame comprising one or more fields, wherein the one or more fields indicate an action to be taken on a receiving device. The device may determine an identifier to be indicated in the wake-up frame. The device may determine a size of the identifier. The device may cause to compress the identifier forming a compressed output, wherein the identifier is compressed by applying a cyclic redundancy code (CRC) computation. The device may identify a portion of the compressed output. The device may cause to send the wake-up frame to a receiving device, wherein the wake-up frame comprises the portion of the compressed output based on the size of the identifier.
US11653286B2
The invention discloses an equipment direct-through system relay state determination method and device. The method comprises the steps that relay user equipment UE acquires relay configuration information and/or receives device-to-device D2D information, and the relay state of the relay UE is determined according to the relay configuration information and/or the D2D information. The device is arranged in the relay user equipment UE and comprises an information acquisition module and a state determination module. According to the method and the device, the UE with the relay capacity can enter the relay second state without accessing of far-end users and enter the relay first state when receiving the request of the far-end users for searching the relay and periodically broadcast the relay information so that switching of the relay state of the relay UE can be realized through the mode, and the objective of power saving can be achieved when the relay UE is in the relay second state.
US11653279B2
A UE transmits to a source base station a capability of the UE associated with a bandwidth class or a band combination. The capability is associated with a handover in which the UE maintains connections with the source base station and a target base station. The UE receives a handover message comprising at least one of a target base station configuration to apply during handover execution or a source base station configuration to apply during handover execution based on the capability of the UE. The UE establishes a connection with the target base station and maintains a connection with the source base station over a period of time during the handover. The UE communicates with the source base station and the target base station during handover execution using at least one of the target base station configuration or the source base station configuration.
US11653277B2
A wireless device may receive one or more configuration parameters of a first cell and a second cell. The one or more configuration parameters may indicate a first bandwidth part (BWP) of the first cell, a second BWP of the second cell, and beam failure recovery configuration parameters of the first BWP are for one or more beam failure recoveries of the second BWP of the second cell. The wireless device may switch to the first BWP of the first cell as an active BWP of the first cell. Based on the beam failure recovery configuration parameters of the first BWP being for one or more beam failure recoveries of the second BWP, the wireless device may switch to the second BWP as an active BWP of the second cell.
US11653275B2
Provided is a method of switching, by a user equipment (UE), a transmission chain across carriers, the method including determining to switch a first transmission chain for a transmission between a first carrier and a second carrier, determining a length of a switching gap during which no transmission or reception occurs on the first carrier and/or the second carrier, locating the switching gap within a switching duration, and switching the first transmission chain between the first carrier and the second carrier during the switching gap.
US11653266B2
An access point (AP) device comprising a controller configured to monitor bandwidth allocated by the AP device to a plurality of data flows directed to a plurality of wireless clients using a supported AP device, receive from the supported AP device a message indicating a degradation of a quality of service (QoS) level of the supported AP device, and adapt, in response to the message, a bandwidth allocated to a data flow which is forwarded to the supported AP device.
US11653263B2
In one aspect, a method of wireless communication includes determining a number of bytes in a compressed queue and a number of bytes in an uncompressed queue. The method also includes transmitting a buffer status report (BSR) indicating at least the number of bytes in the compressed queue. The method includes receiving an uplink grant indicating one or more uplink grant resources and a number of bytes allocated for the one or more uplink grant resources. The method also includes generating a transport block (TB) based on the uplink grant and the BSR and from data of at least the compressed queue, wherein the TB includes one or more compressed packets and one or more uncompressed packets. The method further includes transmitting a PUSCH transmission including the TB during an uplink grant resource of the one or more uplink grant resources. Other aspects and features are also claimed and described.
US11653245B2
Methods, systems, and devices for wireless communications are described. In some networks, a user equipment (UE) may perform radio link monitoring according to one or more radio link monitoring configurations. The UE may select a radio link monitoring configuration from a first radio link monitoring configuration associated with radio link monitoring over a duration that a hybrid automatic repeat request (HARQ) process is enabled and a second radio link monitoring configuration associated with radio link monitoring over a duration that the HARQ process is disabled. The UE may monitor reference signals using the selected radio link monitoring configuration, and may determine a radio link failure, a beam failure, or both has occurred based on monitoring the one or more reference signals using the selected radio link monitoring configuration. The UE may subsequently transmit a measurement report based on determining the radio link failure, the beam failure, or both.
US11653244B2
An example method may include determining a multi-user packet error rate associated with communications from a client device to a host device, the multi-user packet error rate based on a number of packets in a multi-user communication frame with an error. The method may also include sending a trigger from the host device to the client device to communicate via a second multi-user communication frame, the trigger identifying a transfer rate based on the multi-user packet error rate.
US11653237B2
A wireless device may determine a first uplink resource for transmission of a first hybrid automatic repeat request acknowledgement (HARQ-ACK) in a time slot. The wireless device may receive, via at least one monitoring occasion of monitoring occasions, at least one repetition of downlink control information (DCI) that indicates a second uplink resource for transmission of a second HARQ-ACK in the time slot. The wireless device may transmit, in the time slot and via an uplink resource, the second HARQ-ACK based on a monitoring occasion of the monitoring occasions being earlier than a time duration from a starting symbol of the first uplink resource, where an ending time of the monitoring occasion ends latest among ending times of the monitoring occasions.
US11653231B2
A method, an apparatus, and a computer program product for wireless communication are provided. A component carrier group may be configured for beam management, such that beam management on a first component carrier is applied to one or more second component carriers to reduce signaling overhead associated with controlling a defined group of component carriers. A user equipment may be configured to identify a group of component carriers and, when a beam failure detection reference signal is received from a base station on a first component carrier, identify a beam failure condition for the first component carrier and one or more second component carriers of the group of component carriers.
US11653222B2
In a connected vehicle environment, network connection parameters such as a network congestion window and bit rate are automatically adjusted dependent on a location of a vehicle in order to optimize network performance. A geospatial database stores learned relationships between network performance of a connected vehicle at different physical locations when configured in accordance with different network parameters. The vehicle can then adjust its network parameters dynamically dependent on its location. A vehicle may maintain multiple connections to different networks concurrently for transmitting duplicate data of a data stream, with the vehicle independently adjusting parameters associated with different networks to optimize performance.
US11653220B2
Systems, methods, and computer-readable media for identifying a deployment scheme for forming a wireless mesh network based on environmental characteristics and an optimum deployment scheme. In some examples, a geographical area for deployment of a wireless mesh network is identified. Additionally, environmental information of the geographical area can be collected. Network characteristics of an optimum deployment scheme for forming the wireless mesh network can be defined. As follows, a deployment scheme for forming the wireless mesh network can be identified based on the network characteristics of the optimum deployment scheme and the environmental information of the geographical area.
US11653219B2
A dual band LTE small cell base station communicates on both licensed bands and unlicensed bands. The small cell base station modifies the communication protocol utilized by the licensed band to enable communication over an unlicensed band. This modification involves replacing the physical (PHY) layer of the licensed band communication protocol with the PHY layer of a to-be-used protocol in an unlicensed band.
US11653218B2
Various embodiments comprise systems, methods, and apparatus for allocating resources in a 5G network comprising Citizens Broadband Radio Service Device (CBSD) nodes configured for communicating via granted spectrum with customer premises equipment (CPE) supporting wireless access points (WAPs) and the like, wherein an initial small bandwidth part (BWP) is assigned to each CPE, a BWP update process provides to a policy control function a list of devices/capabilities consuming CPE bandwidth so that the PCF may calculate a new bandwidth requirement for the CPE, the new requirement being used by the CPE to generate a CPE UE capability information message for the CBSD node, the CBSD node assigning an appropriately sized BWP for the CPE.
US11653217B2
A method for selecting at least one channel for a network element in a shared spectrum communication system is provided. The method includes identifying a plurality of candidate channels of a frequency band of the shared spectrum communication system. For each channel of the plurality of channels, the method further includes: evaluating the channel based on one or more of a plurality of criteria for the network element; scoring the channel based on the evaluation of the channel for the network element; and ranking the plurality of candidate channels based on the assigned scores for each of the plurality of channels. The method further includes selecting at least one channel based on the ranking of the plurality of candidate channels.
US11653201B2
Management and configuration of internet of things network connected devices is facilitated herein. A proxy device comprises a memory that stores executable instructions that, when executed by a processor, facilitate performance of operations that comprise determining a first identity and a first operational parameter of a first device and a second identity and a second operational parameter of a second device. The first device and the second device can be associated with a defined communication network. The proxy device can be provisioned within the defined communication network and can operate as a security update proxy node for the first device and the second device. The operations can also comprise facilitating a first security update at the first device and a second security update at the second device based on a determination that the first device and the second device have delegated responsibility for security synchronization to the proxy device.
US11653197B2
Various aspects include methods for supporting remote Subscriber Identity Module (SIM) profile provisioning that may be performed by a Lightweight Machine-to-Machine (LwM2M) server and LwM2M client computing devices, such as Internet of Things (IoT) devices. A LwM2M server may generate a remote SIM provisioning object for the LwM2M client computing device indicating that the SIM profile update for the LwM2M client computing device is available, and send the remote SIM provisioning object to the LwM2M client computing device. A LwM2M client computing device may receive a remote Subscriber Identity Module (SIM) provisioning object from a LwM2M server indicating that a SIM profile update for the LwM2M client computing device is available, and download the SIM profile update in response to receiving the remote SIM provisioning object.
US11653195B1
Conversion node apparatuses, methods, and systems are disclosed. According to various embodiments, a conversion node is configured to communicate with a premises security system. The premises security system includes a subscriber identity module (SIM) associated with a first subscriber profile. The conversion node includes an embedded subscriber identity module (eSIM) associated with a second subscriber profile. The method includes provisioning a first communication link with the premises security system, receiving the first subscriber profile via the first communication link, modifying the second subscriber profile associated with in the eSIM based at least on the received first subscriber profile, provisioning a second communication link with a cellular network based on the modified second subscriber profile, and communicating, via the provisioned second communication link, data associated with the premises security system to the cellular network.
US11653190B2
A Bluetooth communication method and device, and storage medium and terminal are provided. The method includes: generating a frame to be transmitted, wherein the frame to be transmitted comprises at least a Preamble, an Access Code, a Header, an Enhanced Data Rate Payload and a Trailer, wherein a configuration mode of the Preamble is consistent with a configuration mode of a Preamble in an LE frame, a configuration mode of the Header, the Enhanced Data Rate Payload and the Trailer are consistent with configuration modes of corresponding parts in an EDR frame, a configuration mode of the Access Code is consistent with a configuration mode of an Access Code in the LE frame and a configuration mode of an Access Code in the EDR frame; and generating and transmitting the frame to be transmitted by a modulation mode of the EDR frame and a Symbol Rate of the LE frame.
US11653188B2
A method for configuring access point network settings using a data connection setting application operating on a wireless device is disclosed. The data connection setting application is operable to accesses settings configuration and data from a memory and/or a SIM card, and compare it with wireless network requirements to determine whether the settings need to be reconfigured. Based on the determination, the data connection setting application can enable the display of instructions to a user and provide tools to fill in information required to reconfigure the wireless device according to wireless network requirements for the specific wireless device.
US11653187B1
Disclosed herein are system, apparatus, article of manufacture, method and/or computer program product embodiments, and/or combinations and sub-combinations thereof, for a device including a functional circuit, a power monitor circuit, and a controller. The functional circuit can be configured to perform a function. The power monitor circuit can collect power usage data of the functional circuit. The controller can transmit the power usage data to a master control device, and receive an instruction provided by the master control device. The instruction is generated based on the power usage data of the functional circuit and related to the function. Based on the instruction received from the master control device, the controller can adjust the function performed by the functional circuit.
US11653183B2
A system may comprise a sending mobile phone that transmits SMS messages via a cellular network and packet switched messages via a PSMS and at least one server that supports the PSMS and maintains status information. The sending mobile phone may send a second message via a WLAN and via the PSMS, to a receiving mobile phone on a condition that an undelivered message threshold corresponding to the receiving mobile phone has not been exceeded.
US11653181B2
Methods, systems, and devices for wireless communications are described. A base station and user equipment (UE) may support network coded communications on a sidelink connection. The base station may configure UEs with network coding configurations. The network coding configuration may include one or more sets of network coding parameters. The base station may configure a first UE to send network coded information on the sidelink to a second UE. The network coded information may be generated based on data packets which were unsuccessfully decoded by the second UE. By transmitting network coded information on a sidelink, the second UE may efficiently obtain data packets which were unsuccessfully decoded from the base station.
US11653179B2
A method for communicating location information to a device includes receiving, at a computer system that implements a social networking service, location information that represents a geographic location of a device associated with a first user; associating, by the computer system, the received location information with a profile associated with the first user; and sending, from the computer system to a device associated with a second user, a message that is generated based at least in part on the location information.
US11653176B2
Methods and systems of interacting in a social media environment involving display of an augmented reality user interface including display of an area captured via a camera of a mobile device and a virtual object overlaid on the display of the area representing a content item of a user that is not physically located at that area. The availability of items to access in an area via the augmented reality user interface may be selectively limited by privacy settings of a user, matching of users by profile content, and otherwise.
US11653175B2
Distributed antenna systems provide location information for client devices communicating with remote antenna units. The location information can be used to determine the location of the client devices relative to the remote antenna unit(s) with which the client devices are communicating. A location processing unit (LPU) includes a control system configured to receive uplink radio frequency (RF) signals communicated by client devices and determines the signal strengths of the uplink RF signals. The control system also determines which antenna unit is receiving uplink RF signals from the device having the greatest signal strength.
US11653171B2
A method that generates binaural headphone playback signals given multiple audio source signals with an associated metadata and binaural room impulse response (BRIR) database, wherein the audio source signals are channel-based, object-based, or a mixture of both channel-based and object-based signals. The method includes parameterizing BRIR to be used for rendering, dividing each audio source signal to be rendered into a number of blocks and frames, and averaging the parameterized BRIR sequences. The method also includes downmixing the divided audio source signals using the diffuse blocks of BRIRs, and performing late reverberation processing on the downmixed version of the previous blocks of the audio source signals.
US11653156B2
Hearing device, accessory device, and a method of operating a hearing system comprising a hearing device and an accessory device is disclosed, the method comprising obtaining, in the accessory device, an audio input signal representative of audio from one or more audio sources; obtaining image data with a camera of the accessory device; identifying one or more audio sources including a first audio source based on the image data; determining a first model comprising first model coefficients, wherein the first model is based on image data of the first audio source and the audio input signal; and transmitting a hearing device signal to the hearing device, wherein the hearing device signal is based on the first model.
US11653153B2
The present disclosure relates to a method of performing bilateral dynamic range compression of first and second microphone signals generated by first and second hearing devices, respectively, of a binaural hearing system. The method comprises to pick-up sound pressure inside an ear canal of the user's left or right ear by a first microphone to generate a first microphone signal in response to incoming sound and pick-up sound pressure inside an ear canal of the user's opposite ear by a second microphone to generate a second microphone signal in response to the incoming sound.
US11653144B2
An open audio device includes an acoustic radiator that emits front-side acoustic radiation from its front side and emits rear-side acoustic radiation from its rear side, a front acoustic cavity that receives front-side acoustic radiation, and a rear acoustic cavity that receives rear-side acoustic radiation. At least one sound-emitting opening is acoustically coupled to the front acoustic cavity or the second acoustic cavity. The open audio device also includes a removable accessory that includes an acoustic transmission line that is acoustically coupled to the at least one sound-emitting opening when the removable accessory is attached to the open audio device.
US11653139B2
Left and right earphones are independently wireless such that the left and right earphones are not physically connected when worn by a user. Each earphone comprises a speaker, a body portion, and an earbud extending from the body portion. The body portion comprises a downwardly extending portion that extends straight downwardly when the earphone is worn by the user, a wireless communication circuit for receiving signals transmitted wirelessly to the earphone from a remote source, a microphone, a rechargeable battery, a memory and a processor. Each earphone is configured to receive from a remote computing device, and store in the memory, a firmware update.
US11653138B2
A system and method for automatically and dynamically controlling the output (e.g., volume) of an audio headphone device is disclosed, which includes detecting the invocation of the acoustic reflex with an audio headphone device. The disclosed system can measure the response of the tympanic membrane and middle ear to various SPL and frequencies. That information may be used for automated or customized warning or limiting levels either within the headphone, or at the audio playback device.
US11653131B2
A display device comprises a display unit having a display surface, a light source that irradiates light onto the display unit, a rear housing attached to an opposite side of the display unit from the display surface, a rear cover that covers a part of the rear housing, and a speaker attached to the rear housing. The speaker includes a speaker main body, a first cover member to which the speaker main body is attached and having an outer surface facing the rear housing, a second cover member disposed so as to face the first cover member across the speaker main body, a retaining member disposed between the speaker main body and the first cover member and fixed to the rear housing by a fastening member, and a magnet attached to the outer surface of the first cover member and fixing the speaker main body to the rear housing.
US11653126B2
A method at a sensor apparatus, the method including calculating a value for a target function based on at least one sensor of the sensor apparatus; determining that the value of the target function is within a defined threshold range for a defined time period, thereby finding an in-flight state for the sensor apparatus; and turning off transmission from a radio of the sensor apparatus based on the in-flight state.
US11653124B2
An image sensor includes a pixel suitable for supplying a pixel signal corresponding to sensed light to an output node; a current source suitable for sinking a current from the output node and increasing the amount of sinking current in a first boosting section within a section in which the pixel signal is output from the pixel; and an analog-to-digital conversion circuit suitable for digitally converting a voltage of the output node.
US11653121B2
A photoelectric conversion apparatus includes a light receiving circuit configured to convert light into an electrical signal, a readout circuit configured to read out an analog signal corresponding to the electrical signal, a ΔΣ A/D converter configured to convert the analog signal into a digital signal, and a control circuit configured to change a gain of the photoelectric conversion apparatus in accordance with a change of a driving mode of the photoelectric conversion apparatus. The analog signal read out by the readout circuit is an analog current signal. The readout circuit includes a variable resistor on a signal path for supplying the analog current signal to the ΔΣ A/D converter. The control circuit changes the gain of the photoelectric conversion apparatus by changing a resistance value of the variable resistor.
US11653118B2
Systems and methods for down-scaling are provided. In one example, a method for processing image data includes determining a plurality of output pixel locations using a position value stored by a position register, using the current position value to select a center input pixel from the image data and selecting an index value, selecting a set of input pixels adjacent to the center input pixel, selecting a set of filtering coefficients from a filter coefficient lookup table using the index value, filtering the set of source input pixels to apply a respective one of the set of filtering coefficients to each of the set of source input pixels to determine an output value for the current output pixel at the current position value, and correcting chromatic aberrations in the set of source input pixels.
US11653112B2
A method including collecting analog image data from an imaging array wherein the analog image data includes analog image data from a plurality of imaging pixels and from a plurality of opaque pixels. Each row of the imaging array includes both imaging pixels and opaque pixels. Opaque subtraction is performed in an analog domain, wherein biases determined in the opaque pixels for a given row of the imaging array are subtracted from the analog image data of the imaging pixels of that given row for each row of the imaging array. Performing opaque subtraction includes suppressing outliers in the analog image data from the plurality of opaque pixels. The method includes performing analog to digital conversion (ADC) on the analog image data to produce digital image data for the imaging pixels. ADC is performed after opaque subtraction in the analog domain.
US11653106B2
An image capturing apparatus includes a plurality of imaging units arranged in a circumferential manner and movable in a circumferential direction, and a plurality of illumination units arranged in such a manner that each of the plurality of illumination units corresponds to a different one of the plurality of imaging units. In a case where the plurality of imaging units moves in the circumferential direction, each of the plurality of imaging units integrally moves with a corresponding one of the plurality of illumination units.
US11653104B2
Systems, methods, and software described herein manage video data processing resources for video data obtained from one or more sources. In one implementation, a management system may monitor processing requirements for the video data and computing resources available at multiple video processing locations. The management system may further allocate processing operations to the video processing locations based on the processing requirements for the video data and computing resources available at the video processing locations.
US11653103B2
Embodiments provide a lens moving apparatus including a housing supporting a magnet, a bobbin having an outer circumferential surface on which a first coil is disposed, the bobbin moving in the housing in a first direction, upper and lower elastic members each connected to both the housing and the bobbin, and a second coil disposed so as to be spaced apart from the first coil in the first direction, wherein the second coil generates induction voltage resulting from inductive interaction with the first coil when the bobbin moves in the first direction.
US11653102B2
The present disclosure discloses an image flicker detection method that includes the steps outlined below. An image retrieving is performed to retrieve a current image. A current variation ratio between first rows of pixels of the current image and second rows of pixels in a previous image is calculated. When both the current variation ratio and a previous variation ratio are determined to be larger than a ratio threshold, a detected flicker number is incremented. When the detected flicker number is determined to be larger than a flicker number threshold, a flicker condition is determined to occur. When the detected flicker number is determined to be not larger than the flicker number threshold, the current image becomes the previous image and the current variation ratio becomes the previous variation ratio such that a next image becomes the current image to repeat the above steps.
US11653099B2
A processor-implemented method with image reconstruction includes: acquiring information indicating an amount of ambient light in accordance with a shutter exposure time of a camera; generating an ambient light pattern based on the information about the amount of ambient light; generating a compensation pattern which compensates for a invertibility of an external illumination pattern based on the ambient light pattern; controlling an operation of an external illumination based on the compensation pattern to acquire a photographed image by a camera; and reconstructing a latent image of the photographed image in the acquired photographed image based on the compensation pattern.
US11653090B1
A distributed system for live traffic monitoring and optimization includes a central computer and a plurality of mobile client devices at different geographical locations. Each mobile client device may run a software application to capture images of its current location and the associated location coordinates of each image and communicate the combined digital data of each location to the central computer. The central computer may collect the digital data of every location from all mobile client devices in that location, continuously updating and processing them to provide the most up-to-date and comprehensive graphical information of any location.
US11653089B2
An imaging apparatus according to embodiments of the present disclosure includes a sensor unit, a front engine that generates compressed raw image data by processing image data acquired from the sensor unit, a main engine that executes a development process on the compressed raw image data acquired from the front engine, and a display unit that displays an image. The front engine controls the display unit to display an image based on the image data acquired from the sensor unit, and the main engine records the image data subjected to the development process in a recording medium.
US11653085B2
To simplify the use of a functional scope of a medical image recording system, for example an endoscopy system, a method is proposed in which an image processing unit of the image recording system recognizes predefined image recording situations on the basis of an image sequence recorded using an image sensor of the image recording system and in response thereto proposes an adaptation to a user that results in an improved display and/or an improved recording of the image sequence in the respective recognized image recording situation. The adaptation can relate here to an algorithm, using which the image sequence is processed after the recording, and/or an image recording method currently used to generate the image sequence.
US11653079B2
The present disclosure provides a camera module, a circuit board assembly and a manufacturing method thereof, and an electronic device with the camera module, wherein the circuit board assembly comprises at least one electronic component, a substrate, and a molding unit. At least one of the electronic components is connected to the substrate conductively on a back face of the substrate. The molding unit comprises a back molding portion and a molding base, wherein the molding base is bonded to a front face of the substrate integrally when the back molding portion is bonded to at least a part of an area of the back face of the substrate integrally. There may be no need to reserve a position on the front face of the substrate to conductively connect the electronic components, so that the length and width of the camera module can be reduced, thereby reducing the volume of the camera module.
US11653078B2
An optical device comprises at least one printed circuit board, the printed circuit board includes an electronic image-capture circuit, a lens holder comprising at least one optical lens, the lens holder comprising a wall forming a cavity extending along the optical axis of the device from its top end to its bottom end, the bottom end being mounted on the rigid printed circuit board so as to align, along the optical axis of the device, the electronic image-capture circuit and the optical lens, a flexible heater band arranged in contact with the wall of the lens holder and around the wall of the lens holder, the heater band comprising an electrical connection interface electrically connected to at least one rigid printed circuit board of the optical device.
US11653076B2
An internet protocol (IP)-based ceiling or wall-mounted speaker with optional IP-based camera and/or alarm indicator is provided. The IP-based speaker has a detachable add-on device for accommodating different types of interchangeable camera configurations and other components such as flush mount camera, camera providing angled view, night vision-type camera for different services and configurations. Multiple IP-based speakers are connected to an IP device to exchange audio data via an Ethernet connection for cost effective, flexible and convenient installations. The IP-based speaker has a speaker cone for talkback features, and relay for remote relay control of doors or gates for security applications as well as public address applications.
US11653069B2
Systems and methods are provided for presenting subtitles in association with a composite video. The systems and methods include a facility for uploading a subtitle file having the full subtitles information for the entire composite video. The uploaded subtitle file is then split to generate video content item subtitles files that correspond to video content items in the composite video.
US11653060B2
A set-top box for changing channels and method for use of the same are disclosed. In one embodiment, the set-top box includes a network interface controller that is configured to receive a source internet protocol television signal, which includes two channels, from an external source and at least partially prepare the source internet protocol signal in order to forward the tuned signal to a television. The set-top box saves in a buffer the at least partially prepared second channel beginning at a recent periodic, sequential signal access point. In response to receiving a channel change instruction when the set-top box is forwarding the at least partially prepared first channel signal, the set-top box causes the television tuner to forward the at least partially prepared signal based on the second channel stored in the buffer beginning at the recent periodic, sequential signal access point.
US11653052B2
Producing a privacy-protected video clip in a video management system includes retrieving a selected video clip constituting at least a portion of a stored video stream; obtaining segments of the video clip which are spaced apart in time and have a total length equal to a defined time period; combining the obtained segments of the video clip to form a background training clip; and processing the background training clip, or the separate segments, to produce a background model. The video clip is processed to produce a privacy-protected video clip, such that, for each image the video clip, the processing includes performing background subtraction, using the background model, to define foreground regions, and obscuring the defined foreground regions.
US11653051B2
The present disclosure describes techniques for controlling display of gifts in a web-based live broadcast The techniques comprises storing a host state gift object in a host state queue, wherein the host state gift object corresponds to a gift-giving behavior of a first user associated with a first client computing device; storing a plurality of guest state gift objects in a guest state queue, wherein the plurality of guest state gift objects correspond to gift-giving behaviors of other users; storing a plurality of display gift objects in a display queue; updating the display queue based on the host state queue or the guest state queue, wherein the host state queue has a higher priority than the guest state queue for updating the display queue; and causing to display each display gift object on an interface of the first client computing device in a form of a combo bar.
US11653045B2
Provided is a method for transmitting a broadcasting content and a line content, the broadcasting content and the line content being synchronously displayed, the method including: generating a line parity packet from a plurality of line data packets in each of which the line content is stored; transmitting the line data packet and the line parity packet through a communication line; and transmitting a plurality of broadcasting data packets in each of which the broadcasting content is stored, from a base station using a broadcasting wave, a transfer clock time of the broadcasting content being delayed by a predetermined time compared with a transfer clock time of the line content. At this point, video quality can be improved when the real-time broadcasting program content and the real-time line content are simultaneously displayed.
US11653042B2
An apparatus and a method for providing information used for generating and consuming multimedia content in a broadcast system supporting a multimedia service based on an Internet protocol are provided. The method includes composing a message type field containing information indicating on a type of control information contained in the control message, composing a length field containing information on the length of the control message, composing optional fields having different values according to the type of the control information, and composing a payload field containing content of the control information.
US11653038B2
Disclosed herein are system, apparatus, article of manufacture, method and/or computer program product embodiments, and/or combinations and sub-combinations thereof, for facilitating dynamic content modification. An example embodiment operates by provisioning, by a content-management system in network communication with a content-presentation device, the content-presentation device with multiple supplemental content segments including a primary supplemental content segment and a backup supplemental content segment in response to a modifiable content segment being scheduled to be present at an upcoming time on a channel that is being received by the content-presentation device. After the provisioning and before the upcoming time, the example embodiment selects one of the provisioned supplemental content segments for application by the content-management system in the dynamic content modification at the upcoming time. The example embodiment further performs the selecting based on whether the modifiable content segment will actually be present on the channel at the upcoming time.
US11653037B2
In one aspect, a method is for use in connection with a content-modification system that includes a content-distribution system and a content-presentation device. The method includes (i) identifying an upcoming content modification opportunity on an identified channel, wherein the identifying is based on detecting a match between first reference fingerprint data representing an initial portion of a modifiable content-segment and query fingerprint data representing content transmitted by a content-distribution system to a content-presentation device, wherein the first reference fingerprint data was generated before the query fingerprint data was generated; and (ii) responsive to identifying the upcoming content modification opportunity, transmitting to the content-presentation device, second reference fingerprint data representing more than the initial portion of the modifiable content-segment to facilitate the content-presentation device to, at a later time, continue performing a content-modification operation related to the identified content modification opportunity.
US11653036B2
Embodiments of the present disclosure disclose a live streaming method and system, a server, and a computer storage medium. The method includes: providing, by a first end for information interaction, a first audio/video live stream for a server, and providing, by a second end for information interaction, a second audio/video live stream for the server. The method further includes performing, by the server, coding and processing on the first audio/video live stream and the second audio/video live stream, to obtain a third audio/video live stream, and pushing the third audio/video stream to a third end for information interaction; and receiving, by the third end, audio/video content of the first end and the second end according to the third audio/video live stream.
US11653034B2
An enhancement decoder for video signals, comprising an interface to receive a first video stream (1150) using a first signal element coding format from a standard decoder, an interface to receive an enhancement data stream and a de-multiplexer (200) to decompose the enhancement data stream into a first set of enhancement data, a second set of enhancement data and a range data. A first decoder video stream derived from the first video stream at a first resolution is enhanced by a first enhancer using the first set of enhancement data. A second decoder video stream derived from an output of the first enhancer is converted by an up-sampler to a second resolution. The second resolution being higher than the first resolution. A third decoder video stream derived from an output of the up-sampler at the second resolution is enhanced by a second enhancer using the second set of enhancement data. A coding format adjustment module converts one of the first to third decoder video streams from a first signal element coding format to a second signal element coding format using the range data.
US11653032B2
A video processing method, comprising: initializing a HMVP list for a current CTU row when the current CTU is the beginning CTU of a current CTU row; and processing the current CTU row based on the HMVP list. By performing the method, the encoding efficiency and decoding efficiency are improved.
US11653026B2
A video encoding system in which pixel data is decomposed into frequency bands prior to encoding. The frequency bands are organized into blocks that are provided to a block-based encoder. The encoded frequency data is packetized and transmitted to a receiving device. On the receiving device, the encoded data is decoded to recover the frequency bands. Wavelet synthesis is then performed on the frequency bands to reconstruct the pixel data for display. The system may encode parts of frames (tiles or slices) using one or more encoders and transmit the encoded parts as they are ready. A pre-filter component may perform a lens warp on the pixel data prior to the wavelet transform.
US11653025B2
A process for coding an image of a view from among a plurality of views, including the following steps: selecting a first or a second coding method to code image data from the image; generating a data signal containing information indicating whether it is the first or the second coding method that has been selected, and, if it is the first coding method, coding the original image data so as to provide coded original data, and, if it is the second coding method, coding processed image data from the image obtained by image processing of the original image data so as to provide coded processed data; and coding information describing the image processing which has been applied.
US11653023B2
There is provided an encoding device, an encoding method, a decoding device, and a decoding method capable of generating a more accurate three-dimensional model. A three-dimensional model generating unit generates three-dimensional model information representing a three-dimensional model of a subject on the basis of a plurality of captured images and active depth information, and a conversion processing unit converts the three-dimensional model represented by the three-dimensional model information into a plurality of two-dimensional images by projecting the three-dimensional model from a plurality of directions, and generates depth information representing a depth from an arbitrary viewpoint to the three-dimensional model by using the plurality of two-dimensional images. Then, transmit data including the plurality of two-dimensional images, the depth information, and the active depth information is transmitted to the decoding device. The present technology can be applied to, for example, a free viewpoint video transmission system.
US11653021B2
The present invention relates to a technique for encoding and decoding video data, and more particularly, to a method for performing inter-prediction in an effective manner. The present invention combines an inter-prediction method using an AMVP mode and an inter-prediction method using a merge mode so as to propose a method for using the same candidate. The method for encoding video data proposed by the present invention comprises the following steps: receiving mode information on an inter-prediction method of a current block; determining, on the basis of the received mode information, whether the interprediction method to be applied to the current block is an AMVP mode or a merge mode; and selecting a candidate to derive motion information of the current block, wherein the candidate is selected in a left region, top region and corner region of the current block and in the same position block as the current block, and the AMVP mode and the merge mode are applied on the basis of the selected candidate.
US11653019B2
Disclosed are an image coding and decoding methods, an image processing device, and a computer storage medium. The image coding method comprises: obtaining a dynamic range of a copy parameter of a current coding sampling value segment according to a size of a reference area; and coding the copy parameter according to the dynamic range to generate a video bitstream containing information about the size of the reference area and information about the copy parameter. The decoding method comprises: parsing a video bitstream to obtain a dynamic range of a copy parameter of a decoding sampling value segment; and decoding the copy parameter according to the dynamic range.
US11653014B2
A method for decoding a large field of view video is disclosed. At least one picture of said large field of view video is represented as a 3D surface projected onto at least one 2D picture using a projection function. The method comprises, for at least one current block of said 2D picture: —determining whether an absolute value of at least one component of a motion vector (d V) associated with another block of said 2D picture satisfies a condition; —transforming, based on said determining, said motion vector (d V) into a current motion vector (d P) associated with said current block responsive to said projection function; and —decoding said current block using said current motion vector (d P).
US11653005B2
A video coding mechanism is disclosed. The mechanism includes partitioning a picture into a plurality of tiles. A number of the tiles are included in a tile group. A flag is also encoded into a parameter set of a bitstream. The flag is set to a first value when the tile group is a raster scan tile group and a second value when the tile group is a rectangular tile group. The tiles are encoded into the bitstream based on the tile group. The bitstream is stored for communication toward a decoder.
US11653001B2
In some embodiments, a decoder may receive, from a bit stream for a block vector, an indication of a block vector predictor and a block vector difference. A sign of a directional component of the block vector difference may be determined based on: a directional component of the block vector, and a directional component of the block vector predictor. The decoder may decode the block vector based on the block vector predictor and the block vector difference. The decoder may generate an intra block compensated prediction of a block based on the block vector. The decoder may decode the block based on the intra block compensated prediction of the block and a prediction residual of the block.
US11653000B2
A video decoding method performed by a video decoding device according to the present document may comprise the steps of: acquiring image information from a bitstream, the image information including a picture header associated with the current picture including a plurality of slices; parsing, from the picture header, at least one of a first flag indicating whether information necessary for an inter-prediction operation for a decoding process is present in the picture header, or a second flag indicating whether information necessary for an intra-prediction operation for the decoding process is present in the picture header; generating prediction samples by performing at least one of intra-prediction or inter-prediction for the slices in the current picture on the basis of at least one of the first flag or the second flag; and generating reconstructed samples on the basis of the prediction samples.
US11652992B2
A method of partitioning in video coding for JVET, comprising representing a JVET coding tree unit as a root node in a quadtree plus binary tree (QTBT) structure that can have quadtree or binary partitioning of the root node and quadtree or binary trees branching from each of the leaf nodes. The partitioning at any depth can use asymmetric binary partitioning to split a node represented by a leaf node into two child nodes of unequal size, representing the two child nodes as leaf nodes in a binary tree branching from the parent leaf node and coding the child nodes represented by final leaf nodes of the binary tree with JVET, wherein further partitioning of child nodes split from leaf nodes via asymmetric binary partitioning is allowed recursively along the same branch in any order with symmetric partitioning.
US11652983B2
A solid-state imaging device includes a pixel that outputs a pixel signal of an analog signal, a readout unit that converts the pixel signal into a digital signal to generate a digital pixel signal, a memory unit that stores the digital pixel signal, and a first inspection signal output unit that outputs a first inspection signal to the memory unit such that the memory unit stores the first inspection signal. The first inspection signal stored in the memory unit is output from the memory unit in a period after output of the digital pixel signal of a frame ends and before output of the digital pixel signal of a next frame starts.
US11652978B2
A depth map generation device includes a plurality of image capture pairs, a depth map generation module, and a processor. The depth map generation module is coupled to the plurality of image capture pairs for generating a plurality of depth maps corresponding to the plurality of image capture pairs according to the image pairs captured by the plurality of image capture pairs. The processor is coupled to the depth map generation module for optionally outputting a depth map of the plurality of depth maps, or outputting a blending depth map composed of a part or all of the plurality of depth maps.
US11652976B1
An imaging system including: first camera and second camera; depth-mapping means; gaze-tracking means; and processor configured to: generate depth map of real-world scene of real-world environment; determine gaze directions of first eye and second eye; identify line of sight of user and conical region of interest real-world scene; determine optical depths of objects in conical region of interest, wherein at least first object, second object and third object from amongst objects are at different optical depths; adjust optical focus of one of first camera and second camera to focus on first object and second object in alternating manner, whilst adjusting optical focus of another of first camera and second camera to focus on third object; and capture images using adjusted optical focus of cameras.
US11652971B2
Embodiments disclose a real-time surgery method and apparatus for displaying a stereoscopic augmented view of a patient from a static or dynamic viewpoint of the surgeon, which employs real-time three-dimensional surface reconstruction for preoperative and intraoperative image registration. Stereoscopic cameras provide real-time images of the scene including the patient. A stereoscopic video display is used by the surgeon, who sees a graphical representation of the preoperative or intraoperative images blended with the video images in a stereoscopic manner through a see-through display.
US11652966B2
A projector includes a projecting section configured to display an image, an image interface to which an image signal corresponding to a first image is input from a personal computer, an image processing section configured to generate a second image obtained by reducing visibility of the first image based on the image signal, and a first control section configured to, when a first condition is satisfied, cause the projecting section to display the second image and, when a second condition is satisfied, cause the projecting section to display the first image.
US11652962B2
A system and method for moving and aligning tandem axle lock pins on a semi-trailer, having a viewer and a remote receiver that are placeable in communication with each other. The viewer is attachable to a trailer so that a camera on the viewer can be positioned such that the trailer slide rail and tandem axle slider frame of a trailer are within the field of vision. The remote receiver may be a smartphone which can access data from the camera so that the user can from a remote location, such as a cab of a tractor, determine the alignment and orientation of the trailer slide rail and the tandem axle slider frame.
US11652954B2
A video distribution apparatus (corresponding to an information processing apparatus) is provided with a light emitting diode (LED) (a tally lamp) for indicating whether a video is selected as a video being distributed or a video in a standby state by a switcher, which receives the video. In a case where a control command is received from an infrared remote controller (corresponding to an external device), the video distribution apparatus determines whether the LED (the tally lamp) is in an ON state or an OFF state. In a case of the ON state, the video distribution apparatus disables a control command from the infrared remote controller. In a case of the OFF state, the video distribution apparatus performs processing according to the control command from the infrared remote controller.
US11652938B2
An image forming apparatus includes a sheet feeding tray, a sheet discharge tray, and a conveyance mechanism. The conveyance mechanism includes a guide part, a first turning shaft, a second turning shaft, a coupling member and a drive part. The guide part has a sheet discharge port. The first turning shaft supports the guide part so as to be turned around an axis along a width direction crossing to the conveyance direction. The second turning shaft is provided on the downstream side of the first turning shaft and below the guide part. The coupling member has one end portion supported by the second turning shaft in a turnable manner and the other end portion provided so as to be slidable with respect to the guide part. The drive part turns the coupling member around the second turning shaft to change a height of the sheet discharge port.
US11652928B2
An operation setting selection apparatus includes, a physical property obtainer which obtains physical property information of a recording medium on which an image is formed; and a hardware processor. The hardware processor obtains from first information, in which operation failure information regarding contents of operation failure which occurs when an image forming operation is performed is associated to the physical property information of the recording medium used when the operation failure occurs and the operation setting regarding the image forming, the operation setting and the operation failure information associated to the physical property information obtained by the physical property obtainer. The hardware processor performs operation regarding selection of the operation setting regarding the image forming operation on the recording medium based on the physical property information, the operation setting and the operation failure information which are obtained.
US11652918B2
A system and method for providing assistance to a customer of a computing device. In one aspect, an incoming call is received from a device of a customer; a check for identification of the customer is done; an event history of the device is obtained; and a solution is provided to the customer using the event history. In another aspect, a method includes: receiving a code from a mobile computing device; and in response to receiving the code, calculating at least one set of data for use in guiding a request of a customer for service to a resource that can provide a suggested remedy. In another aspect, a method includes: identifying a user associated with a mobile computing device; determining an event history of the mobile computing device; and providing guidance to resolve an issue based on the event history.
US11652917B2
Systems and methods are provided to stop both external and internal fraud, ensure correct actions are being followed, and information is available to fraud teams for investigation. The system includes components that can address: 1) behavioral analytics (ANI reputation, IVR behavior, account activity)—this gives a risk assessment event before a call gets to an agent; 2) fraud detection—the ability to identify, in real time, if a caller is part of a fraudster cohort' and alert the agent and escalate to the fraud team; 3) identity authentication—the ability to identify through natural language if the caller is who they say they are; and 4) two factor authentication—the ability to send a text message to the caller and automatically process the response and create a case in the event of suspected fraud.
US11652911B2
A method and system for differentiating different Protocol Data Units (PDU) in a D2D communication network. The type of PDU to be differentiated is assigned/associated with a unique data/value and transmitted to the destination, by a transmitting User Equipment. At the receiving end, the receiving User Equipment differentiates between different types of PDU packets received, based on the unique data associated with the collected data. Further, the received PDU data is processed based on a suitable packet processing function that matches the PDU type of the PDU data received.
US11652905B2
The present invention relates to systems and methods for controlling real-time traffic surge at a server [102]. An Application Programming Interface (API) gateway [104] receives at least one service request from at least one application device [106] for availing at least one service from a server [102], and enables at least one part of the server [102] based on a count of the received requests determined by a load counter. A throttling parameter, including one of a static throttling parameter and a dynamic throttling parameter, is determined by a throttling parameter module [204] for the enabled at least one part of the server [102]. The API gateway [104] validates the at least one service request based on the count and the throttling parameter. Thereafter, the at least one part of the server [102] provides at least one service to the validated at least one application device [106].
US11652904B2
A method, system, and computer-readable medium are disclosed for generating a unified user profile. For example, a system may store, on a client device, a token under a first domain name. The token may specify state data for a communication session between the client device and a first content publisher addressed by the first domain name. The communication session utilizes a stateless communication protocol. The system may then generate a redirection resource locator. The redirection resource locator may include an identifier for a web object belonging to a second content publisher addressed by a second domain name and the token. The system then stores, on the client device, the token under the second domain name by directing the client device to send a web object request generated based at least in part on the redirection resource locator to the second content publisher. The web object request may request the web object from the second content publisher and including the token.
US11652899B2
Systems, methods, and apparatus to identify media devices are disclosed. An example apparatus includes memory, instructions, and at least one processor. The at least one processor is to execute the instructions to cause the at least one processor to at least monitor a home network associated with a panelist home for a network communication, maintain a table of device identifiers and respective media access control addresses corresponding to registered devices on the home network, in response to the detection of the network communication transmitted on the home network, attempt to identify a device identifier of the requesting device from the table of device identifiers and respective media access control addresses based on a media access control address of the requesting device; and in response to a failure to identify the device identifier, prompt the panelist to provide a device identifier for the unidentified device.
US11652893B2
Disclosed are techniques for processing user profiles using data structures that are specialized for processing by a GPU. More particularly, the disclosed techniques relate to systems and methods for evaluating characteristics of user profiles to determine whether to offload certain user profiles to the GPU for processing or to process the user profiles locally by one or more central processing units (CPUs). Processing user profiles may include comparing the interest tags included in the user profiles with logic trees, for example, logic trees representing marketing campaigns, to identify user profiles that match the campaigns.
US11652889B2
This application provides a communication method and a communications device. The method includes: obtaining a media access control (MAC) address that is of a terminal device and that is bound to a session and first route information of an interface, corresponding to the session, between a user plane function network element and a data network; and sending to an application function network element or a gateway of the data network, the MAC address that is of the terminal device and that is bound to the session and the first route information.
US11652881B2
In some embodiments, a method processes a first packet and generates a first copy of the first packet as a second packet. The method sends second copies of the first packet to a first group of multiple destinations defined by a first address. Also, the method sends the second packet to an interface with a loopback function. The interface recirculates the second packet for further processing. The second packet is processed where the second packet is assigned a destination of a second address. Then, the method sends copies of the second packet to a second group of multiple destinations defined by the second address.
US11652880B2
Aspects of the present disclosure relate to mapping content delivery. A client device provides, to a map management server, a request for a map of a geographic region. The client device receives, from the map management server, an identification of tiles for the map. The client device provides, to a first tile server, a request for the tiles for the map. In response to receiving the tiles from the first tile server: the client device displays the map of the geographic region based on the tiles.
US11652877B2
Techniques described herein relate to a method for managing nodes. The method may include sending, by a first node of nodes, a node information request to a social manager, where the node information request specifies a portion of a service to be provided to the first node; obtaining node information associated with a portion of the nodes from the social manager, where the portion of the plurality of nodes previously expressed node capability information and node configuration information associated with the portion of the service; identifying a second node of the portion of the nodes based on the node information to perform the portion of the service; and performing the service using the second node, where the second node performs the portion of the service.
US11652874B2
A verifier peer system transmits a request to an application of another peer system to obtain integrity data of the application. In response to the request, the verifier peer system obtains a response that includes kernel secure boot metrics of the other peer system and integrity data of the application and of any application dependencies. If the verifier peer system determines that the response is valid, the verifier peer system evaluates the integrity data and the kernel secure boot metrics against a set of Known Good Values to determine whether the integrity data and the kernel secure boot metrics are valid. If the integrity data and the kernel secure boot metrics are valid, the verifier peer system determines that the other peer system is trustworthy.
US11652868B2
A media distribution system includes an enterprise hub, which in turn includes a processor and memory, multiple media outlets, and multiple integrated services layers (ISLs) acting as intermediaries between the enterprise hub to the media outlets. A first media outlet is served by a single ISL, while a second media outlet is served redundantly by at least two ISLs.
US11652863B2
Aspects of the disclosure provide methods and apparatuses for cloud gaming. In some examples, an apparatus for cloud gaming includes processing circuitry. For example, the processing circuitry receives a video sequence and metadata associated with the video sequence. The video sequence includes a sequence of picture frames generated in response to gaming control information, and the metadata is indicative of the gaming control information. The processing circuitry can configure encoding parameters based on the metadata that is indicative of the gaming control information. Then, the processing circuitry can encode the video sequence into a coded video bitstream, based on the encoding parameters.
US11652848B1
A plurality of security rule processing nodes is configured for network traffic of a set of sources and destinations. Respective subsets of configuration information of the sources and destinations, including security rules, are transmitted to the nodes. Respective addresses of at least a subset of the nodes are transmitted to a packet processing intermediary. The intermediary requests evaluation of applicable security rules with respect to packet flows by selected nodes prior to initiating routing actions for packets of the flows.
US11652846B2
An intelligent electronic device (IED) of an electric power distribution system includes processing circuitry and a memory that includes a tangible, non-transitory, computer-readable comprising instructions. The instructions, when executed by the processing circuitry, are configured to cause the processing circuitry to receive operating data associated with the electric power distribution system, determine whether the operating data matches with expected operating data, generate a connectivity association key (CAK) based on the operating data in response to a determination that the operating data matches with the expected operating data, and establishing a connectivity association based on the CAK.
US11652845B2
An attack countermeasure determination includes a domain name input unit that receives any domain name as input, and acquires setting information corresponding to the domain name, registration information corresponding to the domain name, and external information corresponding to an internet protocol (IP) address corresponding to the domain name, as feature information on the domain name, an attack countermeasure determination unit that specifies a pre-designated category for the domain name on the basis of the feature information and determines, in a stepwise manner, an attack countermeasure against the domain name in accordance with the specified category, and an attack countermeasure information output unit that outputs attack countermeasure information corresponding to the attack countermeasure.
US11652843B1
A system and method for detecting cyber-attacks using quantile regression analysis are disclosed. The method includes identifying at least one hit quantile out of a plurality of quantiles, wherein at least one sample of traffic directed at a protected entity falls within quantile edges of the at least one identified hit quantile, wherein each of the plurality of quantiles is characterized by a probability distribution of at least one feature of a data stream, each of the plurality of quantiles having a respective probability estimate of bytes to fall into it; updating the probability estimates of the plurality of quantiles when the hit quantile has been identified; determining if the probability estimate of the at least one hit quantile is above a threshold; and detecting a cyber-attack when the probability estimate of the at least one hit quantile is above the threshold.
US11652842B2
Methods, apparatuses, and computer program products for edge device assisted mitigation of publish-subscribe denial of service (DoS) attacks are disclosed. An edge device hosts a virtualized copy of an Internet-of-Things (IoT) device subscribed to one or more publish-subscribe topics. When the edge device receives an indication to activate the virtualized copy of the IoT device, for example, during a DoS attack on the IoT device, the edge device activates the virtualized copy of the IoT device, which receives traffic from the publish-subscribe topic. The virtualized copy of the IoT device applies security policies to incoming traffic received from the subscription topics and transmits to the IoT device sanitized traffic obtained from the received incoming subscription content traffic.
US11652839B1
An attack tree model for an aviation system comprises a plurality of tree nodes organized as a tree. For each tree node of the attack tree model model, the tree node corresponds to a respective event that may befall aviation system. An analysis computing system generates one or more attack tree models for the aviation system, wherein the aviation system includes one or more systems, sub-systems, or components. The analysis computing system further performs an assessment of one or more of the system, sub-systems, or components of the aviation system using the one or more attack tree models, and outputs metrics indicative of the assessment.
US11652835B1
This technology maintains de-identified visit data to a plurality of websites from assigned user identifiers (UIDs) corresponding to a plurality of clients. The assigned UIDs include a different assigned UID for each client-website pair, the de-identified visit data associating the assigned UIDs to a plurality of groups. A first group from the groups is determined based on first request data corresponding to a first request from a client to a web server system. First group visit data describing visits to a set of the websites by assigned UIDs belonging to the first group is obtained from the de-identified visit data. Affinity data, comprising at least one affinity score for at least one of the websites, is generated based on the first group visit data. Generation of affiliate content based on the affinity data is caused, where the affiliate content corresponds to the at least one of the websites.
US11652834B2
Among other things, traces are received of activities of an online user who is associated with an entity. By analysis of the traces a security state of the entity is inferred. Also, a map is generated between (a) technical assets that contribute to security characteristics of respective entities and (b) the identities of the entities that are associated with the respective technical assets At least part of the generating of the map is done automatically. A user can he engaged to assist in the generating of the map by presenting to the user through a user interface (a) data about the technical assets of entities and (b) an interactive tool for associating the technical assets with the identities of the entities.
US11652819B2
Secure methods, systems, and media for generating and verifying user credentials are provided. In some embodiments, the method comprises: receiving, from a user device, a request for access to a service that requires valid user credentials; determining an aspect of the user credentials that is to be satisfied to grant access to the requested service; transmitting, to the user device, a request for information related to the aspect of the user credential; receiving, from the user device, information related to the aspect of the user credential, wherein the information has been signed using a key associated with the user device; verifying the key used to sign the information by the user device; in response to verifying the key used to sign the information, determining whether the aspect of the user credential has been satisfied based on the received information; and, in response to determining that the aspect of the user credential has been satisfied, granting access to the service.
US11652817B1
The technology described herein discloses systems and methods for upgrading biometric authentication system. The system can receive first biometric information in connection with an authentication request from a user. The system can authenticate the user via a first authentication system by comparing the first biometric information received in connection with the authentication request with second biometric information. The user can be automatically enrolled into a second authentication system using the first biometric information received in connection with the authentication request.
US11652811B2
The present disclosure pertains to provisioning of credentials, and in particular to provisioning of authentication credentials to a computer device for accessing a cloud platform computer system. The computer device obtains sensor data and sends a request including a device identifier to a provisioning server using a provisioning server network address. The computer device receives a response, from the provisioning server, including a platform credential and a platform server network address of a platform server. The computer device stores the platform credential. The computer device sends the sensor data and the platform credential to the platform server using the platform server network address.
US11652807B2
Provided is a computing device of a group based communication system configured to securely validate a client device associated with a group-based communication interface user. An example computing device is configured to identify a validating request transmitted from the client device. If a validating request is identified, the example computing device will transmit a temporary device code to the client device associated with the group-based communication interface user and an e-mail code to an e-mail address associated with a user profile associated with the group-based communication interface user. The example computing device also stores the codes transmitted. The example computing device then receives a confirmation exchange from the client device and determines whether the confirmation exchange satisfies client device validation parameters. If the confirmation exchange satisfies the client device validation parameters, the example computing device will validate the client device by transmitting and storing a long lived device code.
US11652804B2
A backend computer and methods of using the backend computer are described. The method may comprise: receiving, at a first backend computer, sensor data associated with a vehicle; determining a labeling of the sensor data, comprising: determining personal data and determining non-personal data that is separated from the personal data, wherein each of the personal and non-personal data comprise labeled data, wherein the personal data comprises information relating to at least one identified or identifiable natural person; and performing via the personal data and the non-personal data that is separated from the personal data, at the first backend computer, data processing associated with collecting sensor data associated with the vehicle.
US11652792B2
A network is secured by managing domain name requests such that client devices are restricted from visiting malicious or undesirable domains. An endpoint Domain Name Server (DNS) agent is installed on client devices on a local network, and the endpoint DNS agents intercept DNS requests from the client devices and process the received DNS request in the endpoint DNS agent based on a security policy set for the client device via the endpoint DNS agent. In a further example processing the received DNS request comprises identifying the client device, end user, and the DNS request to a cloud-based DNS server, and processing a response received from the cloud-based DNS server received in response to the DNS request. The endpoint DNS agent is further operable to distinguish between DNS requests for local domains and remote domains, and to redirect DNS requests for local domains to a local network DNS server.
US11652790B2
A quarantine system could be disposed between an outer firewall and an inner firewall. The quarantine system may include persistent storage containing mappings between computing devices disposed within the inner firewall and data sources disposed outside the outer firewall. The quarantine system may include one or more processors configured to perform operations that include requesting and receiving, based on the mappings, a software-related update from a data source, the software-related update being targeted for deployment on the computing devices. The operations may also include assigning the software-related update for review by a group of one or more agents authorized to approve or reject the software-related update. The operations may also receiving an indication that the software-related update has been approved by the one or more agents and, responsive to receiving the indication, transmitting, based on the mappings, the software-related update to a recipient device within the inner firewall.
US11652780B2
A method for synchronizing a binding process among a group of network devices connected to a server that is multi-homed to the group of network devices in provided. The method is executed by a first network device among the group of network devices and includes: receiving, from the server, network traffic associated with a host executing on the server; configuring, using the network traffic, a binding between the first network device and the host and setting a binding status of the first network device for the host to a first status; and transmitting, in response to the setting and via an out-of-band (OOB) channel to a second network device among the plurality of network devices, first binding instructions for causing the second network device set a binding status of the second network device for the host to a second status different from the first status.
US11652779B1
A system and method for improving the download time of emails in an environment in which a server distributes emails to persons working in close proximity to each other. When these persons receive multi-recipient emails intended for several or all of these persons, the server distributing the emails delivers the multi-recipient emails to the first one of the persons who logged on to read his or her emails on his or her personal computer, for distribution to the other persons over a personal area network. This reduces the download time for the persons downloading their emails at a subsequent time.
US11652777B2
Provided is an electronic device which periodically transmits current location information to the location information service providing server in case of executing grouping applications, produces group including at least one member, selected by a user, of address list information received from the location information service providing server, requests messages requesting group participation to the member included in the group through the social network service providing server in case of generating predetermined events, and periodically receives the location information from the member accepting the group participation and displays the received location information on a map.
US11652776B2
Systems and methods for providing notification delivery based on utilization of bloom filters are provided. A collaboration system obtains subscriber information for each user of a collaboration system, whereby the subscriber information corresponds to one or more features of content that are relevant to each user. The collaboration system hashes the subscriber information to generate a bloom filter for each user. The collaboration system receives an article to be published, whereby the article comprises a set of features. The set of features is hashed to obtain a hash set. The hashing of the set of features is performed using same hashing functions as that used to generate the bloom filter. The collaboration system compares the hash set to the bloom filter to identify a match, whereby the match indicates a feature of the article matches the subscriber information. The collaboration system generates a list of recipients based on the match.
US11652769B2
Snippets of content associated with a communication platform are described. In an example, based at least in part on a determination, by the communication platform, that a user of the communication platform is permitted to access one or more snippets of content provided by one or more other users of the communication platform, causing one or more user interface elements associated with the one or more snippets of content to be presented via a user interface of a user computing device of the user. The communication platform can receive, from the user computing device, a request to view a snippet of content of the one or more snippets of content and can cause the snippet of content to be presented by the user computing device via the user interface associated with the communication platform.
US11652763B2
Embodiments of the present disclosure disclose an information display method and apparatus, and an electronic device. The method in a specific embodiment comprises: receiving a multimedia information stream, wherein the information stream comprises a multimedia data stream, and interactive information sent by a user according to multimedia information content; determining data types corresponding to the interactive information, the data types comprising an emoji data type and a chat data type; and in response to determining that the interactive information is to be displayed on a display interface displaying the multimedia data stream, displaying the interactive information on the display interface in an interactive information display region corresponding to the data types, the interactive information display region comprising a chat information display region and an emoji information display region.
US11652762B2
Systems and methods for presenting graphical user interfaces corresponding to users and including portions of one or more chat sessions the users are participants in, the chat sessions facilitating synchronous textual communication between the users that takes place through a chat system are disclosed. Some implementations may: obtain chat information characterizing participants in the chat sessions; and effectuate presentation, responsive to receiving user input indicating a selection of the first user by the second user, of a first graphical user interface corresponding to the first user via a client computing platform associated with the second user.
US11652758B2
Systems and methods to reserve resources is provided. In exemplary embodiments, a selection of a profile from a user is received. A dynamic graphical user interface is generated, using one or more processors. The dynamic graphical user interface allows the user to configure a topology based on the selected profile. The dynamic graphical user interface provides input fields in which the user may select a resource. An indication of the selected applicable topology property for configuring the topology is received. A topology is automatically generating based in part on the selected applicable topology property.
US11652757B2
A system for enabling Time-Sensitive Networking (TSN)-stream configuration of a TSN network includes: a gathering device for gathering resource utilization information from TSN switches of the TSN-stream configuration as gathered resource utilization information; and a tool device for providing a TSN stream path calculation based on the gathered resource utilization information and allocating stream paths and establishing channel multiplexing in the TSN network based on the gathered resource utilization information.
US11652745B2
An on-board network system includes at least one processor. Plural relay devices that temporarily retain received data and relay the retained data in descending order of relay priority levels include a first relay device. For each set of data retained at the first relay device, the processor measures a retention duration for which the data is retained without being relayed. Data whose measured retention duration exceeds a predetermined threshold is congested data. A second relay device is a different relay device from the first relay device among the plurality of relay devices, and is capable of relaying the congested data. The processor requests the second relay device to raise the relay priority level of the congested data.
US11652742B2
Ghost routing is a network verification technique that uses a portion of a production network itself to verify the impact of potential network changes. Ghost routing logically partitions the production network into a main network and a ghost network. The main network handles live traffic while the ghost network handles traffic generated for diagnostic purposes. The ghost network may have a network topology identical to the production network and may use the same hardware and software as the production network. An operator may implement a network configuration change on the ghost network and then use verification tools to verify that the network configuration change on the ghost network does not result in bugs. Verifying on the ghost network may not affect the main network. If the network operator verifies the network configuration change on the ghost network, the network operator may implement the network configuration change on the main network.
US11652739B2
A method routes packets from a source to a destination across an IP network having a plurality of nodes (including the source and destination), and a plurality of network segments interconnecting the plurality of nodes. The source and destination are configured to use a given service. To those ends, the method receives information relating to the given service, and forms a path between the source and the destination. The path includes a) at least one intermediate node between the source and the destination and b) a plurality of specific network segments extending from the source to the destination. The plurality of specific network segments are a sub-set of the plurality of network segments. To form the path, the method assigns the plurality of specific network segments to the network path between the source and the destination as a function of the information relating to the given service.
US11652738B2
A device may provide path data identifying a primary path and one or more alternate paths for segment routing traffic in the network, and may receive performance data indicating a performance degradation in the primary path. The device may determine that the performance data satisfies a first threshold, and may request, based on the performance data satisfying the first threshold, alternate path performance data. The device may receive the alternate path performance data based on the request, and may compare the alternate path performance data for the one or more alternate paths. The device may select a particular alternate path, of the one or more alternate paths, based on comparing the alternate path performance data for the one or more alternate paths, and may trigger, based on the performance data satisfying a second threshold, a failover of the traffic from the primary path and to the particular alternate path.
US11652733B2
Techniques for operating a networking switch in two broadcast networks are provided. In some embodiments, the switch may instantiate a first controller client and a second controller client in a control plane of the switch; register the first controller client with a first broadcast controller associated with a first broadcast network; and register the second controller client with a second broadcast controller associated with a second broadcast network. The switch may further receive a first multicast route through the first controller client; receive a second multicast route through the second controller client; and program at least one of the first multicast route and the second multicast route into a multicast routing information base.
US11652731B2
Methods for dynamic routing of queued network-based communications using real-time information and machine learning are performed by systems and devices. Requests associated with fulfillments are received over a network from requestor systems, and the requests are queued in a data structure of a queue. Information that includes geolocation information from a user device of a user that is associated with the fulfillment, temporal information from the user device, or related request information associated with another request is then received over the network, and a fulfiller and a fulfillment time for the fulfillment are determined from the information. The request is provided from the queue to the fulfiller at the fulfillment time over the network.
US11652720B2
The present disclosure relates to systems, methods, and computer readable media for predicting deployment growth on one or more node clusters and selectively permitting deployment requests on a per cluster basis. For example, systems disclosed herein may apply tenant growth prediction system trained to output a deployment growth classification indicative of a predicted growth of deployments on a node cluster. The system disclosed herein may further utilize the deployment growth classification to determine whether a deployment request may be permitted while maintaining a sufficiently sized capacity buffer to avoid deployment failures for existing deployments previously implemented on the node cluster. By selectively permitting or denying deployments based on a variety of factors, the systems described herein can more efficiently utilize cluster resources on a per-cluster basis without causing a significant increase in deployment failures for existing customers.
US11652715B1
A method for detecting network mis-cabling includes receiving, from a discovery process, an original remote device identifier (“ID”) and remote port ID of a port of a remote device connected to a port of a local device and storing the original remote device ID and remote port ID together with a local device ID and a local port ID of the port of the local device. The method includes receiving, from the discovery process, a new remote device ID and remote port ID for a remote device connected to the port of the local device, and comparing the original remote device ID and port ID with the new remote device ID and remote port ID. The method includes, in response to the original remote device ID and the original remote port ID not matching the new remote device ID and the new remote port ID, sending a mismatch alarm.
US11652714B2
Embodiments are directed to monitoring network traffic using network monitoring computers (NMCs). Two or more network segments coupled by a traffic forwarding device (TFD) may be monitored. External network addresses and internal network addresses may be determined based on encrypted network traffic exchanged between external endpoints and the TFD and internal network traffic exchanged between internal endpoints and the TFD. Metrics associated with the external network addresses or the internal network addresses may be determined based on the monitoring. Correlation scores may be provided for the external network addresses and the internal network addresses based on of a correlation model, the metrics, or the other metrics. If a correlation score associated with an external network address and an internal network address exceeds a threshold value, the external network address and the internal network address may be associated with each other based on the correlation score.
US11652710B1
Mechanisms for redistributing computing resources in a distributed data processing system is provided. Performance metrics are collected for processing requests associated with a computer operation for which there is an established service level agreement (SLA) having a required SLA performance metric. The performance metrics are compared to the SLA performance metric to select an SLA for which the SLA performance metric is being met. A plurality of computer simulations are executed that simulate different distributions of computing resources. Simulation results are compared to the SLA performance metric to identify one or more computer simulations whose results either meet, exceed, or are closest to the SLA performance metric of the selected SLA. A distribution of computing resources is selected based on the comparison and the computing resources are redistributed accordingly.
US11652709B2
A method for managing computation load of a fog node is disclosed, wherein a computation capacity of the fog node is predicted to become unavailable to a fog network. The method comprises identifying a candidate set of nodes for computational load transfer from the fog node. The method further comprises obtaining a computation graph representing computation in the fog network, and using a learning model to identify a morphism from the obtained computation graph to a new computation graph, in which the fog node is not included. The identified morphism comprises a sequence of one or more morphing operations that replaces the fog node in the obtained computation graph with a topology of one or more nodes selected from the candidate set. The method further comprises causing computation performed at the fog node to be transferred to one or more nodes of the candidate set.
US11652703B2
Technologies for implementing edge intelligence for utility communication networks are provided. For example, a system includes a mesh network and a utility fog configured to manage the mesh network. The utility fog includes a secure utility system configured for executing a private utility application and a first edge intelligence device configured for executing a first subset of software applications. Each software application is configured to manage endpoints in the mesh network or process data collected by the mesh network. The mesh network includes the endpoints and an edge intelligence device configured for executing a second subset of the software applications that is different from the first subset of software applications.
US11652693B2
The present disclosure relates to a method for anchoring an edge cloud to a central cloud, the method being performed in a cloud environment comprising a central cloud and an edge cloud, the method comprising obtaining (S238, S310), by a connectivity controller of an edge cloud, an address of an anchoring registry of a central cloud; sending (S240, S312), by the connectivity controller, to the anchoring registry, information about networking configuration of the edge cloud; setting up (S246, S314), by an orchestrator of the central cloud, a virtual private network, VPN, service in the central cloud; requesting (S248, S316), by the orchestrator of the central cloud, edge VPN configuration information from the central VPN service, based on the information about networking configuration of the edge cloud; sending (S252, S318), by the anchoring registry, the edge VPN configuration information, to an orchestrator of the edge cloud; creating (S258, S320), by an orchestrator of the edge cloud, an edge VPN service, based on the edge VPN configuration information; and establishing (S260, S322) a VPN connection between the edge VPN service and the central VPN service, whereby services from either one of the edge cloud or the central cloud are exposed in the edge cloud and the central cloud.
US11652689B2
Disclosed herein are system, method, and device embodiments for zero touch deployment and dynamic configuration. A management server receives a dynamic configuration value for a configuration setting via a configuration service, and generates configuration information including a mapping of a configuration setting to the dynamic configuration value. Further, the management server receives a configuration information request including an identifier associated with a remote client device, and sends the configuration information to the remote client device.
US11652686B2
A method for dynamically provisioning computer components using a message platform communicatively coupled to a message generator is provided. The method includes receiving a first computer message, wherein the first computer message indicates that a computer component should be provisioned for a network cluster, routing the first computer message such that a first platform that is a customer of the first queue i) receives the first computer message and ii) automatically performs a first configuration operation on the computer component based on the first computer message, receiving, at the advanced message queue exchange, a second computer message from the first platform, and routing the second computer message such that a second platform that is a customer of the second queue i) receives the second computer message and ii) automatically performs a second configuration operation on the computer component based on the second computer message.
US11652673B2
An apparatus and method for providing a decision feedback equalizer are disclosed herein. In some embodiments, a method and apparatus for reduction of inter-symbol interference (ISI) caused by communication channel impairments is disclosed. In some embodiments, a decision feedback equalizer includes a plurality of delay latches connected in series, a slicer circuit configured to receive an input signal from a communication channel and delayed feedback signals from the plurality of delay latches and determine a logical state of the received input signal, wherein the slicer circuit further comprises a dynamic threshold voltage calibration circuit configured to regulate a current flow between output nodes of the slicer circuit and ground based on the received delayed feedback signal and impulse response coefficients of the communication channel.
US11652670B2
A method for transmitting a sounding reference signal and a terminal device are provided. The method includes: receiving, by the terminal device, SRS configuration information from a network device; determining, based on one or more of an SRS bandwidth configuration parameter, a sequence number nSRS of a quantity of SRS transmissions, a quantity Λ of antenna ports, and the received SRS configuration information, an index α(nSRS) corresponding to an antenna port used to transmit an SRS; selecting the antenna port with the index of α(nSRS) from indexes corresponding to the Λ antenna ports; and transmitting the SRS through the antenna port with the index of α(nSRS) during an nSRSth SRS transmission. nSRS is an integer greater than or equal to 0, Λ is a positive integer greater than or equal to 4, and a symbol * indicates a multiplication operation.
US11652667B2
In one aspect, an apparatus includes: a front end circuit to process incoming radio frequency (RF) signals into orthogonal frequency division multiplexing (OFDM) samples of a plurality of OFDM symbols; a transform engine coupled to the front end circuit to convert the plurality of OFDM samples into a plurality of frequency domain sub-carriers; a demodulator coupled to the transform engine to demodulate the plurality of frequency domain sub-carriers; a channel estimation circuit coupled to the transform engine to determine a first channel estimate based on a first set of pilot sub-carriers of the plurality of frequency domain sub-carriers and a second channel estimate based on the first set of pilot sub-carriers; and a control circuit coupled to the channel estimation circuit to control a configuration of the demodulator based at least in part on a selected one of the channel estimates.
US11652657B2
Various embodiments relate generally to dating/friendship finder application systems. An online and in-person gathering system which includes a method for tracking affinity and aversion between users by requesting individual user's feedback on other users based on post-gathering interactions amongst them. System tracks and discloses affinity and aversion feedback towards another user to facilitate decision making with regards to attending or not attending a gathering. Gathering invites are visible or invisible to users based on the affinity and aversion responses from hosts (users planning a gathering) and prospective participant-users. Through empirical affinity and aversion feedback, system identifies proclivity towards personality types defined by the hashtag descriptors provided by users, as well as provide relevant ranking for the presentation of other users, gatherings and 3rd party content objects.
US11652649B2
Any electrical component that is responsive to a physical or environmental phenomenon may be used to create a secure sensor. A secure sensor may include a first electrical component having a first side connected to a voltage source, a second component having a first side connected to the voltage source, an analog comparator having a first input connected to a second side of the first component and a second input connected to a second side of the second component and an output that represents at least one bit of a key, and an analog to digital converter having an input connected to the second side of the first component wherein an output of said analog to digital converter is related to a physical phenomenon that the component responds to by a coefficient of the components characteristic. The first component and the second component may have the same nominal value. The first component, the second component and the analog to digital comparator may be encased in the same package. The package may be configured to inhibit inspection and discovery of components contained in said package. A processor may be connected to a key register and to a table containing the information related to the sensed physical phenomenon wherein the processor may be configured to store the key bits in the key register and is configured to store data corresponding to the sensed physical phenomenon. The processor may be configured to store a time stamp associated with an entry in the table. A communications interface may be connected to the processor.
US11652644B1
A method includes verifying a digital signature on a dual-signed message by a relying party computing system. Verifying the digital signature on the dual-signed message includes generating a cryptographic hash of content identified in the dual-signed message and signing the cryptographic hash using public key of a signing party computing system to generate a verifying hash. Verifying the digital signature on the dual-signed message further includes comparing the verifying hash to a value of the dual-signed message. Verifying the digital signature on the dual-signed message further includes, responsive to the verifying hash matching the value of the dual-signed message, determining that the digital signature on the dual-signed message is valid. The method further includes identifying an attribute of the dual-signed message by the relying party computing system. The method further includes, based on identifying the attribute, receiving a verification notification for the dual-signed message by the relying party computing system.
US11652642B2
Digital data locker system providing enhanced security and protection for data storage and retrieval
The subject matter herein is directed to a digital data locker that acts as an intermediary between end users operating end user device and document providers. The data locker provides the end user with a secure and easy way to manage, store, and retrieve data that is stored at the document providers. Specifically, the features provided by the data locker include, but are not limited to, a dual level of encryption for data, content assurance to determine whether the data is corrupted, and dissociation between an identity of an end user and the data of the end user stored at the document providers. More specifically, an end user device operated by the end user, through use of a single application, may access the data locker to securely store and retrieve data on/from the document providers.
US11652638B2
Systems and methods are provided for managing user identities in networks. One exemplary method includes receiving, at a communication device, an API call request for a credential from a relying party. The communication device includes an application that incorporates an SDK. After receiving the API call request for the credential, the communication device authenticates a user associated with the communication device and identified in the API call request. After authentication of the user the communication device generates, via the SDK, a private-public key pair and stores the private key in memory. The communication device compiles, via the SDK, a credential packet include the public key and identity data associated with the user and transmits the credential packet to the relying party, whereby the relying party is registered to the SDK to request assertions of an identity of the user.
US11652632B2
Examples described herein include systems and methods for contextually providing automated device enrollment into a management system. A management application on a user device can receive network settings for connecting to a local server. The network settings can be preconfigured by an administrator. The management application can cause the user device to send an enrollment request and a device identifier to the local server. The device identifier can be used to validate the device and provide a security token to the management application. The management application can use the security token to complete enrollment of the user device.
US11652623B2
Methods, systems, and computer program products for operating a secure conference system. A non-limiting example of the computer-implemented method includes transmitting an invitation for a conference to a plurality of participants and instructing a blockchain system to create a blockchain network at a start of the conference. The blockchain network includes a node corresponding to each of the plurality of participants and a node corresponding to a central conference device. The method also includes obtaining, from the node of the blockchain network corresponding to the central conference device, a secret key corresponding to the central conference device and receiving an media communication stream from each of the plurality of participants. The method further includes creating a mixed media communication stream by combining the media communication stream from each of the plurality of participants, encrypting, using the secret key, the mixed media communication stream and multicasting the mixed media communication stream to the plurality of participants.
US11652619B2
A system and method are described for proactively performing key swaps among nodes in a quantum key distribution (QKD) network. The method includes determining a routing solution for nodes in the QKD network; making the routing solution available to the nodes in the QKD network; and initiating key swaps among the nodes in the QKD network according to the routing solution, prior to key requests being made within the QKD network. The method can also include continuously performing key swaps among the nodes in the QKD network according to the routing solution; detecting a change in capacity and/or a change in demand on one or more links within the QKD network; determining a new routing solution based on the detected change; and continuously preforming subsequent key swaps according to the new routing solution.
US11652616B2
Aspects of the invention include initializing a local key manager (LKM) on a node of a computing environment. The node includes a plurality of channels. The LKM is configured to provide a secure data transfer between the node and an other node of the computing environment. A connection is established, by the LKM, between the LKM and an external key manager (EKM) that stores a shared key for the node and the other node. In response to establishing the connection, the LKM registers security capabilities of the plurality of channels. The security capabilities are used by the LKM to provide the secure data transfer between the node and the other node.
US11652615B1
A system for dispersing access rights for routing devices in a network including a router, a key and a key socket, and a key-router validation server. The router and the physical key must be present and both must be validated by the key-router validation server before the router can establish a VPN network between remote external and internal networks. Neither the key nor the router does contain critical information for allowing access to networks. Losing either the key, or the router, does not endanger security of the networks. This is the essence of dispersed access rights.
US11652609B2
The present embodiments relate to systems and methods for using a blockchain or shared ledger to handle a total loss of a vehicle associated with a Vehicle Identification Number (VIN). A vehicle lifecycle may be tracked on a blockchain according to VIN. If the vehicle suffers a total loss, a transaction is broadcast to the blockchain to update the shared ledger to record the loss status of the vehicle. The blockchain may also include other information, such as mileage, regarding the vehicle and searchable by VIN. The other information and the loss status may be used to determine whether the vehicle likely represents a total loss.
US11652606B2
A stacked-substrate advanced encryption standard (AES) integrated circuit device is described in which at least some circuits associated logic functions (e.g., AES encryption operations, memory cell access and control) are provided on a first substrate. Memory arrays used with the AES integrated circuit device (sometimes referred to as “embedded memory”) are provided on a second substrate stacked on the first substrate, thus forming a AES integrated circuit device on a stacked-substrate assembly. Vias are fabricated to pass through the second substrate, into a dielectric layer between the first substrate and the second substrate, and electrically connect to conductive interconnections of the AES logic circuits.
US11652604B2
Methods and systems described herein improve blockchain storage operations in a variety of environments. A blockchain compression system may determine that a blockchain compression condition associated with a blockchain having a first plurality of blocks has been satisfied. In response, the system compresses the first plurality of blocks using a first hash tree into a first root hash value and stores the first plurality of blocks in a first database. The blockchain compression system generates a first new era genesis block that includes the first root hash value and a first database address of the first database at which the first plurality of blocks are stored. The blockchain compression system stores the blockchain at one or more nodes in a blockchain network. The blockchain includes the first new era genesis block and any previous new era genesis blocks. This may effectively reduce storage requirements for the blockchain, in various embodiments.
US11652596B2
Provided in the present invention is a method executed by user equipment, the method comprising: receiving downlink control information (DCI); determining, according to the DCI, a number of subframes occupied by a physical uplink shared channel (PUSCH) transmission comprising one or more PUSCH repetitions; dividing the one or more PUSCH repetitions into one or more blocks of PUSCH repetitions; and determining a redundancy version index for each of the one of more blocks of PUSCH repetitions, where each of the one or more blocks of PUSCH repetitions comprises at least one PUSCH repetition.
US11652595B2
Techniques and examples of tracking reference signal and framework thereof in mobile communications are described. A user equipment (UE) receives, from a base station of a network, a reference signal via a communication link between the UE and the base station. The reference signal contains resource configuration with respect to tracking reference signal (TRS) configuration. The UE also receives, from the base station, a TRS burst containing a plurality of TRS symbols with one or more components of the UE configured according to the TRS configuration. The UE processes the TRS burst to perform channel estimation, synchronization, time tracking, frequency tracking, or a combination thereof.
US11652592B2
A method and apparatus are disclosed, from the perspective of the UE, for reporting channel state information (CSI). In one embodiment, the method includes a UE being configured with at least two CSI-RS (Channel State Information-Reference Signal) resources. In addition, the method includes the UE performing measurements on the at least two CSI-RS resources. The method also includes the UE generating multiple CSIs according to measurements on the at least two CSI-RS resources, wherein at least one CSI corresponds to measurements on more than one CSI-RS resource. The method further includes the UE reporting at least one of the generated CSIs.
US11652591B2
Various aspects of the present disclosure generally relate to wireless communication. In some aspects, a base station may determine a demodulation reference signal (DMRS) configuration and a physical uplink shared channel (PUSCH) transmission mode for a user equipment to use for one or more uplink transmissions. The base station may transmit a dynamic joint indication of the DMRS configuration and the PUSCH transmission mode. Numerous other aspects are provided.
US11652584B2
A device that comprises a plurality of distributed transceivers, a central processor and a network management engine may be configured to function as relay device, relaying an input data stream from a source device to at least one other device. The relaying may include configuring one or more of the plurality of distributed transceivers to particular mode of relay operation and receiving the input data stream from the source device via at least one of the configured one or more of the plurality of distributed transceivers. The relaying may also include transmitting at least one relay data stream corresponding to the input data stream to the at least one other device, via at least one of the configured one or more of the plurality of distributed transceivers.
US11652583B2
An electronic communication device includes a controller which controls, according to the number of bit data in which an error has occurred of packet data transferred in serial communication, whether to start logging of information about the error of the packet data or stop logging of information about the error of the packet data.
US11652578B2
A method for transmitting hybrid automatic repeat request acknowledgement (HARQ-ACK) information by a user equipment (UE) in a wireless communication system is provided. The method includes receiving a physical downlink control channel (PDCCH) including information for downlink semi-persistent scheduling (DL SPS) release from a base station and transmitting an uplink channel including HARQ-ACK information for the PDCCH including the information for DL SPS release to the base station, in which a first symbol of the uplink channel is transmitted at least after a processing time (Tproc,3) from when a last symbol of the PDCCH is transmitted, and the processing time is determined based on a smaller value between a subcarrier spacing value of the PDCCH and a subcarrier spacing value of the uplink channel.
US11652570B2
According to one embodiment of the present invention, a method of receiving DCI by a UE includes receiving bundling information regarding REGs via higher layer signaling, performing blind detection for a PDCCH in a CORESET configured on a plurality of OFDM symbols, and acquiring DCI from the PDCCH. When the bundling information indicates a first value, the UE may perform bundling such that only REGs locating on a same RB and corresponding to different OFDM symbols in the CORESET, are bundled as 1 REG bundle, and when the bundling information indicates a second value, the UE may perform bundling such that the REGs locating on the same RB and corresponding to the different OFDM symbols are bundled as 1 REG bundle along with REGs locating on different RBs in the CORESET, and the UE may perform the blind detection of the PDCCH by assuming same precoding for REGs belonging to a same REG bundle as a result of REG bundling.
US11652566B2
In data communications, a suitably designed contrast coding scheme, comprising a process of contrast encoding (108) at a transmitter end (101) and a process of contrast decoding (120) at a receiver end (103), may be used to create contrast between the bit error rates ‘BERs’ experienced by different classes of bits. Contrast coding may be used to tune the BERs experienced by different subsets of bits, relative to each other, to better match a plurality of forward error correction ‘FEC’ schemes (104, 124) used for transmission of information bits (102), which may ultimately provide a communications system (100) having a higher noise tolerance, or greater data capacity, or smaller size, or lower heat.
US11652565B2
A redundancy system for a distributed antenna system is provided. The system includes a first communication link, a second communication link, a first communication node and a second communication node. The first communication link traverses first path. The second communication link traverses a second path. The second path is spatially separated from the first path. The first communication node is communicatively coupled to transmit the same signal through both the first communication link and the second communication link. The second communication node has a receiver system that is communicatively coupled to receive the signals transmitted through the first and second communication links. The receiver system is configured to synchronize delay and phase differences between the received signals and then combine the signals together to generate a single output.
US11652546B2
If wavelength defragmentation is performed during the operation of an optical network, an instantaneous interruption of a network arises; consequently, data are lost; therefore, an optical network control method according to an exemplary aspect of the present invention includes monitoring a data volume of a client signal to be transmitted using a plurality of optical subcarriers; and performing synchronously, depending on a variation in the data volume, an optical subcarrier changing process of changing an active optical subcarrier, of the plurality of optical subcarriers, to be used for transmitting the client signal, and a remapping process of remapping the client signal onto an active optical subcarrier after having been changed.
US11652542B2
The invention relates to inserting reference signals in a radio signal to be transmitted over a wireless communication system, the radio signal being emitted according to a specific SS-STBC scheme, the method comprising, inserting the reference signals to transmit them in the radio signal such as samples of these reference signals are in specific positions in the SS-STBC symbol.
US11652537B2
Interference in multi-feeder links of a same frequency between an aerial-floating type communication relay apparatus and plural gateway (GW) stations is suppressed. A transmission signal band of a feeder link is divided into plural divided frequency bands, and plural propagation path responses between plural GW stations and an antenna for feeder link of the communication relay apparatus are respectively estimated with respect to each of plural divided frequency bands, by setting a center frequency of the divided frequency band as an estimation frequency, based on a reception result of the pilot signals respectively received from the plural GW stations and separated from each other. A weight for suppressing an interference signal that causes an interference by a transmission signal transmitted from the GW station and received with a directional beam corresponding to another GW station is calculated for each of the divided frequency bands based on the plural propagation path responses. A reception signal received with the directional beam corresponding to the other GW station is multiplied by the weight corresponding to the other GW station and subtracted from the reception signal received with the directional beam corresponding to the other GW station, for each of the divided frequency bands.
US11652535B2
The improved beamforming devices for communication systems operating in the mm-wave spectrum are particularly designed for antenna architectures consisting of antenna arrays, comprising multiple antenna array elements. The disclosed approaches comprise intelligent two stage searches, wherein information from the first stage is used in the second stage. This significantly reduces the computational complexity compared to the known approaches, with minimal loss in performance.
US11652533B2
Currently, user devices in a 5G/6G wireless network must perform a complex iteration procedure to align their directional transmission/reception beams toward the base station. Disclosed is a faster, simpler procedure to enable users with beamforming capability to align their beams. The base station transmits a series of sequential signals, all with the same amplitude, modulation, and spatial distribution. A user device can receive the signals using directional reception beams oriented in various directions, measuring the signal quality for each of the reception beams. The user device can then select the reception beam with the best signal quality, or it can interpolate between the two best beams to determine the optimal alignment direction toward the base station. A single user device (such as a new arrival) can align its beam, or all of the user devices in the network can optimize their beams simultaneously, saving time at very low resource cost.
US11652515B2
Method and device for feeding back channel state information (CSI) and method and device for determining CSI are provided. The method for feeding back CSI includes feeding back CSI according to a determined structure of the CSI, where the structure of the CSI includes M CSI subsets; an m-th CSI subset among the M CSI subsets includes km channel information components. The M CSI subsets include N CSI subsets, and an n-th CSI subset among the N CSI subsets includes Ln channel information components which are determined by transforming a group of base vectors.
US11652514B1
System and methods for wirelessly transporting data from a first communication node to a second communication node using different combinations of beams and on a packet-by-packet basis. Packets associated with a certain Quality of Service (QoS) and/or latency requirements are transported between the first and the second nodes using a first transmission path, while packets associated with a different QoS/latency requirements, are transported between the first and the second nodes using another transmission path, in which in order to switch from the first path to the second path, the system adjusts appropriate beam directions in real-time, and so as to result in fast-switching beam configurations that dynamically change in accordance to packet movement in the network. Latency-critical packets are directed to the faster path, while other packets are directed to the slower path, so as to prevent network congestion and optimize overall network performance.
US11652510B2
A wearable audio output device is in communication with a first device and with a second device that is different from the first device. While outputting first audio from the first device, the wearable audio output device receives a first input corresponding to a request to output second audio from the second device; and, in response to receiving the first input: in accordance with a determination that the second audio from the second device satisfies audio priority criteria with respect to the first audio from the first device, the wearable audio output device: ceases to output the first audio from the first device; outputs the second audio from the second device; and causes the first device to display a first alert indicating that the first audio from the first device is not being output by the wearable audio output device.
US11652503B2
A communication system includes a plurality of full duplex transceiver assemblies each having an ON condition and an OFF condition, and configured to be worn by a different user, each of the plurality of full duplex transceiver assemblies having a housing and printed circuit board coupled to the housing, the printed circuit board including a transceiver having a microprocessor. Each microprocessor is configured to emit a different stream of controlling data when the plurality of full duplex transceiver assemblies are in the ON condition, thereby allowing each of the plurality of full duplex transceiver assemblies to communicate among a plurality of different logical channels. Embedded with each different stream of controlling data is a unique identification number for grouping each of the plurality of full duplex transceiver assemblies together.
US11652498B2
The present application concerns an iterative bit-flipping decoding method using symbol or bit reliabilities, which is a variation of GRAND decoding and is denoted by ordered reliability bits GRAND (ORBGRAND). It comprises receiving a plurality of demodulated symbols from a noisy transmission channel; and receiving for the plurality of demodulated symbols, information indicating a ranked order of reliability of at least the most unreliable information contained within the plurality of demodulated symbols. A sequence of putative noise patterns from a most likely pattern of noise affecting the plurality of symbols through one or more successively less likely noise patterns is provided. Responsive to the information contained within the plurality of symbols not corresponding with an element of a code-book comprising a set of valid codewords, a first in the sequence of putative noise patterns is used to invert the most unreliable information of the information contained within the plurality of symbols to obtain a potential codeword, and responsive to the potential codeword not corresponding with an element of the code-book, repeatedly: a next likely noise pattern from the sequence of putative noise patterns is applied to invert a noise effect on the received plurality of demodulated symbols to provide a potential codeword, each successive noise pattern indicating an inversion of information for one or more demodulated symbols for a next more reliable combination of information contained within the plurality of symbols, until the potential codeword corresponds with an element of the code-book.
US11652495B2
The disclosure relates to compressing strings by reducing the number of string characters that are stored. For example, a system may generate a first radix tree for a set of strings and a second radix tree for a reverse of each of the set of strings. The system may merge nodes of the first radix tree and/or second radix tree based on a tuning parameter. The system may identify, based on the first radix tree, beginning portions of at least two strings that match and identify, based on the second radix tree, ending portions of at least two strings that match. The system may use the matching beginning portions, the unique portions, and/or the matching ending portions to generate a pattern that matches the two or more strings. The system may store the two or more strings in association with the generated pattern without their matching beginning and/or ending portions.
US11652494B1
Methods and devices for digitizing an analog repetitive signal using waveform averaging are described. An example method includes generating a discrete set of analog dither offset voltages, wherein at least two of the discrete set of analog dither offset voltages are different from each other, receiving the analog repetitive signal comprising multiple instances of a waveform, wherein the waveform has a waveform duration, generate a timing alignment to align each waveform of the analog repetitive signal and the corresponding analog dither offset voltage over the waveform duration, combining, based on the timing alignment, each waveform and the corresponding analog dither offset voltage over the waveform duration to produce an analog output signal, converting the analog output signal to a digital output signal, and producing, based on the timing alignment, a digital averaged signal based on averaging the multiple instances of the waveform in the analog output signal.
US11652486B1
A bit line (BL) may be coupled at a first end to a BL driver (BLD) and at a second end to a BL receiver (BLR). The BL include a plurality of sections and each BL section may be coupled to at least one corresponding sectional configuration memory latch controlled by: at least one sectional word line write (WLW-k) signal, which when asserted enables data to be written into the at least one corresponding sectional configuration memory latch when a corresponding tri-stateable sectional driver (SD-k) is activated, and at least one sectional word line read (WLR-k) signal, which when asserted enables data to be from the at least one corresponding sectional configuration memory latch when the corresponding sectional pull-up (PU-k) is activated.
US11652481B2
One example of the present disclosure is an integrated circuit (IC). The IC includes an inverter with an input and an output, a clock transmission gate coupled to the output of the inverter; and a plurality of storage cells. The clock transmission gate is coupled to each of the plurality of storage cells, wherein each of the plurality of storage cells comprises a plurality of nodes arranged based on a minimum spacing.
US11652476B2
The present invention provides an output buffer including a first transistor, a second transistor and a pad-tracking circuit is disclosed. The first transistor is coupled between a supply voltage and an output node, wherein the output node is coupled to a pad. The second transistor is coupled between the output node and a reference voltage. The pad-tracking circuit is coupled to the control circuit and the first transistor, and is configured to generate a gate control signal to a gate electrode of the first transistor. The output buffer is selectively operated in an input mode and a fail-safe mode, and when the output buffer switches between the input mode and the fail-safe mode and the supply voltage of the first transistor ramps up or ramps down, the pad-tracking circuit generates the gate control signal to the gate electrode of the first transistor according to the voltage of the pad.
US11652462B2
Aspects of this disclosure relate to a multiplexer with a hybrid acoustic passive filter. The multiplexer includes a plurality of filters configured to filter respective radio frequency signals, a shared filter coupled between each of the plurality of filters and a common node, and a radio frequency filter coupled to the common node. At least a first filter of the plurality of filters includes acoustic resonators and a non-acoustic passive component. Related multiplexers, wireless communication devices, and methods are disclosed.
US11652461B2
A transistor device includes a transistor cell comprising a channel region, a gate runner that is electrically connected to a gate electrode on the channel region and physically separated from the gate electrode, and a harmonic termination circuit electrically connected to the gate runner between the gate electrode and an input terminal of the transistor device, the harmonic termination circuit configured to terminate signals at a harmonic frequency of a fundamental operating frequency of the transistor device.
US11652454B2
There is provided a monolithic microwave integrated circuit, MMIC, front-end module (100) comprising: a gallium nitride structure (110) supported by a silicon substrate (120); a silicon-based transmit/receive switch (130) having a transmit mode and a receive mode; a transmit amplifier (112) configured to amplify an outgoing signal to be transmitted by said MMIC front-end module, wherein said transmit amplifier is electrically connected (132) to said transmit/receive switch, wherein said transmit amplifier comprises a gallium nitride high-electron-mobility transistor, HEMT, (114) formed in said gallium nitride structure; and a receive amplifier (113) configured to amplify an incoming signal received by said MMIC front-end module, wherein said receive amplifier is electrically connected (133) to said transmit/receive switch, wherein said receive amplifier comprises a gallium nitride HEMT (115) formed in said gallium nitride structure.
US11652452B2
A power amplifier arrangement (200) for amplifying an input signal to produce an output signal comprises a plurality N of amplifier sections (212, 213), a first input transmission line (221) comprising multiple segments and a first output transmission line (231) comprising multiple segments. Each amplifier section comprises one or more first transistors (T1) distributed along the first input transmission line (221) and the first output transmission line (231). Each amplifier section is configured to amplify a portion of the input signal to produce a portion of the output signal. A portion of the input signal is one of N portions of the input signal partitioned on any one or a combination of an amplitude basis and a time basis. The output signal is produced at an end of the first output transmission line (231) by building up N potions of the output signal from each amplifier section.
US11652439B2
The present disclosure relates to a simple, lightweight, cost-effective, aesthetically pleasing, and strong system for mounting solar panel tiles (or other tiles/panels) over a roof (surface). The system includes frames (footage) parallelly positioned over the surface using reference bars passing through the frames, and bolts/screws to couple the frames to the surface. The frames include C-shaped grooves at both ends. Each groove is configured with a flat spring that is coupled to the grooves using a spring fixing bracket. Further, Z-shaped clamps are coupled at the bottom surface of the tiles to form a tile assembly. The spring is adapted to be pressed upon application of a force while mounting the tile assembly in the frames, which allows one side of the tile assembly, and the Z-shaped clamp on the other side of the tile assembly to be accommodated and locked in the two opposite C-shaped grooves of the frames.
US11652423B2
A switching power supply device according to an embodiment of the present disclosure includes: power supply circuits corresponding to phases of a polyphase AC power supply as an external power supply; a switching circuit configured to switch a connection destination of another power supply circuit other than a specific power supply circuit corresponding to a specific phase of the external power supply among the power supply circuits to a phase corresponding to the other power supply circuit or the specific phase; and a control unit configured to connect, to each phase of the external power supply connected to the switching power supply device, the other power supply circuit corresponding to the phase, and connect the other power supply circuit as a surplus to the specific phase when the number of phases of the external power supply is smaller than the number of the power supply circuits.
US11652420B2
An isolated converter with high boost ration includes a transformer, a first bridge arm, a second bridge arm, and a boost circuit. The transformer includes a secondary side having a secondary side first node and a secondary side second node. The first bridge arm includes a first diode and a second diode. The second bridge arm includes a third diode and a fourth diode. The boost circuit includes at least one fifth diode coupled between the first bridge arm and the secondary side second node, at least one sixth diode coupled between the second bridge arm and the secondary side first node, and at least two capacitors coupled to the secondary side first node and the secondary side second node.
US11652419B2
Systems and methods for voltage compensation based on load conditions in power converters. For example, a system controller for regulating a power converter includes a first controller terminal; a second controller terminal; and a compensation current generator. The compensation current generator is configured to receive an input signal through the first controller terminal. The input signal indicates a first current flowing through a primary winding of a power converter. The compensation current generator is configured to receive a demagnetization signal related to a demagnetization period of the power converter and associated with an auxiliary winding of the power converter. The compensation current generator is configured to generate a compensation current based at least in part on the input signal and the demagnetization signal. The compensation current generator is connected to a resistor. The resistor is configured to generate a compensation voltage based at least in part on the compensation current.
US11652414B2
A mixed analog-to-digital converter circuit capable of stabilizing voltages at two ends of a load and reducing output voltage ripples, includes a power supply, a digital converter, an analog converter, and a load assembly. The analog converter includes power supply capacitors arranged in parallel; and when working, the load assembly is connected to corresponding power supply capacitors, and the power supply capacitors not connected to the load assembly are connected to the digital converter. The digital converter includes a component multiplexer connected to input and output ends of a power supply through wires; the component multiplexer includes power supply capacitors arranged in series; the analog converter includes the component multiplexer; two ends of each power supply capacitor in the component multiplexer are respectively connected to input and output ends of the load assembly through discharge wires; and when working, the load assembly is connected to corresponding power supply capacitors.
US11652405B2
A signal amplifying circuit and associated methods and apparatuses, the circuit comprising: a signal path extending from an input terminal to an output terminal, a gain controller arranged to control the gain applied along the signal path in response to a control signal; an output stage within the signal path for generating the output signal, the output stage having a gain that is substantially independent of its supply voltage, and a variable voltage power supply comprising a charge pump for providing positive and negative output voltages, the charge pump comprising a network of switches that is operable in a number of different states and a controller for operating the switches in a sequence of the states so as to generate positive and negative output voltages together spanning a voltage approximately equal to the input voltage.
US11652395B1
Inertial actuators are provided, which use a one-dimensional or a two-dimensional voice coil array to achieve the same force output performance as a monolithic actuator. The voice coil arrays use less permanent magnet and flux conducting material, and have a lower inductance, while achieving increased frequency bandwidth.
US11652392B2
A pre-fitting nest and a method serve for forming a crown from a plurality of U-shaped electrically conductive hairpins to then be able to install the crown in a machine element of an electric machine, e.g., a stator. Here, an accommodating member has a plurality of grooves in which the legs of the hairpins are accommodated. The grooves are annularly disposed about a center and extend perpendicularly to the plane of the accommodating member. With respect to their size and geometry, they are configured such that in each case a first leg of a hairpin rotates within the groove thus to enable an unconstrained positioning of the second leg of the hairpin in another groove. One or several crowns formed from hairpins are provided for introduction into a machine element and inserted into the machine element.
US11652385B2
One embodiment relates to a motor comprising: a housing; a stator disposed in the housing; a rotor disposed in the stator; a shaft coupled to the rotor; a cover disposed on the housing; and an upper bearing disposed on the cover. The cover comprises: a first body having the upper bearing disposed thereon; a second body disposed on the lower side of the first body; a third body disposed on the lower side of the second body; and a protrusion part protruding in the radial direction from the outer peripheral surface of the second body, wherein the third body comprises an inclined surface inclining inwardly with respect to the outer peripheral surface of the second body. Accordingly, when a system and the motor are combined, the motor prevents an increase in the amount of interference between the housing and the cover by means of a reaction force design between the cover and each of the housing and the bearing, and thus a coupling failure in the assembly, as a result of a reaction force, occurring when the system and the motor are coupled may be prevented.
US11652384B2
A terminal assembly for a traction motor includes a bus bar having a ring shape and a terminal holder configured to accommodate the bus bar therein to cover an exterior of the bus bar. The terminal assembly includes: the terminal holder which is perforated to form a coupling hole therein through which a surface of the bus bar is exposed; and a temperature sensor unit which is inserted into the coupling hole and senses a temperature of the bus bar. The terminal assembly for the traction motor according to the present disclosure has a structure in which the temperature sensor unit is coupled to the terminal holder. Thus, the epoxy application process of the related art may be omitted, the occurrence of errors due to the epoxy application may be fundamentally prevented, and the assembly process may be further simplified.
US11652383B2
An electrical machine with a winding support is provided, which comprises a cylindrical base body and support teeth projecting radially from the base body and has grooves bounded by the base body and in each case two of the support teeth, and at least one winding supported by the winding support, which winding is formed by conductively connected conductor sections, which are each guided through at least one of the grooves of the winding support and project beyond the winding support at the axial end faces of the winding support, wherein a respective clamping ring is arranged at each axial end face of the winding support, wherein each clamping ring forms support sections that each extend radially along a respective axial end face of a respective one of the support teeth and mechanically contact at least parts of the conductor sections guided through the grooves adjacent to the respective support tooth, wherein the respective support section contacts the axial end face of the respective support tooth in a contact region, which is spaced apart from the adjacent grooves.
US11652381B2
A filtering of a load in an electrical architecture is provided. The load is equipped with power supply terminals allowing it to be connected to an electrical line of the architecture. The electrical architecture comprises, in addition to the connection to the electrical line and associated with each of the power supply terminals, an insulated electrical conductor connected, at a first of its ends, to the terminal under consideration, and not connected at a second of its ends.
US11652377B2
A rotor of a rotary electric machine includes a rotor core having a magnet insertion hole and a permanent magnet. A magnet insertion hole has an inner diameter side wall surface and an outer diameter side wall surface. A permanent magnet has an inner diameter surface and an outer diameter surface. The rotor further includes a foam adhesive sheet provided at least either between the inner diameter surface and the inner diameter side wall surface or between the outer diameter surface and the outer diameter side wall surface. The foam adhesive sheet includes a foam layer and an adhesive layer stacked in a radial direction. The foam layer is closely fixed to the permanent magnet. The adhesive layer faces the magnet insertion hole. The foam layer is foamed, the adhesive layer closely contacts with the magnet insertion hole, and the permanent magnet is fixed to the magnet insertion hole.
US11652371B2
A method of controlling a wireless power transmitter is discussed. The method includes transmitting a power signal having a predetermined strength; measuring a quality factor and a peak frequency of a coil of the wireless power transmitter using the power signal; receiving reference values including a reference quality factor and a reference peak frequency of a wireless power receiver; determining whether or not a foreign object is present in a charging area of the wireless power transmitter based on a comparison of the reference quality factor with the measured quality factor and a comparison of the reference peak frequency with the measured peak frequency; transmitting response signals indicating a result of the determination; and determining whether to continue or stop a wireless charging procedure based on the response signals.
US11652354B2
A charging device adapted to charge an automatic moving device includes a case, an electricity supply end, a baffle, an arm below the baffle, a blocking assembly on the arm, and a follower. The automatic moving device includes a driving part and an electricity reception end. The case has an opening. The baffle is pivotally connected to the case to cover or expose the opening. The arm has a fixed end and a free end. The blocking assembly is located at an inner side near the opening and movably located on a rotating path of the baffle. The follower is disposed on the free end. When the driving part approaches the opening, the follower moves away from the driving part to drive the blocking assembly to leave the rotating path. The automatic moving device pushes away the baffle, so that the electricity reception end docks with the electricity supply end.
US11652351B2
Various implementations described herein are directed to a method for detecting, by a device, an increase in temperature at certain parts of an electrical system, and taking appropriate responsive action. The method may include measuring temperatures at certain locations within the system and estimating temperatures at other locations based on the measurements. Some embodiments disclosed herein include an integrated cable combining electrical conduction and heat-detection capabilities, or an integrated cable or connector combining electrical conduction with a thermal fuse.
US11652347B2
A method, system and apparatus of fault detection in line protection for a power transmission system. A voltage (u) at a measurement point on an electrical line is obtained. The measurement point is a point at which a protection device for the line protection is installed. A current (i) at the measurement point is further obtained and a differential value of the current is determined. Then, a voltage (uq) at a setting point on the electrical line is determined from the voltage (u) at the measurement point, the current (i) at the measurement point and the differential value of the current (i) according to a time domain lumped parameter model for the electrical line. The voltage change between the determined voltage at the setting point during the fault period and a voltage at the setting point determined during a pre-fault period can be further determined. The fault detection can be performed based on the determined voltage change and a fault threshold. It can ensure voltage determination accuracy and detection reliability with a low sampling rate. Moreover, the solution can work right after the fault inception, almost no waiting time is required, and thus it may achieve a super-fast line protection.
US11652337B2
The disclosed robotic system may include (1) a drive subsystem that translates the robotic system along a powerline conductor and (2) a rotation subsystem coupled to the drive subsystem, where (a) the rotation subsystem is coupled to a container that defines an arcuate volume about an axis such that the container partially surrounds the powerline conductor when the axis aligns with the powerline conductor, (b) the container carries a segment of fiber optic cable coupled to the powerline conductor, and (c) the rotation subsystem, while the drive subsystem translates the robotic system along the powerline conductor, rotates the container about the powerline conductor while the axis is aligned with the powerline conductor such that the segment of fiber optic cable is wrapped helically about the powerline conductor. Various other systems and methods are also disclosed.
US11652315B2
An electrical power supply device is configured to communicate with a start-stop controller that automatically shuts down and restarts an internal combustion engine in a vehicle. The device includes a DC-DC power convertor and a device controller. The DC-DC power convertor is configured to produce a first voltage or a second voltage that is less than the first voltage. The device controller causes the DC-DC power convertor to produce the first voltage in response to a first signal from the start-stop controller indicating that the input voltage will remain equal to or greater than the threshold voltage and also causes the DC-DC power convertor to produce the second voltage in response to a second signal from the start-stop controller indicating that the input voltage may become less than the threshold voltage.
US11652314B2
A sealed electrical connector assembly includes a first and second connector member. The first connector member is arrangeable in open and sealed positions. In the sealed position, the first connector member is mated and sealed to the second connector member. The first and second connector member sealing walls face each other in a sealing region. The first and second connector members includes first and second connector member sealing walls extending essentially the same direction. In the sealed position, a flexible sealing element is configured to be arranged between and contacting the first and second connector member sealing walls in the sealing region. The flexible sealing element is fixed with respect to one of the sealing walls and is releasably engageable with another one of the sealing walls for providing a watertight seal. The sealing wall is slanted with respect to the first direction along an entire sealing region.
US11652313B2
An electrical connector includes a housing with a housing body and a cover mount. The housing has a cable cavity that extends through the cover mount along a connector axis. The electrical connector includes a first cover. The first cover is located on the first side of the connector axis. A second cover is located on a second side of the connector axis. The first cover engages the second cover to retain the covers in their relative positions. The covers also engage the cover mount to retain their position relative to the housing.
US11652311B2
A connector assembly includes a first connector and a second connector matable with the first connector. The first connector has a first housing and a pair of first conductive terminals disposed in the first housing each having a pair of first elastic terminals arranged symmetrically in a vertical direction. Each pair of first elastic terminals has a pair of front ends adapted to be brought into elastic and electrical contact with a pair of first wires inserted into the first connector. The second connector has a second housing and a pair of second conductive terminals disposed in the second housing each having a rear end adapted to be brought into elastic and electrical contact with a second wire inserted into the second connector. The pair of first elastic terminals each have a rear end adapted to clamp a front end of one of the second conductive terminals.
US11652310B2
A detachable capacitor connection structure is provided for a storage device. In an embodiment, a connection element detachably connects a capacitor module including one or more capacitors to a circuit board such that the capacitor module is stacked over the circuit board. The connection element includes: a first connector including two pin headers, mounted on a bottom plane of the capacitor module; and a second connector including two sockets, mounted on a top plane of the circuit board corresponding to the bottom of the capacitor module, suitable for connecting the first connector to the circuit board.
US11652303B2
A terminal assembly is disclosed. The terminal assembly comprises a main body having a welding platform and a first electrical conductive member having a connection terminal. According to the present invention, a welded structure is formed between the main body and the first electrical conductive member by making the connection terminal be welded on the welding platform. Briefly speaking, when utilizing this terminal assembly to make two electrical nodes be electrically connected to each other, one electrical conductive end of the main body and the first electrical conductive member are firstly connected to the two electrical nodes, respectively. Next, a welding process is applied to the welding platform and the connection terminal, such that an electrical connection is therefore established between the two electrical nodes.
US11652299B2
A tightly coupled dipole array is an egg-crate configuration defined by a plurality of electrically connected antenna unit cells. At least one of the unit cells utilizes a short or conductive element that shorts the common mode resonance. Shorting the common mode resonance in an intentional manner removes instances of the common mode resonance. To achieve the shorting of the common mode resonance, a conductive element is connected with one of the dipole arms and connected to the outer conductor of the feed or a ground plane. This creates a grounding loop that pushes the resonance out of the band of interest.
US11652294B2
The present disclosure relates to coaxial dual-band antennas. One example antenna includes a waveguide tube, a ring groove, and a high frequency feed. The waveguide tube has a tubular structure and is configured to transmit a first electromagnetic wave. The ring groove whose opening direction is the same as an output direction of the first electromagnetic wave is on a wall of the waveguide tube. A frequency of the first electromagnetic wave is lower than a frequency of an electromagnetic wave transmitted by the high frequency feed. The high frequency feed is located in the waveguide tube and has a same axis with the waveguide tube.
US11652292B2
A dual antenna with a shared radiator includes a radiator unit, a first feed-in unit, a second feed-in unit, a sensing module and a ground unit. The first feed-in unit and the second feed-in unit are respectively coupled with the radiator unit. The sensing module is connected to a substantial center of the radiator unit and used for sensing a distance between the radiator unit and an external object through the radiator unit. The ground unit is connected to the sensing module. The first feed-in unit is used to send or receive a first radio frequency signal together with the radiator unit, and the second feed-in unit is used to send or receive a second radio frequency signal together with the radiator unit.
US11652291B2
A tri-frequency multi-polarisation omnidirectional antenna comprising: a first plurality of curved electrically conductive strips arranged on the first face and being arranged to form an outer-loop; second plurality of curved electrically conductive strips arranged on the first face and being arranged to form an inner-loop; third plurality of curved electrically conductive strips arranged on the first face and being arranged to form middle-loop; a first power divider and a second power divider each connected to the strips of the inner-loop; a dielectric resonator comprising a first face, the first face arranged on the first face of the substrate; an electrically conductive probe being arranged at least partially within the dielectric resonator and extending at least part way along the symmetry axis.
US11652289B2
An antenna system and method for fabricating an antenna are provided. The antenna system includes a substrate and an antenna. The antenna includes a conductive particle based material applied onto the substrate. The conductive particle based material includes conductive particles and a binder. When the conductive particle based material is applied to the substrate, the conductive particles are dispersed in the binder so that at least a majority of the conductive particles are adjacent to, but do not touch, one another.
US11652287B2
A luminaire includes a light source positioned at a first level within a luminaire housing. The luminaire also includes a trim component positioned at a second level of the luminaire housing different from the first level. The trim component extends into a room from a ceiling surface and includes an aperture antenna that receives wireless signals and transmits wireless signals. Further, the luminaire includes a communication module that communicates wirelessly with one or more devices remote from the luminaire by controlling excitation of the aperture antenna.
US11652286B2
In one embodiment of the present disclosure, an antenna assembly includes a plurality of layers defining an antenna assembly including a plurality of PCB layers and a plurality of non-PCB layers, the antenna assembly having a top surface and a bottom surface, and adhesive coupling between the PCB layers and the non-PCB layers.
US11652284B2
A nozzle cap assembly includes a body with a first curved side wall, the body defining a top end and a bottom end positioned opposite from the top end; a nut, the top end of the body positioned between the nut and the bottom end of the body; a spacer comprising a hollow body, the hollow body defining a curved outer surface, the spacer positioned between the nut and the bottom end of the body; and an antenna assembly coupled to the curved outer surface.
US11652276B2
There is provided an information processing apparatus configured to execute communication with a communication apparatus including a plurality of antennas, comprising: communication unit for receiving a signal transmitted from each of the plurality of antennas of the communication apparatus; acquisition unit for acquiring information concerning a distance between the plurality of antennas of the communication apparatus, which is included in the received signal; and identifying unit for identifying information concerning an angle between the information processing apparatus and the communication apparatus based on the acquired information concerning the distance between the plurality of antennas.
US11652274B1
The present invention discloses a millimeter wave wireless connector chip, a wireless connector and a signal transmission system, wherein the chip comprises a data interface module, a serial-to-parallel conversion module, a millimeter wave transceiving module and a state machine control module; the data interface module is configured for receiving or sending a data signal; the serial-to-parallel conversion module is configured for converting a parallel signal into a serial signal and sending the serial signal to a wireless transceiving module, and is also configured for receiving the serial signal sent by the millimeter wave transceiving module and converting the received serial signal into a parallel signal; the millimeter wave transceiving module is configured for transceiving data by millimeter waves; and the state machine control module is configured for controlling the serial-to-parallel conversion module and the millimeter wave transceiving module to perform data reception, data sending or data dormancy.
US11652267B2
A conditioning integrated circuit (CDIC) chip can be used to aggregate signals to/from a number of beam forming integrated circuit (BFIC) chips, and signals to/from a number of CDIC chips can be aggregated by an interface integrated circuit (IFIC) chip. The CDIC chip includes temperature compensation circuitry to adjust the gain of the transmit and receive signals as a function of temperature based on inputs from a temperature sensor. The CDIC may include a plurality of beam forming channels each having a transmit circuit and a receive circuit, a common port coupled to the beam forming channels for selectively providing a common transmit signal to the beam forming channels and receiving a common receive signal from the beam forming channels, and a temperature compensation circuit configured to provide variable attenuation to the common transmit signal and the common receive signal based on a temperature sense signal.
US11652264B2
Microelectronic assemblies that include a lithographically-defined substrate integrated waveguide (SIW) component, and related devices and methods, are disclosed herein. In some embodiments, a microelectronic assembly may include a package substrate portion having a first face and an opposing second face; and an SIW component that may include a first conductive layer on the first face of the package substrate portion, a dielectric layer on the first conductive layer, a second conductive layer on the dielectric layer, and a first conductive sidewall and an opposing second conductive sidewall in the dielectric layer, wherein the first and second conductive sidewalls are continuous structures.
US11652258B2
A battery pack includes a battery cell and a casing configured to receive the battery cell. The casing has a vent hole configured to allow gas generated in the battery cell to be discharged therethrough, and a sound generator installed in the vent hole so as to block the vent hole. The sound generator is configured to allow the gas to pass therethrough, and generate a sound by the flow of the gas when the gas is discharged from the casing through the vent hole.
US11652257B2
A shock absorbing device for a rechargeable battery, in particular for supplying a machine tool with electrical energy, wherein the rechargeable battery includes a housing for accommodating at least one energy storage cell. The shock absorbing device includes at least one shock absorbing element for absorbing shock energy exerted on the housing of the rechargeable battery.
US11652253B2
An exemplary enclosure assembly includes, among other things, first and second pieces of an enclosure having an interior area. The first and second pieces are pressed vertically together at an interface. A gasket seal seals the interface at a position outside the interface relative to the interior area. An exemplary enclosure securing method includes, among other things, sealing an interface by compressing a gasket seal horizontally between first and second enclosure pieces of an enclosure that provides an interior area. The first and second pieces are pressed vertically together along the interface.
US11652251B2
An aqueous battery system includes an electrode assembly, a recombination device, and a controller. The recombination device has a catalyst that combines hydrogen and oxygen produced by the electrode assembly to form water and generate heat via exothermic reaction. The controller, responsive to a detected temperature or change in temperature associated with the recombination device due to the heat, changes power supplied to the electrode assembly.
US11652249B2
A battery module for a vehicle includes a cell module in which battery cells are overlapped with each other while having a predetermined directivity, and a cooling channel module directly bonded to at least one surface parallel to an overlap direction of the battery cells of the cell module, the cooling channel module having a refrigerant circulated therein, where a cell bonding surface of the cooling channel module has a wave-shaped cross section curved along a curvature formed by end portions of the overlapped battery cells.
US11652238B2
The present invention provides an electrolyte solution for a non-aqueous electrolyte solution battery capable of exhibiting excellent high-temperature cycle characteristics and excellent high-temperature storage characteristics at high temperature of 60° C. or above, and a non-aqueous electrolyte solution battery using the same. The electrolyte solution for a non-aqueous electrolyte solution battery of the present invention comprises at least: a non-aqueous solvent; a solute; at least one first compound represented by the following general formula (1); and at least one second compound represented by the following general formula (2).
US11652236B2
A sulfide solid electrolyte may include lithium, phosphorus and sulfur, and the sulfide solid electrolyte may have a diffraction peak A at 2θ=25.2±0.5 deg and a diffraction peak B at 29.7±0.5 deg in powder X-ray diffraction using CuKα rays, and a crystallite diameter in a range of from 5 to 20 nm.
US11652233B2
An embodiment of the present disclosure provides a battery pack including: a plurality of battery modules each including at least one battery cell; a housing supporting the plurality of battery modules which are arranged side by side in a first direction, the housing including a support wall that covers at least one surface of the plurality of battery modules and a barrier wall that is placed between the plurality of battery modules; a compression member provided on the housing and pressing the plurality of battery modules; and a cover coupled to the housing and covering the plurality of battery modules and the compression member.
US11652228B2
Disclosed is a method of manufacturing an electrolyte membrane for fuel cells. The method includes preparing an electrolyte layer including one or more ion conductive polymers that form a proton movement channel, and permeating a gas from a first surface of the electrolyte layer to a second surface of the electrolyte layer.
US11652223B2
An anode gas purge control method for a proton exchange membrane fuel cell is disclosed. An anode water management structure is constructed, and an anode nitrogen concentration observer is used to control the anode water management structure to operate. Liquid water contained in gas of a fuel cell stack is taken out by controlling a hydrogen flow rate through a hydrogen circulating pump and removed through a second water-vapor separator. Liquid water precipitated by gas condensation is removed through a first water-vapor separator. A nitrogen concentration observed value is obtained by using the anode nitrogen concentration observer, a purge duration is obtained by using a purge continuation process model, and when the nitrogen concentration observed value reaches a nitrogen concentration threshold, the purge valve is opened and nitrogen is discharged. After the purge duration, the purge valve is closed, and next cycle is entered.
US11652222B2
A fuel cell system includes a fuel cell stack having a hydrogen hole in which hydrogen gas passes, a hydrogen-related auxiliary machine, and a hydrogen pipe that connects the hydrogen hole and the hydrogen-related auxiliary machine. The hydrogen pipe includes a liquid retention part that is located below the hydrogen hole, and a connecting point between the hydrogen pipe and the hydrogen-related auxiliary machine in a gravity direction.
US11652216B2
An electrode catalyst layer for fuel cells capable of effectively preventing reduction of cell voltage in a high current density region. The electrode catalyst layer contains a catalyst-on-support composed of a support made of a conductive inorganic oxide having a catalyst supported thereon and a hydrophilic material. The hydrophilic material is an agglomerate including hydrophilic conductive particles. The content of the hydrophilic material in the catalyst layer is 2 mass % or higher and lower than 20 mass % relative to the sum of the support and the hydrophilic material. The ratio of the particle size d1 of the hydrophilic particles to the particle size D of the catalyst-on-support is 0.5 to 3.0. The ratio of the particle size d2 of the hydrophilic material to the thickness T of the catalyst layer is 0.1 to 1.2.
US11652201B2
A porous reduced silica fiber material has a diameter of about 0.1 to about 20 microns and a surface area of about 5 m2/g to about 400 m2/g. The porous reduced fiber material may be used to form an electrode having a high capacity and improved cycle life over comparable commercial silicon electrodes.
US11652199B2
The present invention relates to an ultrathin foil transferring and processing process for reducing curling and preventing folding of an ultrathin foil which may occur in the ultrathin foil transferring and processing process, and comprises: a step of coating or mounting an electrostatic-inducing material on both ends of a roll to form a charging part; a charging step of rubbing an ultrathin foil and the roll during the transferring and rolling of the ultrathin foil, to charge both ends of the ultrathin foil and the roll with positive or negative charges; and an electrostatic force applying step in which an electrostatic force is applied to both ends of the ultrathin foil simultaneously with or after the charging step and thus the curling of the ultrathin foil is reduced.
US11652198B2
A light-emitting device including a light-emitting module, a first wiring and a second wiring. The light-emitting module includes one or more light-emitting elements and a package covering the one or more light-emitting elements. Each of the one or more light-emitting elements has a first electrode and a second electrode. The light-emitting module has a groove structure on a lower surface side. The first wiring and the second wiring are partially or entirely present in the groove structure. At least part of the first electrode and at least part of the second electrode are exposed to an inside of the groove structure. The first wiring is electrically connected with the first electrode, and the second wiring is electrically connected with the second electrode.
US11652192B2
A light-emitting device includes a substrate comprising a base member, a first wiring, a second wiring, and a via hole; at least one light-emitting element electrically connected to and disposed on the first wiring; and a covering member having light reflectivity and covering a lateral surface of the light-emitting element and a front surface of the substrate. The base member defines a plurality of depressed portions separated from the via hole in a front view and opening on a back surface and a bottom surface of the base member. The substrate includes a third wiring covering at least one of inner walls of the plurality of depressed portions and electrically connected to the second wiring. A depth of each of the plurality of depressed portions defined from the back surface toward the front surface is larger on a bottom surface side than on an upper surface side of the base member.
US11652181B2
A visibly transparent luminescent solar concentrator (LSC) is disclosed. The LSC includes a transparent substrate having at least one edge surface. A dye layer is coupled to the substrate, the dye layer having a peak absorption wavelength outside the visible band, the dye layer being configured to re-emit light at a peak emission wavelength outside the visible band, at least a portion of the re-emitted light being waveguided to the edge surface of the substrate. A photovoltaic device is coupled to the edge surface of the transparent substrate, the photovoltaic device being configured to absorb light at the peak emission wavelength and generate electrical energy.
US11652180B2
Embodiments of the present invention may utilize one or more techniques, alone or in combination, to maximize a surface area of a receiver that is configured to convert light into another form of energy. One technique enhances collection efficiency by controlling a size, shape, and/or position of a cell relative to an expected illumination profile under various conditions. Another technique positions non-active elements (such as electrical contacts and/or interconnects) on surfaces likely to be shaded from incident light by other elements of the receiver. Another technique utilizes embodiments of interconnect structures occupying a small footprint. According to certain embodiments, the receiver may be cooled by exposure to a fluid such as water or air.
US11652169B2
Disclosed is a semiconductor device and a manufacturing method, comprising: forming a pad oxide layer and a silicon nitride layer on a substrate; etching the silicon nitride layer into a plurality of segments; forming an oxide layer, having an up-and-down wave shape, by performing a traditional thermal growth field oxygen method on the semiconductor device by use of the plurality of segments serving as forming-assisted structures; performing traditional processes on the semiconductor device having an up-and-down wavy semiconductor surface, to form a gate oxide layer, a polysilicon layer, and to form a source region and a drain region by implantation The semiconductor device having an up-and-down wavy channel region may be formed by a traditional thermal growth field oxygen method, thus the manufacturing processes are simple, the cost is low, and the completed device may have a larger effective channel width and a lower on-state resistance.
US11652165B2
A method and vertical FET device fabricated in GaN or other suitable material. The device has a selective area implant region comprising an activated impurity configured from a bottom portion of a recessed regions, and substantially free from ion implant damage by using an annealing process. A gate region is configured from the selective area implant region, and each of the recessed regions is characterized by a depth configured to physically separate an n+ type source region and the p-type gate region such that a low reverse leakage gate-source p-n junction is achieved. An extended drain region is configured from a portion of an n− type GaN region underlying the recessed regions. An n+ GaN region is formed by epitaxial growth directly overlying the backside region of the GaN substrate and a backside drain contact region configured from the n+ type GaN region overlying the backside region.
US11652156B2
Embodiments of the present invention are directed to methods and resulting structures for nanosheet devices having asymmetric gate stacks. In a non-limiting embodiment of the invention, a nanosheet stack is formed over a substrate. The nanosheet stack includes alternating semiconductor layers and sacrificial layers. A sacrificial liner is formed over the nanosheet stack and a dielectric gate structure is formed over the nanosheet stack and the sacrificial liner. A first inner spacer is formed on a sidewall of the sacrificial layers. A gate is formed over channel regions of the nanosheet stack. The gate includes a conductive bridge that extends over the substrate in a direction orthogonal to the nanosheet stack. A second inner spacer is formed on a sidewall of the gate. The first inner spacer is formed prior to the gate stack, while the second inner spacer is formed after, and consequently, the gate stack is asymmetrical.
US11652151B2
The present disclosure provides a semiconductor device structure with a conductive contact and a method for preparing the semiconductor device structure. The semiconductor device structure includes a dielectric layer disposed over a semiconductor substrate; a conductive contact penetrating through the dielectric layer; and a metal oxide layer separating the conductive contact from the dielectric layer, wherein the conductive contact and the metal oxide layer comprise a same metal.
US11652146B2
Wafers including a diamond layer and a semiconductor layer having III-Nitride compounds and methods for fabricating the wafers are provided. A nucleation layer, at least one semiconductor layer having III-Nitride compound and a protection layer are formed on a silicon substrate. Then, a silicon carrier wafer is glass bonded to the protection layer. Subsequently the silicon substrate, nucleation layer and a portion of the semiconductor layer are removed. Then, an intermediate layer, a seed layer and a first diamond layer are sequentially deposited on the III-Nitride layer. Next, the silicon carrier wafer and the protection layer are removed. Then, a silicon substrate wafer that includes a protection layer, silicon substrate and a diamond layer is prepared and glass bonded to the first diamond layer.
US11652137B2
A semiconductor device includes transistor cells formed along a first surface at a front side of a semiconductor body and having body regions of a first conductivity type, a drift region of a second conductivity type that is opposite from the first conductivity type and is disposed between the body regions and a second surface of the semiconductor body that is opposite from the first surface, and an emitter layer of the second conductivity type that is disposed between the drift region and a second surface of the semiconductor body, the emitter layer having a higher dopant concentration than the drift region, a metal drain electrode directly adjoining the emitter layer. The metal drain electrode comprises spikes extending into the emitter layer.
US11652136B2
A semiconductor arrangement is provided. The semiconductor arrangement includes a molding layer and a first capacitor. The first capacitor includes a first vertical conductive structure within the molding layer, a second vertical conductive structure within the molding layer, and a first high-k dielectric material between the first vertical conductive structure and the second vertical conductive structure.
US11652128B2
An image sensor includes a photoelectric conversion unit that photoelectrically converts incident light to generate an electric charge; and an AD conversion unit having a comparison unit that compares a signal caused by an electric charge generated by the photoelectric conversion unit with a reference signal, a first storage unit in a first circuit layer, the first storage unit storing a first signal based on a signal output from the comparison unit, and a second storage unit in a second circuit layer that is stacked on the first circuit layer, the second storage unit storing a second signal based on the signal output from the comparison unit.
US11652127B2
A device is disclosed. The device includes a plurality of pixels disposed over a first surface of a semiconductor layer. The device includes a device layer disposed over the first surface. The device includes metallization layers disposed over the device layer. One of the metallization layers, closer to the first surface than any of other ones of the metallization layers, includes at least one conductive structure. The device includes an oxide layer disposed over a second surface of the semiconductor layer, the second surface being opposite to the first surface, the oxide layer also lining a recess that extends through the semiconductor layer. The device includes a spacer layer disposed between inner sidewalls of the recess and the oxide layer. The device includes a pad structure extending through the oxide layer and the device layer to be in physical contact with the at least one conductive structure.
US11652120B2
A light detection device includes: a back-illuminated light receiving element; a circuit element; a connection member; an underfill; and a light shielding mask. The light shielding mask includes a frame having an opening and a light shielding layer formed on an inner surface of the opening. A first opening edge on the side of the circuit element in the opening is located at the outside of an outer edge of the light receiving element. A second opening edge opposite to the circuit element in the opening is located at the inside of the outer edge of the light receiving element. The opening is narrowed from the first opening edge toward the second opening edge. A width of the frame increases from the first opening edge toward the second opening edge. The underfill reaches a gap between the light receiving element and the light shielding layer.
US11652118B2
An image sensing device is disclosed. The image sensor includes a stacked air grid including a plurality of air layers that is physically isolated from each other and then stacked, and a color filter disposed at one side of the stacked air grid.
US11652115B2
The present technology relates to a solid-state imaging device capable of suppressing deterioration in dark characteristics, and an electronic apparatus. The present invention is provided with: a photoelectric conversion section that performs photoelectric conversion; a charge retaining section that temporarily retains electric charge converted by the photoelectric conversion section; and a first trench formed in a semiconductor substrate between the photoelectric conversion section and the charge retaining section, the first trench being higher than the photoelectric conversion section in a depth direction of the semiconductor substrate. Alternatively, the first trench is lower than the photoelectric conversion section and higher than the charge retaining section in the depth direction of the semiconductor substrate. The present technology can be applied to, for example, a back-illuminated CMOS image sensor.
US11652113B2
An image sensor including a semiconductor substrate having a first surface and a second surface; and a pixel isolation film extending from the first surface of the semiconductor substrate into the semiconductor substrate and defining active pixels in the semiconductor substrate, wherein the pixel isolation film includes a buried conductive layer including polysilicon containing a fining element at a first concentration; and an insulating liner between the buried conductive layer and the semiconductor substrate, and wherein the fining element includes oxygen, carbon, or fluorine.
US11652107B2
Embodiments include diode devices and transistor devices. A diode device includes a first fin region over a first conductive region and an insulator region, and a second fin region over a second conductive and insulator regions, where the second fin region is laterally adjacent to the first fin region, and the insulator region is between the first and second conductive regions. The diode device includes a first conductive via on the first conductive region, where the first conductive via is vertically adjacent to the first fin region, and a second conductive via on the second conductive region, where the second conductive via is vertically adjacent to the second fin region. The diode device may include conductive contacts, first portions on the first fin region, second portions on the second fin region, and gate electrodes between the first and second portions and the conductive contacts.
US11652102B2
An integrated circuit structure includes a first well, a second well, a third well, a first set of implants and a second set of implants. The first well includes a first dopant type, a first portion extending in a first direction and having a first width, and a second portion adjacent to the first portion of the first well, extending in the first direction and having a second width. The second well has a second dopant type and is adjacent to the first well. The third well has the second dopant type, and is adjacent to the first well. The first portion of the first well is between the second well and the third well. The first set of implants is in the first portion of the first well, the second well and the third well. The second set of implants is in the second portion of the first well.
US11652085B2
The present disclosure provides a fan-out wafer-level packaging structure and a method for packaging the same. The structure includes: two or more semiconductor chips with a bonding pad, the semiconductor chips are arranged in a fan-out wafer array, and each of the semiconductor chips has an initial position, respectively; a plastic packaging layer, covering surfaces of the semiconductor chips and between the semiconductor chips, each of the semiconductor chips has an offset position, respectively, and the offset position has an offset distance relative to the initial position; a redistribution layer formed on the semiconductor chips, to realize interconnection between the semiconductor chips, the redistribution layer includes at least one first redistribution layer, the first redistribution layer is formed on a surface of the semiconductor chips and is aligned and in contact with the bonding pad of the semiconductor chips; and a metal bump formed on the redistribution layer.
US11652082B2
A micro-transfer printing system comprises a source substrate having a substrate surface and components disposed in an array on, over, or in the substrate surface Each component has a component extent in a plane parallel to the substrate surface. A stamp comprises a stamp body and stamp posts extending away from the stamp body disposed in an array over the stamp body. Each of the stamp posts has (i) a post location corresponding to a component location of one of the components when the stamp is disposed in alignment with the source substrate, and (ii) a post surface extent on a distal end of the stamp post. The post surface extent is greater than the component extent.
US11652073B2
A light source unit for a display device includes: a printed circuit board including a soldering pad located on a substrate of glass and including a copper layer, and a first diffusing barrier pattern located on the soldering pad and including a molybdenum alloy; and a light emitting diode mounted on the soldering pad through a solder resist. In one embodiment, the printed circuit board is a glass printed circuit board.
US11652072B2
To improve reliability of a semiconductor device. There are provided the semiconductor device and a method of manufacturing the same, the semiconductor including a pad electrode that is formed over a semiconductor substrate and includes a first conductive film and a second conductive film formed over the first conductive film, and a plating film that is formed over the second conductive film and used to be coupled to an external connection terminal (TR). The first conductive film and the second conductive film contains mainly aluminum. The crystal surface on the surface of the first conductive film is different from the crystal surface on the surface of the second conductive film.
US11652061B2
Embodiments may relate to a microelectronic package that includes a die and a backside metallization (BSM) layer positioned on the face of the die. The BSM layer may include a feature that indicates that the BSM layer was formed on the face of the die by a masked deposition technique. Other embodiments may be described or claimed.
US11652060B2
A method is disclosed. The method includes a plurality of semiconductor sections and an interconnection structure connecting the plurality of semiconductor sections to provide a functionally monolithic base die. The interconnection structure includes one or more bridge die to connect one or more of the plurality of semiconductor sections to one or more other semiconductor sections or a top layer interconnect structure that connects the plurality of semiconductor sections or both the one or more bridge die and the top layer interconnect structure.
US11652059B2
Techniques and mechanisms for high interconnect density communication with an interposer. In some embodiments, an interposer comprises a substrate and portions disposed thereon, wherein respective inorganic dielectrics of said portions adjoin each other at a material interface, which extends to each of the substrate and a first side of the interposer. A first hardware interface of the interposer spans the material interface at the first side, wherein a first one of said portions comprises first interconnects which couple the first hardware interface to a second hardware interface at the first side. A second one of said portions includes second interconnects which couple one of first hardware interface or the second hardware interface to a third hardware interface at another side of the interposer. In another embodiment, a metallization pitch feature of the first hardware interface is smaller than a corresponding metallization pitch feature of the second hardware interface.
US11652055B2
The present disclosure relates to an integrated chip including a lower conductive wire within a first dielectric layer over a substrate. A second dielectric layer is over the first dielectric layer. A conductive via is over the lower conductive wire and within the second dielectric layer. A conductive liner layer lines sidewalls of the via. A barrier layer lines sidewalls of the conductive liner layer and lines sidewalls of the second dielectric layer. The conductive liner layer is laterally separated from the second dielectric layer by the barrier layer. The conductive liner layer vertically extends between sidewalls of the barrier layer from a bottom surface of the conductive via to a top surface of the lower conductive wire.
US11652054B2
In some embodiments, the present disclosure relates to an integrated chip that includes a first interconnect dielectric layer over a substrate. An interconnect wire extends through the first interconnect dielectric layer, and a dielectric on wire structure is arranged directly over the interconnect wire. Outer sidewalls of the dielectric on wire structure are surrounded by the first interconnect dielectric layer. The integrated chip further includes a second interconnect dielectric layer arranged over the first interconnect dielectric layer, and an interconnect via that extends through the second interconnect dielectric layer and the dielectric on wire structure to contact the interconnect wire.
US11652051B2
The present disclosure provides a contact structure and an electronic device having the same. The contact structure includes: a substrate; a copper layer disposed on the substrate; an adhesion promotion layer disposed on the copper layer, wherein the adhesion promotion layer forms a monomolecular adsorption layer on the surface of the copper layer; and a silver nanowire layer disposed on the adhesion promotion layer, and the adhesive force between the copper layer and the silver nanowire layer is 3B or more. In the present disclosure, by disposing the adhesion promotion layer on the copper layer, in the stacked structure of the copper layer and the silver nanowire layer, the adhesive force between the copper layer and the silver nanowire layer is increased, so as to prevent a peeling phenomenon of the copper layer occurring in the subsequent yellow-light process.
US11652042B2
Embodiments of semiconductor devices and methods for forming the same are disclosed. In an example, a semiconductor device includes at least one dielectric layer pair including a first dielectric layer and a second dielectric layer different from the first dielectric layer, an interlayer dielectric (ILD) layer in contact with the at least one dielectric layer pair, and one or more capacitors each extending vertically through the ILD layer and in contact with the at least one dielectric layer pair.
US11652039B2
A packaging substrate and a semiconductor device comprising a semiconductor element, include a core layer and an upper layer disposed on the core layer, and the core layer includes a glass substrate as a core of the packaging substrate to improve electrical properties such as a signal transmission rate by connecting the semiconductor element and a mother board to be closer to each other so that electrical signals are transmitted through as short a path as possible.
US11652035B2
A mixed pitch method of placing pads in a ball grid array (BGA) package having a BGA substrate and a plurality of connectors arranged in an array and connected via the pads to the BGA substrate. Selected pairs of the pads are placed on the BGA substrate at a distance defined by a first pitch P1. Ground pads are placed on the BGA substrate at a distance from the selected pairs of pads defined by a second pitch P2, wherein P2=M*P1 and M is greater than one. The selected pairs of the pads on the BGA substrate are also placed at a distance from other selected pairs of the pads defined by the second pitch P2.
US11652034B2
A method of attaching an integrated circuit (IC) package to a printed circuit board (PCB) with a set of direct current (DC) blocking capacitors includes: applying a conductive attachment material to a first set of attachment pads located on a first planar surface of the IC package; aligning the set of DC blocking capacitors in accordance with corresponding positions of the first set of attachment pads; attaching the set of DC blocking capacitors to the IC package by: positioning the aligned set of DC blocking capacitors so that a first surface of a first DC blocking capacitor of the set of DC blocking capacitors is adjacent to a corresponding attachment pad of the first set of attachment pads; and connecting the conductive attachment material to the IC package and to the first surface of the first DC blocking capacitor to create an IC package assembly.
US11652033B2
A semiconductor device provided with first and second semiconductor element each having an obverse and a reverse surface with a drain electrode, source electrode and gate electrode provided on the obverse surface. The semiconductor device is also provided with a control element electrically connected to the gate electrodes of the respective semiconductor elements, and with a plurality of leads, which include a first lead carrying the first semiconductor element, a second lead carrying the second semiconductor element, and a third lead carrying the control element. The first and second leads overlap with each other as viewed in a first direction perpendicular to the thickness direction of the semiconductor device, and the third lead overlaps with the first and second leads as viewed in a second direction perpendicular to the thickness direction and the first direction.
US11652024B2
A cooler includes a base on the upper surface of which semiconductor elements are mounted; a housing which is superimposed on the rear surface side of the base and between which and the base a refrigerant flow path is formed; screws which are disposed in the outer peripheral portion of an overlap region between the base and the housing and which fasten and fix the base to the housing; O-rings which seal the outer peripheral portion of the refrigerant flow path; and joining members which are disposed in a joining surface portion of the housing, which is inside the outer peripheral portion of the refrigerant flow path and makes contact with the base, and which bite into the base and housing in an unpenetrated state. The joining strength between the housing and the base is reinforced by the joining members whose joint interfaces are not exposed to the outside.
US11652013B2
A sensor device includes: a first sensor element; a second sensor element; and a processing chip that includes a semiconductor substrate, a first processor that receives a first detection signal and processes the first detection signal, a second processor that receives the second detection signal and processes the second detection signal, and an isolation portion that electrically isolates the first processor the second processor. The first processor includes a first diagnosis unit that self-diagnoses a presence or absence of a failure. The second processor includes a second diagnosis unit that self-diagnoses a presence or absence of a failure. The processing chip identifiably outputs a first output of the first processor and a second output of the second processor.
US11652010B2
Implementations of a method for healing a crack in a semiconductor substrate may include identifying a crack in a semiconductor substrate and heating an area of the semiconductor substrate including the crack until the crack is healed.
US11652008B2
A method includes, receiving a layout design of at least part of an electronic module, the design specifying at least (i) an electronic device coupled to at least a substrate, and (ii) an electrical trace that is connected to the electronic device and has a designed route. A digital input, which represents at least part of an actual electronic module that was manufactured in accordance with the layout design but without at least a portion of the electrical trace, is received. An error in coupling the electronic device to the substrate, relative to the layout design, is estimated based on the digital input. An actual route that corrects the estimated error, is calculated for at least the portion of the electrical trace. At least the portion of the electrical trace is formed on the substrate of the actual electronic module, along the actual route instead of the designed route.
US11652007B2
A method includes illuminating a wafer by an X-ray, detecting a spatial domain pattern produced when illuminating the wafer by the X-ray, identifying at least one peak from the detected spatial domain pattern, and analyzing the at least one peak to obtain a morphology of a transistor structure of the wafer.
US11651992B2
The present disclosure relates to semiconductor structures and, more particularly, to gap fill void and connection structures and methods of manufacture. The structure includes: a gate structure comprising source and drain regions; a gate contact in direct contact and overlapping the gate structure; and source and drain contacts directly connecting to the source and drain regions, respectively.
US11651989B2
A wafer is positioned in an opening of a first frame. The wafer is pressure-bonded at one surface thereof to a first tape together with the first frame, onto a second tape pressure-bonded to a second frame. The wafer is processed by pressure-bonding the second tape, which is pressure-bonded to the second frame having an outer diameter smaller than an inner diameter of the opening of the first frame, to another surface of the wafer, cutting the first tape along an outer periphery of the second frame, imparting an external stimulus to the first tape to lower a pressure-bonding force with which the first tape is pressure-bonded to the one surface of the wafer, and peeling off the first tape from the one surface of the wafer pressure-bonded to the second tape.
US11651979B2
An apparatus for transferring a substrate is provided. A unit for transferring a substrate, includes a support structure, a first hand to place the substrate, a second hand stacked with the first hand and placing the substrate, a first guide rail guiding movement of a first support rod to support the first hand in the support structure, a second guide rail guiding movement of a second support rod in the support structure to support the second hand, and a pressure reducing member reducing pressure of an exhaust fluid passage provided in the support structure. The exhaust fluid passage includes a first fluid passage communicating with the first guide rail, a second fluid passage communicating with the second guide rail, and a third fluid passage formed by combining the first fluid passage with the second fluid passage. The pressure reducing member reduces pressure of the third fluid passage.
US11651973B2
A method and apparatus for bonding a processor wafer with a microchannel wafer/glass manifold to form a bonded wafer structure are provided. A glass fixture is also provided for protecting C4 solder bumps on chips disposed on the processor wafer. When the glass fixture is positioned on the processor wafer, posts extending from the glass fixture contact corresponding regions on the processor wafer devoid of C4 solder bumps, so that the glass fixture protects the C4 solder bumps during wafer bonding. The method involves positioning the processor wafer/glass fixture and the microchannel wafer/glass manifold in a metal fixture having one or more alignment structures adapted to engage corresponding alignment elements formed in the processor wafer, glass fixture and/or glass manifold. The metal fixture secures the wafer components in place and, after melting solder pellets disposed between the processor wafer/glass fixture and microchannel wafer/glass manifold, a bonded wafer structure is formed.
US11651969B2
An etching method according to one embodiment, includes alternately switching a first step and a second step. The first step introduces a first gas containing a fluorine atom without supplying radiofrequency voltage to form a surface layer on a surface of a target cooled at a temperature equal to or lower than a liquefaction temperature of the first gas. The second step introduces a second gas gaseous at the first temperature and different from the first gas, and supplies the radiofrequency voltage, to generate plasma from the second gas to etch the target by sputtering using the plasma.
US11651968B2
A method for forming a planarization layer includes: providing a substrate including a trench; coating a pre-thinner over a surface of the trench; forming a gap-filling material in the trench; coating a post-thinner over the gap-filling material; and performing a spinning process to rotate the substrate.
US11651965B2
Embodiments are described herein that apply capping layers to cores prior to spacer formation in self-aligned multiple patterning (SAMP) processes to achieve vertical spacer profiles. For one embodiment, a plasma process is used to deposit a capping layer on cores, and this capping layer causes resulting core profiles to have protective caps. These protective caps formed with the additional capping layer help to reduce or minimize material loss and corner loss of the core material during spacer deposition and spacer etch processes. This reduction in core material loss improves the resulting spacer profile so that a more vertical profile is achieved. For one embodiment, an angle of 80-90 degrees is achieved for vertical sidewalls of the spacers adjacent core sites with respect to the horizontal surface of the underlying layer, such as a hard mask layer formed on a substrate for a microelectronic workpiece.
US11651953B2
According to one embodiment, a method including supplying a liquid onto a substrate, solidifying the liquid on the substrate to form a solidified body, and melting the solidified body of the liquid on the substrate is provided. When solidifying the liquid, an internal pressure of the liquid on the substrate is varied.
US11651949B2
A spherical ion trap includes a substrate and an ion aperture; two RF electrodes in electrostatic communication with an ion trapping region; RF ground electrodes in electrostatic communication with the ion trapping region; and the ion trapping region bounded by opposing RF electrodes and the RF ground electrodes, such that: the ion trapping region is disposed within the ion aperture and receives ions that are selectively trapped in the ion trapping region in response to receipt of DC and RF voltages by the RF electrodes, and receipt of the DC voltages by RF ground electrodes, and the first RF electrode, the second RF electrode, the RF ground electrodes, and the ion trapping region are disposed in the same plane within the ion aperture.
US11651944B2
A treatment method performed by a film processing apparatus including: a first discharge electrode unit and a second discharge electrode unit respectively including magnets that form a magnetic field; and an AC power source capable of alternately switching polarities of the first discharge electrode unit and the second discharge electrode unit. In the treatment method, a predetermined surface treatment of a film F is performed by generating a plasma P while alternately switching polarities of the first discharge electrode unit and the second discharge electrode unit by using high-frequency power supplied from the AC power source.
US11651934B2
An electron-beam device includes upper-column electron optics and lower-column electron optics. The upper-column electron optics include an aperture array to divide an electron beam into a plurality of electron beamlets. The upper-column electron optics also include a lens array with a plurality of lenses to adjust the focus of the plurality of electron beamlets. Respective lenses of the plurality of lenses are to adjust the focus of respective electron beamlets of the plurality of electron beamlets. The upper-column electron optics further include a first global lens to adjust the focus of the plurality of electron beamlets in a manner opposite to the lens array.
US11651932B1
An ion source capable of extracting a ribbon ion beam with improved vertical angular uniformity is disclosed. The extraction plate and extraction optics are designed such that there is at least one non-uniform gap between adjacent components. A non-uniform gap may be effective in reducing angular spread non-uniformity of the extracted ribbon ion beam. Specifically, for a given gap in the Z direction, ions extracted from regions with lower plasma density may have more vertical angular spread. A larger gap in the Z direction between components in this region may make the vertical angular spread closer to the vertical angular spread of ions extracted from regions with higher plasma density. The non-uniform gap may be created by having an extraction plate that is flat or curved and electrodes that are flat, convex or concave. In certain embodiments, the non-uniform gap is located between the extraction plate and the suppression electrode.
US11651929B2
The purpose of the present invention is to provide a charged particle source that exhibits small energy dispersion for charged particle beams emitted under a high angular current density condition and allows stable acquisition of large charged particle currents even for a small light source diameter. The charged particle source according to the present invention has a spherical virtual cathode surface from which charged particles are emitted, and the virtual cathode surface for charged particles emitted from a first position on a tip end surface of an emitter and the virtual cathode surface for charged particles emitted from a second position on the tip end surface of the emitter match each other (see FIG. 4).
