Abstract:
The present invention is concerned with 2-Aminoquinoline derivatives as 5-HT5A receptor antagonists, their manufacture, pharmaceutical compositions containing them and their use as medicaments. The active compounds of the present invention are useful in the prevention and/or treatment of depression, anxiety disorders, schizophrenia, panic disorders, agoraphobia, social phobia, obsessive compulsive disorders, post-traumatic stress disorders, pain, memory disorders, dementia, disorders of eating behaviors, sexual dysfunction, sleep disorders, abuse of drugs, motor disorders such as Parkinson's disease, psychiatric disorders or gastrointestinal disorders. In particular, the present invention is concerned with compounds of the general Formula (I) wherein R1 and -Z-Ar1 are as described herein.
Abstract:
The present invention relates to compounds of formula wherein R 1 is hydrogen or halogen; R 2 is lower alkyl; R 3 is hydrogen, lower alkyl, -(CH 2 ) n -cycloalkyl, -(CH 2 ) n -phenyl optionally substituted by halogen, or is lower alkyl substituted by halogen, or is -(CH 2 ) n -heterocyclyl, -(CH 2 ) n N-di-lower alkyl, -(CH 2 ) n NHC(O)-lower alkyl, adamantly or -(CH 2 ) n -O-lower alkyl; n is 0, 1, 2 or 3; and pharmaceutically acceptable acid addition salts and tautomers thereof. It has been found that the compounds of formula I have a good activity on the 5-HT 5A receptor. Therefore, the invention provides the use of a compound of formula I or a pharmaceutically acceptable salt thereof for the treatment of diseases, related to this 15 receptor.
Abstract:
The present invention relates to compounds of the general formula (I), wherein R1, R2, X and n are as defined in the specification as dual modulators of the serotonin 5-HT2a and dopamine D3 receptors, their manufacture, pharmaceutical compositions containing them and their use as medicaments. Compounds of general formula (I) have high affinity for the dopamine D3 and serotonin (5-Hydroxytryptamine; 5-HT) 5-HT2A receptors and are effective in the treatment of psychotic disorders, as well as other diseases such as depression and anxiety, drug dependence, dementias and memory impairment.
Abstract:
The present invention is concerned with 6-substituted benzoxazine derivatives of formula (I), wherein X, Y, R1 and R2 are as described herein, as well as their manufacture, pharmaceutical compositions containing them and their use as medicaments. The active compounds of the present invention are 5-HT5A receptor antagonists, useful in the prevention and/or treatment of depression, anxiety disorders, schizophrenia, panic disorders, agoraphobia, social phobia, obsessive compulsive disorders, post-traumatic stress disorders, pain, memory disorders, dementia, disorders of eating behaviors, sexual dysfunction, sleep disorders, abuse of drugs, motor disorders, Parkinson's disease, psychiatric disorders or gastrointestinal disorders.
Abstract:
ácido 4-hidróxi-4-metila-piperidina-1-carboxilico (4-metóxi-7-morfolin-4-il-benzotiazol-2-il)-amida. a presente invenção refere-se ao composto da fórmula i que é ácido 4-hidróxi-4-metila-piperidina-1 -carboxílico (4-metóxi-7-morfolin-4-ii-benzotiazol-2-ii)-amida, e seus sais de adição ácidos farmaceuticamente aceitáveis. foi descoberto que o composto é útil para o tratamento ou prevenção de doença de alzheimer, doença de parkinson, doença de huntington, neuroproteção, esquizofrenia, ansiedade, dor, déficit de respiração, depressão, adhd (distúrbio de déficit de atenção, hiperatividade), dependência a anfetaminas, cocaína, opióides, etanol, nicotina, canabinóides, ou para o tratamento de asma, respostas alérgicas, hipoxia, isquemia, derrame e abuso de substâncias, ou para uso como relaxante muscular, agentes antipsicóticos, antiepilépticos, anticonvulsivos e cardioprotetores.
Abstract:
Foreliggende oppfinnelse angår forbindelsen med formel som er 4-hydroksy-4-metylpiperidin-1 -karboksylsyre(4-metoksy-7-morfolin-4-yl-benzotiazol-2-yl)-amid, samt farmasøytisk akseptable syreaddisjonssalter derav. Det er funnet at forbindelsen er anvendelig for behandling eller forebygging av Alzheimers sykdom, Parkinsons sykdom, Huntingtons sykdom, nevrobeskyttelse, schizofreni, angst, smerte, respirasjonsmangler, depresjon, ADHD (oppmerksomhetssvikt-hyperaktivitetslidelse), medikamentavhengighet overfor amfetaminer, kokain, opioider, etanol, nikotin, kannabinoider eller for behandling av astma, allergiske reaksjoner, hypoksi, ischemi, krampeanfall, stoffmisbruk eller for anvendelse som muskelavslappende midler, antipsykotiske midler, antiepileptiske midler, antikrampemidler og hjertebeskyttende midler.
Abstract:
La presente invención se refiere a compuestos de la fórmula general (I), que tienen afinidad y selectividad para los receptores de dopamina D3, su manufactura, composiciones farmacéuticas que los contienen y su uso como medicamentos. Los compuestos activos de la presente invención son útiles para el tratamiento terapéutico y/o profiláctico de trastornos cognitivos.
Abstract:
Compuestos de la fórmula general (I) **(Ver fórmula)** en la que X es un enlace, -CH2CH2-, -CH=CH-, -CH2O-, -CH2NR-, -CH2S(O)-, -CH2S(O)2-, -O-, -OCH2CH2-, -S-, -SCH2-, -OCH2CH2S(O)-, -OCH2CH2S(O)2-, -CH2NRCO-, -CH2NRCH2-, **(Ver fórmula)** -NRS(O) 2NR-, -NHCHR-, -NR- o -NRS(O)2-; y en la que X puede insertarse en ambas direcciones dentro de la fórmula (I); Y es un enlace, -CHR- o -OCH2CH2-; R es hidrógeno o alquilo inferior; Ar1/Ar2 con independencia entre sí son arilo o heteroarilo de 5 a 10 eslabones, opcionalmente sustituido por alquilo inferior, alcoxi inferior, haloalcoxi inferior, halógeno, -CF3, -CH2OH, -CH2O-alquilo inferior, cicloalquilo de 3 a 10 eslabones, heterocicloalquilo de 5 a 10 eslabones, -CH2O(CH2)2O-alquilo inferior, -S(O)2-alquilo inferior o -S(O)2NHR; en donde "radical arilo" puede comprender uno o mas anillos no-aromático(s) fusionados que puede(n) contener heteroátomos elegidos entre N,O o S, y en donde "alquilo inferior" denota un grupo de cadena que contiene de 1 a 7 átomos de carbono y "haloalcoxi inferior" denota un grupo alcoxi C1-6 que está unido vía un átomo de oxígeno y sustituido por uno o mas halógenos; o sus sales de adición de ácido farmacéuticamente aceptables.