US09889518B2
A consumable electrode gas shield arc welding torch (20) includes a torch body (21), a tip body (22) mounted to a front end of the torch body, a tip holder (23) mounted to a front end of the tip body, a spring (26) provided in the tip body (22) in contact with the front end of the torch body (21), a pressing shaft (27) provided in the tip body (22) in contact with a front end of the spring 26) and a power feed tip (28) pressed by the pressing shaft (27) and the tip holder (23). The tip (28) includes a side surface having a projection contacting with a base end (23a) of the holder (23), with a space (29) defined between an inner surface of the holder (23) and a front end (28a) of the tip (28) when the front end (28a) of the tip (28) is inserted into the holder (23).
US09889514B2
A spark erosion tool includes an electrode arranged on a tool longitudinal axis and an electrode holder aligned along and arranged on the axis and connected to the electrode. The electrode holder includes a moving device for moving the electrode relative to the electrode holder and includes a press for applying pressure transversely to the axis in the area of an imaginary hose extending in the axis. The electrode holder has a cross section corresponding essentially to the electrode. An electrode for a spark erosion tool with a cylinder surface or a spherical surface includes a groove connected to a bore. A deflecting bore can be produced in a drill string part using the spark erosion tool. The deflecting bore is curved and connects two straight flushing bores.
US09889513B2
A method for dressing a honing tool using a dressing tool which during the dressing operation rolls at an axial intersection angle with the honing tool. The teeth thereof which move into engagement with the teeth of the dressing tool each have an upper face which is to be dressed and tooth flanks which are also to be dressed.
US09889498B2
The invention relates to mold material mixtures for producing molds and cores for metal casting, consisting of at least one refractory material, a binder based on resols and amorphous silicon dioxide. The invention also relates to a multicomponent system and methods for producing molds and cores using the mold material mixtures as well as molds and cores for metal casting produced according to this method.
US09889497B2
A molding material mixture for producing casting molds for metal processing, particularly for non-ferrous metals, such as aluminum or magnesium, is intended to reduce problems such as metal-mold reaction and/or shrinkage porosity defect. The free-flowing refractory molding material in the molding material mixture is coated with a mixture of inorganic salts exhibiting a eutectic melting point in the range of about 400 C to about 500 C, particularly in the range of about 420 C to about 460 C. Preferably this coating occurs by contacting the inorganic salt mixture with the molding material mixture at a temperature between 500 C and 700 C, in a manner that maintains the free-flowing nature of the coated product. One mixture of inorganic salts that is used is a mixture consisting of, by weight: 74% potassium fluoroborate; 15% potassium chloride; and 12% potassium fluoride. This mixture has a eutectic melting point of 420 C.
US09889487B2
An apparatus for crimping a radially expandable stent includes a pressure vessel, shaping balloon, and mandrel. The mandrel is configured to slidingly receive a stent thereon, and to be slidingly advanced into the pressure vessel. The shaping balloon is inflated to radially compress the stent onto the form of the mandrel; such compression need not be uniform. Pressurization of the shaping balloon facilitates the expansion of the balloon to achieve compression of the stent, with depressurization of the shaping balloon causing the balloon to return to an unexpanded state.
US09889464B1
A drywall finishing apparatus includes a water reservoir connected to a water distribution element. The water distribution element applies water to a finishing pad. The finishing pad is designed to allow water to flow through and reconstitute already applied drywall mud. The reconstituted drywall mud can then be smoothed out with the finishing pad. The finishing pad creates a hydroplaning effect to glide over the drywall mud.
US09889454B2
A fluid discharge device includes a discharge tube, an outer tube and at least one baffle. The discharge tube has a discharge port. The discharge tube has an end surface adjacent to the discharge port. The outer tube is sleeved outside the discharge tube. The outer tube has at least one passage. The passage is configured to flow a clean dry air. The passage has an outlet. The baffle is disposed outside the outlet. When the clean dry air passes through the outlet, at least part of the clean dry air is blocked by the baffle and is directed to the end surface of the discharge tube.
US09889446B2
The present invention provides microfabricated substrates and methods of conducting reactions within these substrates. The reactions occur in plugs transported in the flow of a carrier-fluid.
US09889434B2
The present invention provides a process and catalyst for the autothermal and dry reforming of methane to produce syngas. The process provides a direct single step gas phase reforming of methane or natural gas to syngas over Ni—Pt supported nanocrystalline ZrO2. The process provides methane conversion of 54-99% with H2/CO ratio of 1.14 to 1.42 (mol %) in the temperature range of 250 to 750 800° C. at atmospheric pressure.
US09889430B2
The process provided herein is concerned with disposal of oxidized sulfur compounds formed by oxidative desulfurization. The process uses solid base catalyst in the presence of a caustic solution or solid base catalyst pretreated with a base and eliminates the need to separate the sulfones from the hydrocarbon streams and recover the hydrocarbons.
US09889425B2
Provided are an adsorbent for trapping a radioactive iodine gas generated in a process of oxidizing a nuclear fuel at a high temperature after use and a method of preparing the same, and more particularly, a radioactive iodine gas adsorbent which is formed of bismuth as a main component, thereby exhibiting an excellent radioactive iodine gas trapping capability and an excellent thermal stability after trapping, and a method of preparing the same.An adsorbent for trapping a radioactive iodine gas prepared by a method of preparing an adsorbent for trapping a radioactive iodine gas according to the present disclosure may effectively trap a radioactive iodine off-gas generated in a nuclear fuel pre-treated oxidizing process after use.Particularly, the adsorbent may trap iodine in a larger amount, which is twice or more, than a silver-containing zeolite widely used to trap a radioactive iodine gas, and the trapped iodine forms a stable compound, which is more advantageous for long-term storage.In addition, since an iodine gas is trapped using inexpensive bismuth, instead of expensive silver, in consideration of trapping a large amount of a radioactive iodine gas, the adsorbent has very excellent economic feasibility.
US09889413B2
The present invention relates to a polyetherimide composite nanofiltration membrane and a preparation method thereof, the method comprises the following steps: (1) dissolving polyetherimide and an additive into an organic solvent, stirring and keeping aside for deaeration to prepare a casting solution, blade coating of the casting solution onto a smooth surface of a nonwoven fabric, and placing under an air atmosphere and then putting into deionized water to obtain a support membrane 1, wherein the surface of the nonwoven fabric coated with the casting solution is referred to as surface A; (2) immersing the surface A of the support membrane 1 into an aqueous solution of m-phenylenediamine, taking out and drying in the air, then immersing the surface A into a solution of 1,2,4,5-benzene tetracarbonyl chloride in n-hexane or cyclohexane, and taking out and drying in the air to obtain a support membrane 2; and (3) immersing the surface A of the support membrane 2 into an aqueous solution of EDC.HCl, then adding NHS into the aqueous solution of EDC.HCl, then adding an aqueous solution of ethylene diamine and keeping aside, and then rinsing with deionized water to obtain a polyetherimide composite nanofiltration membrane. The method of the invention has the advantages of low cost, low energy consumption and low pollution; and also has high rejection towards low-molecular-weight compound, stable performance and a longer lifetime.
US09889409B2
Disclosed herein is a method of preparing a nanoporous organic-inorganic hybrid film. The method includes preparing an organic sol including a compound having amino groups, a compound having isocyanate groups, and a solvent; adding an inorganic oxide precursor to the organic sol to form a mixed solution; and subjecting the mixed solution to heat treatment to form an organic molecule network structure in which the organic sol is gelled, and an inorganic molecule network structure located along a surface of the organic molecule network structure.
US09889402B2
A dehumidifying base material and a device for forming the dehumidifying base material are provided. The dehumidifying base material is formed from a raw base material including a metal layer, an upper adhesive film, a lower adhesive film, an upper absorbent material layer, a lower absorbent material layer, an upper release film, and a lower release film. The raw base material is placed on a material placement part and passes a first release roller, an upper absorbent adhesive part, a second release roller, and a lower absorbent adhesive part sequentially to form the dehumidifying base material. The dehumidifying base material with an absorbent material applied onto two sides thereof is compressed, and is rolled by a base material rolling part.
US09889399B2
A filter cartridge arrangement for use in air cleaners is provided. The filter cartridge arrangement includes a media pack including a plurality of inlet flutes and outlet flutes extending between first and second opposite flow faces and formed from an arrangement of facing sheet secured to corrugated sheet. An example cartridge includes a preform secured to the media pack. In some forms, the preform includes an arrangement extending over one of the flow faces.
US09889382B2
Techniques for “scraping” and/or obtaining fantasy sports data include accessing a fantasy sports server. The access may include accessing publicly available data, accessing data for which a user's username and/or password are required, and/or accessing data by operation of an applications programming interface provided by the server(s) or by a file transfer protocol (FTP) provided by the server(s), etc. Upon gaining access, fantasy sports information may be obtained for a plurality of users. The fantasy sports information may include fantasy team roster information, fantasy team game schedule, etc. The fantasy sports information may be used to create a profile of each of a plurality of fantasy sports users. The database may be used with an interleaver or other service to determine which of a plurality of video clips of athletes should be sent to each of a plurality of users.
US09889381B1
One aspect of the disclosure relates to providing an online game for facilitating assumption of a player identity. The online game comprises a player account associated with the player. By facilitating assumption of a first player identity associated with a first player account, game support personnel and/or an administrator may be substituted for a player in the online game. The assumption of the first player identity may be accomplished through transmission and/or implementation of a private key stored on a client computing platform associated with the first player account, in order to facilitate a different client computing platform (e.g., associated with support personnel) to be authenticated to the first player account. This may allow the support personnel and/or an administrator to directly experience the player problems in the online game.
US09889379B2
An example information processing system includes a display controller configured to display a screen that includes a plurality of subjects and at least one content generated by a user, the at least one content satisfying a predetermined timing condition for each subject in a display, at least one content for a subject being included in a plurality of contents posted with regard to the subject.
US09889377B2
While a first mode is set, a processor causes a memory to store a result obtained by execution of an interactive application as first result data, in association with precedently obtained first result data, as a first result data group. While a second mode is set, the processor causes a result obtained by execution of the interactive application to be stored as second result data, independently of the first result data group and precedently obtained second result data. For any of a user who mainly uses an information processing device and a user who temporarily uses the information processing device, results for each user can be utilized not only primarily but also secondarily.
US09889367B2
A system for refereeing a sports match including a portable processing device for compiling data associated with the sports match and eyeglasses including data display means for displaying the data associated with the sports match to a wearer of the eyeglasses.
US09889366B2
Apparatus and method for sports throwing cage. The apparatus might be a pole with multiple curtain couplings and multiple points of contact, a support, and a bend. The curtain couplings hang a vertical net curtain. The support and the bend adapt the bent pole to provide an offset from the vertical net curtain.
US09889354B2
A system is delineated for protecting golf bag contents. The system may comprise a golf bag; a telescopic member coupled to the golf bag, wherein the telescopic member resides in a stowed state substantially within the golf bag and is selectively moved to a deployed state to facilitate protecting the contents of the golf bag; and a cover coupled to the telescopic member, wherein the cover resides in a stowed state when the telescopic member is in its stowed state and is selectively moved by movement of the telescopic member to a deployed state for the cover to protect the contents of the golf bag. The system may be manufactured integrally with a golf bag or as a separate piece for installation on a golf bag.
US09889331B2
A dumbbell with a selectable number of weight disks includes a handle with pins projectable in opposing directions, a base assembly for accommodating two sets of weight disks standing upright, and having through-going openings. Neighbouring weight disks have mutually cooperating connecting arrangements which axially interconnect the weight disks but which permit radial separation. The projection lengths of the pins are stepwise selectable in order thereby to permit selection of the number of weight disks carried on the handle. The handle has, in opposing ends, connecting arrangements for interconnecting with the connecting arrangements of the innermost weight disks in the base assembly. Further, the space between the connecting arrangements of the handle is free through 360° about the handle throughout its entire length, the openings of the weight disks being centrally located.
US09889328B2
A connecting structure between a jumping mat and a frame in a trampoline, comprises an elastic element connected to the frame, the elastic element having at least one positioning element; and a connecting element connected to the jumping mat, the connecting element having at least one limiting element for engaging one of the plurality of positioning elements and thus connecting the elastic element to the connecting element. A trampoline using the connecting structure is also disclosed.
US09889326B2
Noise and room air overpressure on discharge of a gas extinguisher system is reduced. During the discharge, an extinguishing fluid is conveyed from a pressurized container via a container valve and line system to an extinguishing nozzle. At the beginning of the discharge the extinguishing fluid is predominantly present in the line system in liquid phase and after discharge it assumes a predominantly gaseous phase. In a phase transition period, which is accompanied by a significant reduction in the extinguishing fluid mass flow and a significant increase in the noise and the room air pressure, the mass flow is then reduced or stopped. Due to the reduction of the mass flow, the sound level of the noise arising is advantageously reduced to a value of a maximum of 100 dB and the room air pressure to an overpressure value ranging from 200 to 1000 Pa.
US09889318B2
Edema in tissue of a patient undergoing a course of radiation therapy or treatment can be estimated based on one or more MRI measurements used to measure changes in fluid content of various tissues. A correlation between observed changes in edema and one or more delivered fractions of radiation can be used to drive one or more clinical actions. Methods, systems, articles of manufacture, and the like are described.
US09889311B2
Embodiments of the invention include systems, protective casings for smartphones, and associated methods to enhance use of an automated external defibrillator (AED) device before arrival of emergency medical personnel. A system can include a smartphone and a protective casing abuttingly contacting one or more side portions of the smartphone and retaining the smartphone positioned therein. The smartphone can include a defibrillation control module to control defibrillation of a victim of sudden cardiac arrest. The protective casing can include sensors, capacitors, and extendable electrode pads. The protective casing further can include a check module to determine whether the victim's heart rhythm requires an electrical shock to reestablish a normal heart rhythm, a space module to measure presence and amount of preselected materials relatively near the system, and a shock module to activate the one or more capacitors and generate an electrical current to deliver an electrical shock to the victim's chest.
US09889309B2
Method and apparatus for detecting electric energy delivered to the heart of a body when performing defibrillation. The method comprises the steps of applying a defibrillator with electrodes placed on opposite sides of the heart; applying an apparatus on the body and between said electrodes for detecting and measuring electric and/or magnetic fields; performing defibrillation by delivering electric energy to the body; detecting electric energy running through the heart with said apparatus, and indicating electric energy applied to the heart. The apparatus for performing the method comprises detection and indications means for performing the method.
US09889305B1
Systems and methods for patient activated capture of transient data by an implantable medical device
Systems and methods are provided for managing patient activated capture of transient data by an implantable medical device (IMD). The systems and methods collect transient data using the IMD. The collected transient data is stored in a temporary memory section of the IMD. The IMD receives a patient activated storage request including activation information related to a patient designated trigger point from an external device. The IMD transfers a segment of the transient data from the temporary memory section to a long-term memory, wherein the segment of transferred transient data is based on the trigger point. The activation information includes an elapsed time corresponding to a duration of time between entry of the trigger point and issuance of the patient activated storage request by an external activation device.
US09889291B2
Devices and methods for blocking signal transmission through neural tissue. One step of a method includes placing a therapy delivery device into electrical communication with the neural tissue. The therapy delivery device includes an electrode contact having a high charge capacity material. A multi-phase direct current (DC) can be applied to the neural tissue without damaging the neural tissue. The multi-phase DC includes a cathodic DC phase and anodic DC phase that collectively produce a neural block and reduce the charge delivered by the therapy delivery device. The DC delivery can be combined with high frequency alternating current (HFAC) block to produce a system that provides effective, safe, long term block without inducing an onset response.
US09889286B2
A medical device that may include an elongate member having a proximal end and a distal end, and a lumen disposed through the elongate member is disclosed. The medical device may also include an opening disposed at the distal end of the elongate member in communication with the lumen, and a pushing element disposed with the lumen. The medical device may also include at least one fiducial disposed within the lumen and distal to the pushing element, and a separating mechanism disposed at the distal end of the elongate member. The separating mechanism may be configured to apply a separating force to deploy the at least one fiducial.
US09889268B2
The invention relates to an on-site medical gas production plant (100) comprising a unit (50) for purifying gas, such as air, a first compartment (A) for storing purified gas, and a main gas line (10) fluidically connecting the gas purification unit (50) to the said first storage compartment (A). It furthermore comprises a three-way actuated valve (VA) arranged on the main gas line (10) upstream of the first storage compartment (A), and furthermore connected to the atmosphere (at 12) via a vent line (11), as well as an operating device (4) which controls at least the three-way actuated valve (VA), and at least a first gas analysis device (D1) of which a first measurement line (29) is fluidically connected (at 28) to the main line (10), upstream of the three-way actuated valve (VA), and which is electrically connected to the said operating device (4).
US09889267B2
A patient interface for delivery of a supply of pressurized air or breathable gas to an entrance of a patient's airways comprising: a cushion member that includes a retaining structure and a seal-forming structure permanently connected to the retaining structure; a frame member attachable to the retaining structure; and a positioning and stabilizing structure attachable to the frame member.
US09889257B2
Systems and methods are provided for updating medical devices. An exemplary system includes a medical device and a remote device. The medical device is operable to regulate a condition of a user. The remote device receives measurement data correlative to the condition of the user, determines control information for the medical device based at least in part on the measurement data, and transmits the control information via a first peer-to-peer communication session. The medical device receives the control information via a second peer-to-peer communication session and thereafter regulates the condition of the user based at least in part on the control information and subsequent measurement data.
US09889256B2
A status of a battery operated infuser may be detected by measuring a controlled input parameter. The measurement may be used to determine a magnitude of the input parameter and a parameter of the control. For example, control of power input to a motor may be by pulse density modulation. An integral of current over time may serve as a measure of current magnitude and pulse density. The result of the integral may be used to determine the status of the injector. The status may include normal functions for example start of pumping and/or malfunctions such as occlusion or drive disengagement.
US09889250B2
This document discusses, among other things, an apparatus comprising a pump configured to deliver a fluid from a cartridge, a display a temperature sensor and a controller. The controller is configured to compare a temperature within the cartridge as measured by the temperature sensor to a threshold temperature and cause the display to display a message relating to temperature when the measured temperature goes beyond the threshold temperature.
US09889244B2
The present specification discloses a portable dialysis system comprising a mechanism that allows the user to accurately position an air bubble in a venous line, so that it can be safely removed. When an air bubble is detected, the system automatically runs the blood pump in a direction such that the air bubble is placed close to the extraction point on the venous line, from where it can safely be removed using a needleless syringe.
US09889243B2
A hemodialysis system comprising: a source of priming fluid; an extracorporeal circuit including an arterial line, a venous line, and a drip chamber; a level sensor operable with the drip chamber; a reversible blood pump operable with the extracorporeal circuit; a connection between the arterial and the venous line; and a priming sequence in which priming fluid from the source is pumped in a reverse pump direction through the extracorporeal circuit and reversibly in a normal pump direction through the extracorporeal circuit, wherein an output from the level sensor is used to determine when to stop pumping in at least one of the directions.
US09889240B2
An apparatus and method for managing reduced pressure at a tissue site are disclosed. The apparatus comprises a pump for supplying reduced pressure to the tissue site, a motor coupled to the pump to propel the pump, and a drive system electrically coupled to the motor that includes a power source that provides a source of direct current power to the motor during an operational period at a substantially constant current and of sufficient magnitude to supply a targeted reduced pressure during the operational period. The drive system also includes a controller that monitors the pump's loading on the motor by measuring the voltage across the motor to determine whether the motor voltage remains within a predetermined operational range of voltages necessary for maintaining the reduced pressure supplied by the pump proximate to the targeted reduced pressure without directly measuring the reduced pressure using a pressure sensor.
US09889234B2
A scaffold for hard tissue regeneration comprising an active ingredient for treating osteoporosis and a preparation method thereof. The scaffold for hard tissue regeneration is prepared by the steps of mixing a polyphenol-based natural substance containing Quercetein or Genistein involved in the activation of osteoblasts and osteoclasts and the biofunctional analog thereof with a ceramic scaffold material and molding the mixture at room temperature into a three-dimensional scaffold. The biofunctional material included in the scaffold above may be sustain-released slowly over the long period of time so that the osteoblast activity is directly improved and at the same time the osteoclast activity is suppressed in the course of bone regeneration, to have the effect of improving bone regeneration.
US09889231B2
A method of producing metallic medical supplies includes supplying a metallic material as a base material; treating the base material by carrying out any one of electrochemical treatment, chemical treatment, thermal and/or mechanical treatment or a combination of two or more of these treatments to form a film having micro pores and/or micro unevennesses having a density of 5′ 104/mm2 on a surface of the base material; and carrying out iodine-impregnation treatment to impregnate the film with iodine or iodine compounds.
US09889221B1
Photocatalysis is a promising technique for remediation of indoor air pollution. The present invention focuses on the enhancement of the effectiveness of the photocatalytic process by the introduction of artificial roughness on the interior reactor surface. Artificial roughness elements on the catalytic surface enhance the turbulence intensity close to the catalytic surface. The enhanced turbulence intensity translates to an increase in the mass transfer of airborne contaminants to the catalyst surface, improving the efficiency of photocatalysis.
US09889220B1
An air freshener enhancer includes a base having a support for holding a fragrance composition, first inlet openings for receiving ambient air, first outlet openings positioned adjacent the fragrance composition, and main airflow channels for supplying air from the first inlet openings to the first outlet openings; a fan for blowing the air from the first inlet openings, through the main airflow channels and out through the first outlet openings; and the base further includes second inlet openings in a side wall for receiving ambient air, second outlet openings positioned above the fragrance support, and auxiliary airflow channels positioned between the main airflow channels and extending between the second inlet openings and second outlet openings such that air forced through the main airflow channels results in suction of air through the auxiliary airflow channels and out the second outlet openings into contact with the fragrance composition.
US09889219B2
Provided is a decontamination apparatus that includes a motorized base with a transport system that is operable to autonomously move the decontamination apparatus. A plurality of UVC bulbs, each of which emits UVC light, are supported at a vertical elevation above the motorized base. A controller controls operation of the transport system to move the decontamination apparatus along a desired route while the UVC bulbs are energized during a decontamination process.
US09889213B2
Fibrin-specific imaging agents that contain at least two imaging reporters are described, as well as methods of making and using the contrast agents.
US09889211B2
The invention relates generally to activatable antibodies that include a masking moiety (MM), a cleavable moiety (CM), and an antibody (AB) that specifically binds to epidermal growth factor receptor (EGFR), and to methods of making and using these anti-EGFR activatable antibodies in a variety of therapeutic, diagnostic and prophylactic indications.
US09889209B2
The present disclosure is directed to nanoconjugates that cross the blood-brain barrier and methods of their therapeutic use.
US09889204B2
The disclosure provides, inter alia, polymeric antibiotic compounds such as modified chitosans and methods of use thereof.
US09889202B2
A novel delivery system for drugs, and especially macromolecules such as proteins or oligonucleotides through biological membranes is provided, and specifically delivery of siRNA The delivery system comprises conjugation of the macromolecule drug to a moiety that enables effective passage through the membranes. Respectively, novel compounds and pharmaceutical compositions are provided, utilizing said delivery system. In one aspect of the invention, the compounds may be utilized in medical practice, for example, in delivery of siRNA or antisense oligonucleotides across biological membranes for the treatment of medical disorders.
US09889197B2
Diabody molecules and uses thereof in the treatment of a variety of diseases and disorders, including immunological disorders, infectious disease, intoxication and cancers are disclosed. The diabody molecules comprise two polypeptide chains that associate to form at least two epitope binding sites, which may recognize the same or different epitopes on the same or differing antigens. Additionally, the antigens may be from the same or different molecules. The individual polypeptide chains of the diabody molecule may be covalently bound through non-peptide bond covalent bonds, such as disulfide bonding of cysteine residues located within each polypeptide chain. The diabody molecules may further comprise an Fc region, which allows antibody-like functionality to be engineered into the molecule.
US09889194B2
Described herein are immunogenic compositions for preventing infection with Middle East respiratory syndrome coronavirus (MERS-CoV) wherein the immunogenic compositions comprise at least a portion of the MERS-CoV S protein and an immunopotentiator.
US09889193B2
The invention relates to a genetically modified infectious measles virus derived from a live-attenuated measles virus strain, in which the gene encoding the viral accessory C protein has been knocked out (MV-deltaC). It concerns in particular the use of said genetically modified infectious MV-deltaC in the treatment of malignant tumor or cancer conditions, and for the preparation of agents or compositions for such treatment.
US09889191B2
Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3 DLIFLARSALILRGSVAHKSC SEQ ID 4 PGIADIEDLTLLARSMVVVRP SEQ ID 5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ ID 6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.
US09889188B1
The present invention is directed to a composition and/or plasmid and/or vector vaccine which encodes four fragments of the GP1 Ebola protein attached to the extracellular domain of the potent immunostimulatory protein CD40 ligand, in the configuration of two compositions and/or vaccines that are mixed together, to respectively increase the levels of antibodies and CD8 effector T cells, against the lethal Ebola virus.
US09889183B2
The present disclosure provides a method for treating stroke by administering to a subject an anticoagulant, e.g., recombinant tissue plasminogen activator (rTPA), and a protein kinase C (PKC) activator followed by administration of at least one PKC activator for a duration of treatment. The methods disclosed herein may limit the size of infarction and/or reduce mortality, the disruption of the blood-brain barrier, and/or the hemorrhagic damage due to ischemic stroke compared with rTPA administration alone; and may also extend the therapeutic time window for administering rTPA after a stroke. Also disclosed are kits comprising rTPA and a PKC activator for treating stroke.
US09889182B2
Reagents and methods useful for the synthesis of conjugates comprising guanidinylated cyclic acetals are provided. Also provided are methods for increasing the cellular uptake of various therapeutic compounds and treatment modalities using these conjugates.
US09889173B2
The present invention provides a composition for improving macular pigment optical density and preventing or treating age-related macular optical degeneration. The composition comprises lutein, zeaxanthin and tea extracts, wherein the weight ratio of zeaxanthin to lutein is more than or equal to 1. The composition may prevent formation of choroidal neovascularization to achieve effects on comprehensively preventing or treating age-related macular optical degeneration (AMD).
US09889171B2
A composition for the topical application on a mammalian skin comprises one or more Brassica plant extracts selected from the group consisting of: Brassica juncea extract, Brassica oleracea italica extract, Brassica oleracea capitata extract, Brassica oleracea botrytis extract, and Brassica oleracea acephala extract. The composition further comprises one or more selected from the group consisting of: Curcuma longa extract, curcuminoids, tetrahydrocurcuminoids, metabolites of curcuminoids or tetrahydrocurcuminoids, and derivatives of curcuminoids or tetrahydrocurcuminoids. The composition further comprises one or more selected from the group consisting of: Camellia oleifera extract, Camellia sinensis extract, green tea extract and white tea extract; Wasabia japonica extract; Bacopa monnieri extract; Silybum marianum extract; and one or both of Piper nigrum extract or tetrahydropiperine.
US09889160B2
Disclosed herein is a genetically-modified cell comprising in its genome a modified human T cell receptor alpha constant region gene, wherein the cell has reduced cell-surface expression of the endogenous T cell receptor. The present disclosure further relates to methods for producing such a genetically-modified cell, and to methods of using such a cell for treating a disease in a subject.
US09889159B2
The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules.
US09889156B2
A method for treating noise-induced hearing loss (NIHL) includes the step administering a composition to the mammal, wherein the composition consists essentially of a biologically effective amount of vitamin A, vitamin E, vitamin C, a vasodilator comprising magnesium, and, optionally, a withanolide, and/or resveratrol.
US09889155B2
An object of the present invention is to provide an agent that potentiates the antitumor effect of an anticancer agent by allowing efficient accumulation of the anticancer agent in tumor tissue. The administration of carbonate apatite with the anticancer agent allows efficient accumulation of the anticancer agent in the tumor tissue to dramatically potentiate the antitumor effect of the anticancer agent.
US09889148B2
A phosphodiesterase type III (PDE III) inhibitor or Ca2+-sensitizing agent or a pharmaceutically acceptable derivative thereof is provided for the preparation of a medication for the reduction of the heart size of a patient suffering from heart failure.
US09889146B2
Norvaline and/or other amino acids that are capable of being acylated onto tRNALeu by LeuRS, in combination with substituted benzoxaboroles, such as a compound having a structure according to formula III: and methods for decreasing the frequency of resistance and/or reducing the rate of resistance and/or suppressing the emergence of resistance that develops in bacteria exposed to a substituted benzoxaborole or salt thereof by administering a combination of a substituted benzoxaborole such as a compound of formula III or salt thereof and an amino acid or a salt thereof.
US09889144B2
Pharmaceutical compositions, including unit dosage forms, comprising abiraterone acetate and methods for producing and using such compositions are described.
US09889140B2
Azaindazole compounds for treating various diseases and pathologies are disclosed. More particularly, the present invention concerns the use of an azaindazole compound or analogs thereof, in the treatment of disorders characterized by the activation of Wnt pathway signaling (e.g., cancer, abnormal cellular proliferation, angiogenesis, fibrotic disorders, bone or cartilage diseases, and osteoarthritis), the modulation of cellular events mediated by Wnt pathway signaling, as well as genetic diseases and neurological conditions/disorders/diseases due to mutations or dysregulation of the Wnt pathway and/or of one or more of Wnt signaling components. Also provided are methods for treating Wnt-related disease states.
US09889134B2
Polymorphs of N4-(4-([1,2,4]triazolo[1,5-a]pyridin-7-yloxy)-3-methylphenyl)-N6-(4,4-dimethyl-4,5-dihydrooxazol-2-yl)quinazoline-4,6-diamine are provided herein. Processes for preparing the polymorphs and pharmaceutical composition comprising the polymorphs are also disclosed.
US09889128B2
Disclosed is the synthesis procedure for benzazolo[3,2-a]quinolinium chloride salts and the inclusion of chloro-substituent, amino-substituent, and nitro-substituent resulting in several compounds. The compounds are further used as markers due to their fluorescent properties including in hypoxic environments.This disclosure further describes anti-cancer screening of two BQS, namely, 7-benzyl-3-aminobenzimidazo[3,2-a]quinolinium chloride (ABQ-48: NSC D-763307) and the corresponding 7-benzyl-3-nitrobenzimidazo[3,2-a]quinolinium chloride (NBQ 48: NSC D-763303).
US09889127B2
The present invention includes a method of reducing or inhibiting the kinase activity of C-KIT mutant tyrosine kinase activity in a cell or a subject, and the use of such compound for treating mutant C-KIT driven cell proliferative disorder(s) in a subject related to using a compound of the present invention: or pharmaceutically acceptable salt thereof.
US09889125B2
The present invention relates to methods of treating heartburn in a patient receiving clopidogrel therapy. In another aspect, the present invention relates to methods of preventing gastric bleeding or hemorrhage in patients receiving clopidogrel therapy.
US09889117B2
A method for treating and/or delaying the degeneration of Purkinje cells in a subject is provided. The method comprises administering to a subject in need thereof a therapeutically effective amount of a medicament, wherein the medicament comprises a phthalide selected from the group consisting of n-butylidenephthalide (BP), a metabolic precursor of BP, a pharmaceutically acceptable salt of a metabolic precursor of BP, a pharmaceutically acceptable ester of a metabolic precursor of BP, and combinations thereof.
US09889114B2
Since a compound represented by the general formula (I) (wherein definition of each group is as described in the specification), a salt thereof, a solvate thereof, or a prodrug thereof has strong and sustaining intraocular pressure lowering activity and, further, has no side effect on eyes such as ocular stimulating property (hyperemia, corneal clouding etc.), aqueous humor protein rise etc., it has high safety, and can be an excellent agent for preventing and/or treating glaucoma etc.
US09889109B2
The present invention relates to intranasally administered pharmaceutical compositions for the treatment of headaches, such as migraines. Such pharmaceutical compositions comprise benzyl alcohol or a combination of benzyl alcohol and tetracaine. The invention also relates to methods for treating headaches, such as migraines, using these pharmaceutical compositions.
US09889098B2
The subject invention relates to novel micoparticulate and soluble forms of flavonoids, and their synthesis. The invention also includes novel formulations of such flavonoids. Further, the invention includes novel methods of manufacturing the flavonoid formulations. The invention also relates to a wide variety of applications of the flavonoid formulations.
US09889090B2
A method for treating a periodontal disease affecting a periodontal pocket of a patient. The method comprises inserting an oral delivery device into the periodontal pocket at a frequency of about once every 4 days to about once every 6 weeks. The oral delivery device is a controlled release solid unit dosage form suitable for insertion into a periodontal pocket of a patient, comprising a therapeutically effective amount of at least one anti-inflammatory agent, at least one antibacterial agent, or the combination of at least one anti-inflammatory agent and at least one antibacterial agent.
US09889085B1
The present invention is directed to treatments for a disease or condition, in a subject in need thereof, that provide alternatives to treatment by injection that give, relative to treatment by injection, improved treatment outcomes, 100% treatment compliance, reduced side effects, and rapid establishment and/or termination of substantial steady-state drug delivery. The method includes providing continuous delivery of a drug from an implanted osmotic delivery device, wherein substantial steady-state delivery of the drug at therapeutic concentrations is achieved within about 7 days after implantation of the osmotic delivery device in the subject and the substantial steady-state delivery of the drug from the osmotic delivery device is continuous over a period of at least about 3 months. In one embodiment, the present invention is directed to treatment of type 2 diabetes mellitus using insulinotrophic peptides. In embodiments, a subject has a baseline HbA1c % of greater than 6.5% or 10.0%.
US09889073B2
The instant invention relates to a color changing composition in the form of an emulsion comprising, at least: a) microcapsules containing releasable colorant(s), said microcapsules comprising: —a core comprising one organic material, —at least one layered coating surrounding said core, the layered coating comprising at least one polymer, at least one colorant, and advantageously at least one lipid-based material, b) at least partially neutralized, crosslinked acrylic homopolymers or copolymers preferably in a non-particulate form.
US09889071B2
The present invention discloses a new family of calcium sulfate resin-modified hybrid (CSRH) materials and methods of making and using the same.
US09889069B1
Interactive medicine management systems and methods comprising integrated elements using a network processor to provide assistance to individuals in order to organize and monitor patient compliance in the administration of one or more medications are provided.
US09889068B1
The invention is a novel pillbox for storing medicines that overcomes the deficiencies in existing commercial products. Unlike existing products, in which medicine is loaded into the pillbox by opening a top lid, the present invention is a pillbox that allows side-loading and unloading, thereby eliminating the lids. Because the lids tend to break after extensive use, the elimination of the lids extends the lifetime of the pillbox. Another objective of the invention is to offer the user medicine compartments with sizes that can be easily modified, unlike existing products that only offer medicine compartments with fixed sizes.
US09889066B2
Exemplary embodiments of massaging devices are disclosed herein. One exemplary embodiment includes a piston having a longitudinal axis, a massaging head connected to the piston, a motor located on a first side of the longitudinal axis and a handle located on a second side of the longitudinal axis. A drive mechanism for moving the piston and massage head is also included.
US09889065B2
A skin cleanser includes a surface, such as a silicone surface, with at least one textured portion for transmitting vibrational tapping to the skin. The skin cleanser includes at least one oscillating motor for generating the tapping motion to the skin. The textured portion includes touch-points or a wave that transmit the tapping motion to skin in contact with the textured portions. The touch-points may include thicker and thinner formations of the touch-points to provide firmer or softer vibrations to the skin. The touch-points are within about 0.5 to 2.5 mm in diameter. One configuration includes multiple oscillating motors configured to provide different vibration frequencies at around 50-300 Hertz and operable simultaneously.
US09889064B1
Disclosed is a sexual stimulation device that includes a phallus shaped member having a handle opposite a stimulation end. The handle includes a control button for operating the device. The control button is connected to a power source that can activate an oscillating motor, which is attached to a motor head having a motor head attachment and a silicone embedded connector. The motor head oscillates, thereby moving the motor head attachment and the silicone embedded connector therewith. The silicone embedded connector is aligned with a stimulation point at the stimulation end of the device such that when the device is activated, the stimulation point can oscillate. In use, the stimulation end can be inserted into a vagina to contact the g-spot or near the wall of the vagina to stimulate a user.
US09889061B1
A crutch and method of carrying packages using such crutch are disclosed. The crutch comprises a plurality of metal poles connected together and covered by an insulating material. An outwardly extending finger element along an upper edge on a top of the crutch is configured to detachably mount a package having a hanging loop by draping the hanging loop on the finger element. The crutch includes side poles and a center pole sandwiched between the side poles. A pocket for receiving a package or other item is between the side poles and an enclosure holding a stretchable netting is mounted to the crutch and is configured to enable a user to withdraw the netting from the enclosure and wrap the netting around the package. The user detachably connects a free end of the netting to a portion of crutch to secure the package to the crutch.
US09889056B2
A medical apparatus for extending the neck of a patient without manually lifting the patient. This apparatus has a gel pad assembly encapsulating an inflatable bag connected to two hoses for inflation and deflation purposes. The inflatable bag is positioned beneath the shoulders, thereby lifting the shoulders and hence extending the neck when the inflatable bag is inflated.
US09889052B2
An absorbent article has a lower absorbing core and an upper absorbing core. Each absorbing core includes a liquid-holding material and a liquid-permeable core-wrapping sheet. The liquid-holding material is covered by the liquid-permeable core-wrapping sheet, but it also has an exposed portion not covered by the liquid-permeable core-wrapping sheet. The exposed portions of the lower absorbing core and the upper absorbing core face each other and the liquid-holding materials are connected with each other at the exposed portion. Because the liquid-holding material of the upper absorbing core is in direct contact with the liquid-holding material of the lower absorbing core, the area provides a path through which liquid flows smoothly from the upper absorbing core to the lower absorbing core. Also, because the upper and lower liquid-holding materials are covered by the core-wrapping sheets, deformation of the liquid-holding materials is prevented.
US09889050B2
An absorbent article that has an absorber which is disposed in the crotch region and an absorber backsheet which is positioned at the outer direction side of the absorber. At least either one of a front end of the absorber and a rear end of the absorber is disposed in the crotch region. In the front end of the absorber backsheet and the rear end of the absorber backsheet, an end at a side at which the absorber is positioned in the crotch region is disposed outboard of the crotch region in the longitudinal direction.
US09889045B2
User-friendly welding helmet assembly configurations to be worn on the head of a weldor are disclosed. The welding helmet assembly configurations include various advanced features including a spatter shield that is easily replaceable from an external front portion of a shell of the helmet assembly configuration, and an adjustable ratchet headgear within the shell having a repositionable lever adapted to easily adjust a detent position of the ratchet headgear with respect to the shell. Other user-friendly features are also provided, in accordance with various embodiments of the present invention.
US09889032B2
A digestive tract device that can reduce an indwelling-induced burden on the living body includes: a tubular portion that includes a through hole; a holding portion that is provided on a proximal end side of the tubular portion, and holds the tubular portion in the living body; and support portions and which are provided in the holding portion, and are in contact with a plurality of sites of the digestive organ of the living body, and support the holding portion in such a way that the holding portion can move in at least one direction of a circumferential direction and a longitudinal direction of the tubular portion.
US09889031B1
A method of bariatric embolization includes deploying an intravascular pressure modulating device at a target location, operating the pressure modulating device to reduce pressure within the fundus, and infusing an embolizing agent into the fundus. Use of the pressure modulating device prevents delivery of the embolizing agent into proximal and distal non-target vessels. The method takes advantage of unique flow and pressure dynamics of the arterial vessels in the stomach.
US09889029B2
An implant delivery system is disclosed which includes an inner tube assembly, an outer tube assembly and a functional handle. The functional handle includes a threaded rod, a push-pull control member, a casing tube, a displacement tube, an inner tube fixing member, an outer tube fixing member and a stability tube fixing member. The threaded rod extends through a bore of the displacement tube. A fastener of the push-pull control member is able to engage a thread provided on a leading portion of the threaded rod. A trailing portion of the threaded rod is provided with a knob. The push-pull control member includes a fastener, springs and a button. The fastener is able to extend through a slot to engage a thread of the threaded rod in the displacement tube. The springs are configured to cause an automatic locking of the fastener and the threaded rod. The button is provided on the fastener. A cylindrical shell drives the displacement tube to move forward or backward along its longitudinal axis to cause the outer tube assembly to accordingly advance or retract. The delivery system can quickly, stably and accurately insert an implant into a target location.
US09889028B2
An implant release mechanism for releasing, for example, a stent (60) is provided with three restraining wires (62) which pass in the space between a wire guide catheter (24) and a pusher sheath or dilator (30) and are arranged substantially equi-angularly threrearound. Each restraining wire (62) holds both the proximal and distal ends of the stent (60), in this case each holding a proportion of the ends of the stent (60). When the restraining wires (62) are pulled they will first unwrap from the proximal end of the stent (60) and will then release the distal end of the stent (60) so as to allow the stent to become fully deployed within the lumen of the patient. The use of common release wires improves deployment of implants and reduces the number and volume of components in the device, thereby allowing it to occupy a smaller volume.
US09889027B2
A stent delivery system is provided with an inner elongate shaft having a proximal portion and a distal portion and an outer elongate shaft having a lumen extending at least partially therethrough, wherein the proximal portion of the inner elongate shaft is at least partially movably disposed within the lumen. The system also includes a stent positionable about the inner elongate shaft having collapsed and expanded configurations. The system includes a proximal restraining member removably engaged with the outer elongate shaft and attached the stent, and a distal restraining member removably engaged with the inner elongate shaft and attached to the stent. The system also has a proximal biasing member operatively engaged with a distal portion of the outer elongate shaft, a distal biasing member operatively engaged with the distal portion of the inner elongate shaft, and an outer tube with a lumen movably disposed over the inner elongate shaft.
US09889026B2
An endo-urethral prosthesis characterized in that it comprises a set of guides (100) defining an internal space (201) in a urinary channel, and one or more support elements (110) for supporting the internal wall of the urinary tract, the guides comprising recessed areas and protruding areas, said protruding areas forming locking regions (21) for holding the support elements in place, in a position that allows them to support the internal wall of the urinary tract.
US09889019B2
An expandable housing for an interbody fusion system has movable tapered external helical threaded members that travel along tracking to operably engage against the top and bottom shell members, urging them apart to cause expansion in the height of the housing. In an embodiment, the tapered members are disposed in a dual arrangement such that independent engagement of the tapered members along lateral portions of the top and bottom shells cause an angular tilt to the exterior surface of the housing when the tapered members are moved to different degrees. This function permits adjustment in the angular relationship between adjacent vertebrae and assists the lordotic adjustment of the patient's spine. When the functions of the device are used in combination by the surgeon, the device provides an effective tool for in situ adjustment when performing lateral lumbar interbody fusion.
US09889017B2
The present invention relates to an intervertebral disc prosthesis preferably comprising at least three pieces including an upper plate (1), a lower plate (2) and a mobile core (3) at least in relation to the lower plate (2), co-operation means (23, 33) allowing to limit or eliminate the movements of the core (3) in relation to the lower plate (2), in translation and in rotation, respectively, about an axis substantially parallel to the lower plate (2) and about an axis substantially perpendicular to the lower plate (2), at least one part of the surface of at least one plate being concave and complementary with a convex surface (30) of the core (3), with which it is in contact, wherein the tip (31) of the convex surface (30) of the core (3) is off center, in at least one direction, in relation to the center (32) of this convex surface (30).
US09889015B2
Coiled spinal implants for disc, vertebral body, and spinal motion segment replacement or reconstruction comprise a plurality of loops and spaces between the loops, with the loops formed of a hollow material and having a plurality of apertures or a longitudinal gap that extend(s) through the sidewalls of the loops and into the hollow center. The coiled implants include one or more balloons within the hollow center, the spaces between the coil loops, and/or within the central void that the coil surrounds. Filling the balloon expands the loops and thereby increases the height of the coil. Bone graft material or bone cement may be deployed from the apertures or gap.
US09889001B2
A multifocal intraocular lens has an anterior lens surface which includes a first optic of a first radius and a second optic of a different radius. The posterior surface of the lens include an aspheric surface.
US09889000B2
Devices and methods for handling and depositing corneal implants onto corneal tissue. Devices and methods for packaging and storing corneal implants.
US09888999B2
A method for preparing a sterilized human acellular dermal allograft where the dermal allograft is sterilized by irradiation and has a greatly reduced bio-burden and enzymatic and antigenic activity. This product line of allografts can be easily used by surgeons in soft tissue replacement or repair and has an extended shelf life, of up to at least about three years.
US09888996B2
The disclosure describes implantable medical products, that include dry or partially hydrated biocompatible constructs comprising collagen fibers configured to expand in situ after implantation to frictionally engage a bone tunnel wall to thereby affix the construct in the bone tunnel.
US09888991B2
The present disclosure is directed to methods, compositions, devices and kits which pertain to the attachment of surgical meshes to tissue by application of an energy source to the meshes and tissue in the presence of a bonding material.
US09888990B2
The invention relates to methods of increasing genetic merit of swine by establishing a plurality of mating subtypes for a line of swine, and determining a percentage of progeny that are male for each of the mating subtypes, or a percentage of progeny that are female for each of the mating subtypes, that would result, relative to a control, in an increase in genetic merit in the line; the invention further relates to sorting a sperm cell sample from a male swine in one of the mating subtypes into one or more subpopulations of sperm cells, wherein a majority of sperm cells in a subpopulation of sperm cells bear X chromosomes or Y chromosomes, and inseminating one or more female swine in the one of the mating subtypes with the subpopulation of sperm cells to achieve the percentage of progeny that are male, or the percentage of progeny that are female, determined to increase genetic merit relative to the control.
US09888989B2
Due to the low suction strength or an unsuitable positional relationship or distance between the suction feed and the oral cavity, conventional extra-oral intake devices exhibit the problem of not being able to fully suck particulate matter and droplets from teeth, shavings from repair products, saliva, bacteria, blood, rinse water, tooth surface cleaning agents, etc., that are dispersed to outside the oral cavity during practice. In order to improve suction strength, the present invention provides an intake device that is equipped with a protruding airflow-regulating member, the top of which is oriented in the direction in which the fluid flows into the opening part of the suction feed, and that can efficiently suck dispersed particulate matter and droplets within a wide range.
US09888986B2
Articulator—semiadjustable, arcon with lower and upper parts that could be detached from one another or interconnected, with two mechanical joints. An upper horizontal shoulder (5) is fixed to an elevator (4), said elevator (4) is connected to an upper vertical body (11) and can move vertically to adjust the vertical position. A lower vertical body (10) is fixed to the base (1) and holds an axis with two joint heads (14). The upper vertical body (11) is pivotably connected to the lower vertical body (10) through the two joint heads (14), the distance between the joint heads can vary due to an elastic element (18), thus reproducing the lateral shift. The articulation between the vertical bodies (11 and 10) can be locked and unlocked via an elbow shaped piece (13). The articulator lower part has an incisive platform (8) with a position angle that could be adapted.
US09888980B2
A nozzle head (12) for a powder jet device (10) for use in applying dental material, the nozzle head (12) comprising: a first portion (16) and a second portion (18) transitioning into one another; the first portion (16) adjacent a first end (20) of the nozzle head (12) having a coupling (22) for removably connecting the nozzle head (12) to a hand piece (14) of the powder jet device (10); the second portion (18) adjacent a second end (26) of the nozzle head (12) forming a nozzle outlet (28) for the dental material; the second portion (18) comprising at least a first fluid channel (30) which is formed between the nozzle outlet (28) and a channel inlet (32); wherein the channel inlet (32) is arranged at the transition (34) between the first portion (16) and the second portion (18) between the nozzle outlet (28) and the coupling (22).
US09888974B2
Devices, systems, and methods for compensate for friction within powered automatic systems, particularly for telesurgery and other telepresence applications. Dynamic friction compensation may comprise applying a continuous load in the direction of movement of a joint, and static friction compensation may comprise applying alternating loads in positive and negative joint actuation directions whenever the joint velocity reading falls within a low velocity range.
US09888973B2
The present disclosure relates to a control system for user-guided robotic control of a medical device and includes an electronic control unit, a computer-readable memory coupled to the ECU, and a visualization system configured to provide a view of an anatomical model. The memory contains user interface logic configured to be executed by the ECU, and configured to obtain input from a touch screen display with respect to the view of an anatomical model. Control logic stored in the memory is also configured to be executed by said ECU and is configured to produce an actuation control signal responsive to the input to control actuation of a manipulator assembly so as to move the medical device.
US09888964B2
A method and an apparatus according to an embodiment of the invention includes a reflector and an optical fiber end portion disposed within a capillary for use in side-firing optical fibers. The reflector surface can be coated with a multilayer dielectric coating to increase the amount of side-fired laser energy. An outer member or cap can be used to protect the capillary when being inserted through a catheter or endoscope. The endoscope is then at least partially inserted into a patient's body to provide laser-based medical treatment. Multiple grooves can be defined on an outer surface of the optical fiber buffer layer to increase the surface area and improve the mechanical strength of the coupling between the optical fiber and the capillary. In some embodiments, the outer member or cap can also be coupled to the grooved surface portion of the optical fiber buffer layer.
US09888960B2
Bipolar electrosurgical devices may include a handle assembly configured to control movement of components of the electrosurgical device to perform an electrosurgical procedure and a power cord assembly configured to electrically connect the bipolar electrosurgical device with a power source. For bipolar sphincterotomes, an active portion of the handle assembly may include a first active member that contacts and slides across a second active member as the gripping portion moves about a handle stem component of the handle assembly. The power cord assembly may include a pair of return contacts that are shorted together when connected with the handle assembly, which in turn may deactivate an alarm output by the power source.
US09888945B2
An exemplary system for correcting a spinal deformity includes a plurality of transverse rods, a longitudinal rod, and at least one node. The plurality of transverse rods each includes a first end for coupling with an extension member of a spinal fixation system and a second end. The longitudinal rod extends transverse to the transverse rods. The at least one node receives the second ends of first and second transverse rods and the longitudinal rod within a receiving portion and an adjustment member selectively secures the second ends.
US09888943B2
An external fixation clamp for receiving a fixation element includes an inner jaw and an outer jaw movable between an open position that permits the fixation element to be placed between the inner and outer jaws and a closed position that restricts removal of the fixation element from between the inner and outer jaws. A latch assembly may cooperate with the inner and outer jaws to secure the jaws in a closed position. The latch assembly may comprise a latch and a latch biasing member. The latch may be configured to translate linearly relative to one of the inner and outer jaws, and the latch biasing member may have a first higher level of stored energy when the inner and outer jaws are in the open position and a second lower level of stored energy when the inner and outer jaws are in the closed position.
US09888936B2
The present disclosure relates to a method of use during arthroscopic surgery. The method includes inserting a cannulated needle into a joint area of the body, inserting a guidewire through the needle, removing the needle, and inserting an arthroscopy knife into the joint area via the use of the guidewire. An arthroscopy knife and another method of its use is also disclosed.
US09888933B1
A surgical procedure for performing liposculpture on the human body comprising defining a surgical site where the liposculpture is to be performed including substantially 360 about at least the torso portion of the body and/or the limbs. The surgical site is infiltrated with a predetermined quantity of solution and subsequently performing multi-layer emulsification of fat deposits about the surgical site utilizing technology comprising “vibration amplification of sound energy at resonance” or (VASER), wherein the multi-layer emulsification includes at least a superficial layer emulsification of fat deposits and a deep layer emulsification of fat deposits. Subsequently, a multi-layer liposuction extraction of the emulsified fat deposits is performed, wherein the multi-layer liposuction extraction comprises a deep layer liposuction; a superficial layer liposuction and an intermediate layer liposuction.
US09888931B2
A guide tool for guiding surgical instrumentation and facilitating insertion of surgical implants for repair of cartilage and/or bone damage and/or for remodeling of a joint surface for improved mobility in a finger or toe joint is disclosed. The guide tool includes an attachment part including a patient specific contact surface adapted to fit the proximal phalanxes or metatarsal bones in a toe or the distal-, middle-, or proximal phalanxes or metacarpal bones in a finger and further including a directing flange. A design model designing a guide tool described above and the use of the instruments are also disclosed.
US09888925B2
Devices and methods for clamping tissue and/or moving two tissue structures together by moving two plates or arm together. The pressure or force applied to the tissue may be used to bring the tissue together, to seal an opening or to cut through and remove a portion of the tissue. In one procedure disclosed, a clip applier may be used to apply one or more clips to the left atrial appendage of the heart to prevent clots from the left atrial appendage from embolizing and causing harm to the patient, such as a stroke.
US09888924B2
Articles are provided having no orientation or a multi-directional orientation. Such articles may be in the form of films, ribbons, sheets, and/or tapes and may be utilized as buttresses with a surgical stapling apparatus or as reinforcing means for suture lines. The articles may be produced with etchings on at least a part of a surface of the article.
US09888919B2
A method and system for operating a surgical instrument. A surgical instrument can operate in an initial operating state and a secondary operating state. The secondary operating state can be one of a warned operating state or a modified operating state. After receiving feedback from the surgical instrument, an operator of the surgical instrument can decide whether to proceed to the warned operating state or the modified operating state.
US09888914B2
A surgical instrument includes a body, at least one user input feature, an elongate shaft, a needle applier, and a motor. The needle applier includes a needle and a drive assembly coupled to the needle. The drive assembly is configured to drive the needle along an orbital path about a rotation axis that is transverse to the longitudinal axis of the shaft, in response to an actuation of the user input feature. The motor is configured provide motion to the needle applier to thereby actuate the drive assembly.
US09888910B2
An eyelid speculum for retracting a pair of eyelids, comprises: a first arm having a first blade portion contoured to generally conform to an eyeball globe and one of the pair of eyelids; a second arm having a second blade portion contoured to generally conform to the eyeball globe an the other of the pair of eyelids; and a mechanism carrying the first arm and the second arm. The mechanism is operable to hold the first arm and the second arm parallel to and in proximity to each other so that the first blade portion and the second blade portion may be inserted between said eyelids to engage said eyelids. The mechanism is further operable to move the first arm and the second arm apart from each other while maintaining the first arm and the second arm in parallel such that the first blade portion and the second blade portion retract said pair of eyelids. The mechanism advantageously moves away from the surgical field of the eye when retracting the eyelids.
US09888908B2
This invention relates to a device (10) for taking at least one sample of soft tissue from an organ, said device comprising a body (11) and a needle (12) formed by a stylet (13) and a cannula (14) coaxial with said stylet, said device comprising a mechanism for arming the needle, designed for sequentially moving the cannula (14) and then the stylet (13) from a rest position wherein the stylet and the cannula are extended towards the outside of the body, to a shooting position wherein the stylet and the cannula are retracted towards the rear of the body, and a triggering mechanism designed to release the stylet then the cannula and to allow their displacement from the shooting position to the rest position, the cannula being coupled kinematically to a cannula slider (24) comprising at least one retaining element (26) for maintaining the cannula slider in a shooting position, the stylet being coupled kinematically to a stylet slider (30) comprising at least one retaining element (32) for maintaining the stylet slider in a shooting position and means for unlocking (34) the cannula slider. The device is characterized in that at least one element among said retaining element of the cannula slider (26) and said retaining element of the stylet slider (32) comprises at least one hook (50, 50′) arranged to cooperate with a retaining device (27, 33) of said hook. The device for taking a sample further includes unlocking means (34, 41) of said arranged hook to release said retaining element from the corresponding retaining device. The sampling device further includes at least one locking element (52, 52′, 52″, 52′″) arranged to prevent said hook to be released from said corresponding retaining device when said locking element is in a locking position and in order to allow said hook to be released from said corresponding retaining device when said locking element is in a position allowing the shot.
US09888907B2
Disclosed are an ultrasound diagnostic apparatus and an ultrasound image producing method capable of producing a spatial compound image with reduced artifacts. Reception data of frame images is repeatedly acquired in a data acquisition cycle of four frames such that, of three frame images for use in producing a spatial compound image, the angle difference in steering angle between two frames for which the acquisition of reception data is most temporally separated is smaller than a maximum value among the angle differences in steering angle between two frame images among three frame images having different steering angles, and each time reception data of two frame images or reception data of another two frame images is acquired, three frame images sequentially produced based on reception data for three frames sequentially acquired hitherto are synthesized to produce a spatial compound image.
US09888906B2
An ultrasound diagnostic apparatus having image processing circuitry including: an ultrasound image generator generating first ultrasound images from reflected ultrasound; a video image acquirer acquiring, from an imaging device, first video images capturing manipulation of a probe performed during generation of the first ultrasound images; a relational recorder recording, onto a recording medium, the first ultrasound images and the first video images, in association with each other; a data reader reading second ultrasound images and second video images from the recording medium, the second ultrasound images generated and recorded onto the recording medium in the past, and the second video images capturing manipulation of the probe performed during generation of the second ultrasound images; and a screen composer composing a screen by arranging the first ultrasound images, the second ultrasound images and the second video images, and displaying the screen on a display device.
US09888904B2
The present disclosure relates to a housing and a connector for a door using the same. The housing forming a skeleton of a connector for a door coupled with a counter connector which is mounted in a panel includes: a terminal seating space configured to be formed by penetrating through the housing back and forth and an electric wire seating space configured to communicate with the terminal seating space to be opened to a rear of the housing, and an electric wire guide cover configured to prevent the electric wire seating space from protruding backward so as to prevent a load from being applied to a grommet in which an electric wire is coupled with the housing.
US09888901B2
An X-ray diagnostic apparatus according to an embodiment includes an X-ray tube, a detector, an acquisition circuitry, and imaging control circuitry. The acquisition circuitry creates photon count data indicating the number of photons of the X-rays incident on the detector, for each of a plurality of energy bins for identifying a plurality of target substances, based on the detection signal output by the detector. The imaging control circuitry determines an imaging plan including at least one of a setting condition that is a condition concerning setting of a plurality of energy bins used when the acquisition circuitry creates photon count data in main imaging, and an X-ray radiation condition that is a condition concerning X-rays emitted by the X-ray tube in main imaging, based on the photon count data created by the acquisition circuitry or image data of the subject.
US09888891B2
The application relates to an X-ray imaging unit for a medical imaging. The unit comprising a rotating part comprising a first X-ray source and an X-ray imaging detector unit configured to provide an image by means of at least a rotational movement (R) around a rotation axis of the rotating part, and an upper shelf for supporting the rotating part. The upper shelf is configured to enable the rotating part to move with respect to the upper shelf by means of a linear movement (L) and to be attached to a column with a pivoting joint for enabling a pivot movement (P) of the upper shelf around the column. The rotating part is configured to be positioned by the linear movement and the pivot movement during the imaging.
US09888887B2
An X-ray diagnostic apparatus according to the present embodiment includes: an X-ray tube which generates X-rays to be irradiated at an object; an X-ray diaphragm which houses an X-ray shielding member forming an irradiation aperture, through which the X-rays pass, along a side surface of the X-ray tube; an X-ray detector which detects X-rays passing through the object; and an image data generation circuitry which generates image data based on the X-rays detected by the X-ray detector.
US09888885B2
A mobile terminal includes a terminal body that is wearable on a part of a user's body. A wireless communication unit of the mobile terminal connects to an e-Call system of a vehicle and receives information related to a state of the vehicle. A detecting unit of the mobile terminal detects a biometric signal of the user that is sensed by at least one sensor provided in the terminal body. A controller is configured to, based on an accident event of the vehicle being detected from the received information related to the state of the vehicle, analyze the detected biometric signal to obtain state information of the user. Based on a predetermined condition being satisfied, the controller cooperates with the e-Call system of the vehicle and transmits the obtained state information of the user and the information related to a state of the vehicle to a call center.
US09888880B1
A method and system for estimating fractional fat content of an object of interest. An energy emitter is used to direct an energy signal toward the region of interest, wherein the region of interest has an object of interest, a reference, and a boundary area with one or more boundary locations between the object of interest and the reference. Next, a plurality of thermoacoustic or ultrasonic transducers is used to receive a plurality of thermoacoustic bipolar signals from the one or more boundary locations, wherein the thermoacoustic bipolar signals are induced by the energy signal. A machine configured to accept data from the energy emitter and the plurality of thermoacoustic or ultrasonic transducers and calculate a fat concentration that is a function of the thermoacoustic bipolar signal at each respective boundary location and the distance or distances between locations.
US09888873B2
A NIRS sensor assembly includes a light source, a light detector, a first insulating layer, an EMI shielding layer, and a second insulating layer. The first insulating layer covers an exposed portion of the light detector. An optically transparent portion of the first insulating layer is aligned with an active area of the light detector. The EMI shielding layer covers the first insulating layer. An optically transparent portion of the EMI shielding layer is aligned with the active area of the light detector. The second insulating layer covers the EMI shielding layer and the first insulating layer. An optically transparent portion of the second insulating layer is aligned with the active area of the at least one light detector.
US09888868B2
A sensor system and method configured to take multiple channels of sensors, and based on context and user behavior reflected in the signals, identifies specified channels for sensing according to a sensing policy. The sensing policy is used to reduce the amount of data sampled, such that it is possible to reconstruct the values of the non sampled sensors efficiently. The sensing policy is influenced by user and system's behavior and can be assigned either offline or in real time.
US09888864B2
A system and method for identifying a stimulation location on a nerve is disclosed. The system includes an image-based navigation interface used to facilitate advancing a stimulation element within a patient body toward a target nerve stimulation site. Using the system one determines, separately for each potential target nerve stimulation site, a neuromuscular response of muscles produced upon applying a stimulation signal at the respective separate potential target stimulation sites. The image-based navigation interface is configured to display a graphic identification of which muscles were activated for each respective potential target nerve stimulation site upon applying the stimulation signal.
US09888862B2
This invention relates to the determination and/or representation of physiological information relating to a heart surface.
US09888860B2
A map of cardiac activation wavefronts can be created from a plurality of mesh nodes, each of which is assigned a conduction velocity vector. Directed edges are defined to interconnect the mesh nodes, and weights are assigned to the directed edges, thereby creating a weighted directed conduction velocity graph. A user can select one or more points within the weighted directed conduction velocity graph (which do not necessarily correspond to nodes), and one or more cardiac activation wavefronts passing through these points can be identified using the weighted directed conduction velocity graph. The cardiac activation wavefronts can then be displayed on a graphical representation of the cardiac geometry.
US09888858B2
Devices and systems provide methods for detecting cardiac signals from head or facial biopotential sensors. In one embodiment, a facial biopotential signal is measured by a set of sensors. A processor derives a cardiac signal from the facial biopotential signal. Optionally, heart rate is detected from the cardiac signal. Heart rate variability may be determined and evaluated by the processor to generate warnings or messages from the evaluation. One or more head or facial biopotential electrodes for measuring the facial biopotential signal may be integrated in or at a contact surface of head support structures such as a headgear support or respiratory treatment mask. In some such embodiments a controller of a respiratory treatment apparatus may serve as a cardiac signal detector by processing the facial biopotential signal from the sensors and may make control adjustments or generate warnings based on an evaluation of detected signals.
US09888853B2
The provided are a method and system for monitoring one or more physiological characteristic based on WBAN. The method includes: an node of a micro-network for monitoring the human body acquires physiological characteristic information of the human body; and a hub of the micro-network for monitoring the human body recognizes at least one identifier for identifying a physiological status of the human body according to the acquired physiological characteristic information of the human body, and selects, according to the at least one identifier for identifying the physiological status of the human body, whether to send the physiological characteristic information of the human body to a medical monitoring system terminal via a wireless network or not. According to the method, sign information of the monitored human body may be mastered in first time to provide a strong basis for subsequent treatment.
US09888851B2
In one implementation, an apparatus estimates body core temperature from an infrared measurement of an external source point using a cubic relationship between the body core temperature and the measurement of an external source point is described, estimates temperature from a digital infrared sensor and determines vital signs from a solid-state image transducer, or determines vital signs from a solid-state image transducer and estimates body core temperature from an infrared measurement of an external source point using a cubic relationship between the body core temperature and the measurement of an external source point; after which the estimated and/or determined information is transmitted to an external database.
US09888848B2
A measurement system may comprise a sensor wire and a transceiver unit. The sensor wire may comprise an insertable portion configured to be inserted in a blood vessel of a patient's body and two sensors disposed within the insertable portion at a distal end of the sensor wire. The sensors are configured to measure a parameter when inserted inside the patient. The transceiver unit may comprise: a housing adapted to be connected to a proximal end of the sensor wire; and a first communication module within the housing adapted to wirelessly communicate by a communication signal with an external second communication module in order to transfer information to the external second communication module.
US09888846B2
An ophthalmological apparatus includes an optical system, a display device, a subject's eye position acquisition processor, and a control processor that acquires information on positional displacement of the optical system for inspection with respect to the subject's eye on the basis of the three-dimensional position to allow an alignment index image for performing alignment of the optical system for inspection with respect to the subject's eye in accordance with the information on positional displacement to be displayed in a screen of the display device in a pseudo manner, where the control processor has a plurality of display modes, in each of which the alignment index image is displayed in a different display form to allow the alignment index image to be displayed in the screen of the display device in a display mode selected from the plurality of display modes in a pseudo manner.
US09888845B2
A system and method are provided for optical detection of cognitive impairment of a person using a portable video capture device (PVCD). In one embodiment, the method includes: (i) capturing video of an eye exposed to light stimuli over a predetermined time using a video camera of the PVCD; (ii) processing the video to locate at least one feature of the eye; (iii) measuring a change in the feature in response to the light stimuli; (iv) analyzing data from the measured change in the feature by extracting data from the measured change in the feature, calculating a number of parameters from the extracted data, correlating the calculated parameters with predetermined reference parameters and predicting a degree of impairment based on the results of the correlation; and (v) outputting through a user interface in the PVCD the degree of impairment to a user. Other embodiments are also described.
US09888843B2
An apparatus for tracking eye gaze includes a capacitive sensor array having a plurality of capacitive sensors. The capacitive sensor array is configured to detect eye movement based at least on a proximity of the plurality of capacitive sensors to a part of an eye of a user (e.g., a bulge in the cornea). A frame of the apparatus is configured to be worn on a head of the user and configured to support the capacitive sensor array positioned in front of the eye. A control circuit of the apparatus is configured to receive signals from the capacitive sensor array. A body electrode of the apparatus is positioned on the frame and electrically connected to the control circuit, the body electrode configured to establish an electrical connection with a body of the user. A conductive line of the apparatus connects the body electrode to the control circuit.
US09888842B2
A method to track a user's gaze for medical diagnostics is described. The method includes detecting a gaze behavior of a user in response to a stimulus. The stimulus is a non-diagnostic stimulus. The method also includes determining a type of the stimulus and generating an indication of the gaze behavior and the type of the stimulus. The indication may then be used to generate an expected gaze pattern describing expected gaze behavior to given stimuli. Additionally, the indication may be used to determine whether the gaze behavior is indicative of a potential problem and, in response, an alert may be generated. Apparatus and computer readable media are also described.
US09888835B2
An endoscope is provided with a main part, an endoscope shaft and an imaging lens system. An imaging lens system includes a correction module, which comprises a splitter unit and a superimposition unit. Light is routed to the correction module via a first beam path, which is split into a first and a second partial beam path by the splitter unit. The splitter unit guides light from the visible spectrum into one of the two partial beam paths and light from the near infrared range into the other partial beam path. The superimposition unit superimposes the light from the two partial beam paths and guides it into a second beam path, coaxial with the first beam path. The optical path lengths of the two partial beam paths for the light from the visible spectrum and the light from the near infrared range are selected such that they are different.
US09888831B2
The imaging device includes an image sensor that includes a plurality of pixels that generate an image signal from an object image that is formed by an imaging optical system, a scaling section that performs a scaling process on an original image that includes image signals that correspond to the plurality of pixels, and an output section that outputs an image after the scaling process as a scaled image, the scaling section performing the scaling process using a different scaling factor corresponding to the position of a pixel of interest within the scaled image, and the image sensor including pixels in a number larger than the number of pixels of the scaled image as the plurality of pixels.
US09888829B1
The forced air drying dishwasher provides an intake and air channel that ensure a smooth and more than adequate air entry, coupled with a narrowed venturi area to accelerate an air flow into a blower. With the air flow heated by a heating element, a distribution manifold coupled to a pair of nozzle manifolds with a plurality of spaced apart, evenly distributing nozzles are all joined via a plurality of laminar bends to ensure the air flow that is further aided. A gradual bend of an exhaust provides proper exit of the air flow. With such a plurality of air flow enhancements, a drying of dishes is comparatively more hastened and complete.
US09888827B2
A dishwasher appliance with a tub that defines a wash chamber is provided. A bottom wall of the tub defines a volute. An impeller is positioned within the volute of the bottom wall, and a motor mounted to the tub at the bottom wall of the tub. The motor is coupled to the impeller such that the motor selectively rotates the impeller within the volute of the bottom wall. A related method for forming a unitary tub for a dishwasher appliance is also provided.
US09888821B2
A mist generating system for a cleaning implement is adapted to generate a finely atomized liquid mist for suppressing dust, allergens, and other airborne particulates. The mist generating system can be adapted to fit many cleaning implements such as vacuum cleaners, wet extraction cleaners, floor mops, and dusters to suppress airborne dust and particulates generated during operation and the cleaning process.
US09888820B2
A method of cleaning a raised access flooring system includes providing a vacuum cleaner for raised floor environments. The vacuum cleaner includes a body sized to fit underneath the raised access floor system, a power source supported by the body, a vacuum module supported by the body, the vacuum module being configured to intake air and exhaust air, and a drive module supported by the body. The method further includes placing the vacuum cleaner into a space formed between an original floor and a plurality of raised panels of the raised access flooring system, and operating the vacuum cleaner to perform a cleaning operation.
US09888819B2
A robot cleaner includes a body forming an external appearance of the robot cleaner, a body moving part provided to the body to move the body, a body driving unit to drive the body moving part, a dust collector to capture suctioned foreign substances and provided with a first chamber and a second chamber communicating with the first chamber, a suction generation unit to supply suction force to the dust collector, and a guide member to guide the foreign substances captured in the first chamber to the second chamber and to apply pressure to the foreign substances in the second chamber in order to compress the foreign substances.
US09888817B2
A multimode surface cleaning apparatus comprises a surface cleaning head, an upright section moveably mounted to the surface cleaning head between a plurality of reclined floor cleaning positions and an upright storage position, a hand vacuum cleaner removably mounted to the upright section and an auxiliary dirt collection assembly removably mounted to the upright section wherein the auxiliary dirt collection assembly comprises a dirt collection region and optionally a pre-motor filter, one or more cyclones and a suction motor.
US09888812B2
Disclosed herein is a cooking device which may be used for the mixing and stirring of sauces, soups, gravies, and other foodstuffs while being heated on a heat source such as a stovetop, gas burner, hot plate, barbeque grill, charcoal, open flame, etc. The term “sauce” will be used herein to indicate all such foodstuffs to be cooked in order to abbreviate this disclosure. The cooking device allows a user (cook) to stir and mix the sauce while heating the sauce and optionally while a lid assembly is in place thus, more efficiently retaining heat, steam, and flavors within the cooking device during cooking and stirring.
US09888806B2
A device 120 for preparing infused beverages including: a capsule 102, with the front face 103 in a substantially vertical position; an injector 124 for introducing an infusing liquid into the capsule 102 through the frangible region 116 when the capsule 102 is in the receptacle 118; and an infusion vessel 123 with a substantially vertical side opening 125 to the receptacle 118, so as to be in fluid connection with the filter wall 114 of the capsule 102 when the capsule 102 is in the receptacle 118, and an openable and closable bottom opening 127 to allow an infused beverage to flow out of the infusion vessel 123.
US09888805B2
The brewing assembly (1) comprises a support structure (2) which is operationally stationary and in which the following are mounted: a movable part (4) including a cup-shaped body (5) in which there is defined a receptacle (6) suitable for receiving a capsule (C) or the like containing a substance for the preparation of a beverage; a cooperating locating part (9) provided with a member (10) for performing perforation and/or injecting water and/or steam; and a displacement mechanism (11) for causing displacement of the movable part (4) between an open position, remote from the locating part (9), in which the cup-shaped body (5) is in a position suitable for receiving a capsule (C) or the like, and a closed position, in which the cup-shaped body (5) is able to be coupled with the locating part (9) so as to define therewith a brewing chamber in which the capsule (C) is sealingly clamped, for preparation of the beverage. When passing from the closed position to the open position the movable part (4) performs an initial movement away from the locating part (9) and a subsequent movement during which it substantially pivots about an at least approximately horizontal transverse axis.A disengagement member (30) protruding axially beyond the cup-shaped body (5) towards the locating part (9) is fixed to the movable part (4) and is configured and arranged such that during the subsequent pivoting movement of the movable part (4) its path is able to interfere with a used capsule (C) which may be still attached to the locating part (9) so as to cause it to be detached therefrom.
US09888793B2
The present invention is directed towards a travel pillow for sleeping in a vertical or near-vertical reclined position. When sleeping in these positions, gravity tends to pull the head forward of the shoulders causing it to droop. The current state of the art travel pillow does not provide a support means to counter this forward drooping tendency. Moreover, its rear support displaces the cervical spine forward, further increasing the tendency for the head to slump forward. The present invention holds a resting head in an upright and stable position to prevent forward head drooping and does so without forwardly displaying the cervical spine. The five novel elements of the present invention are integrally configured to maintain a healthy alignment between the occipital bone of the head, the cervical spine of the neck, and the thoracic spine of the upper back.
US09888789B2
A refrigerating cabinet (1) comprises at least one goods presentation and air circulation space (2), a refrigeration cycle for cooling the at least one goods presentation and air circulation space (2), and at least one drain conduit (36; 42) configured for draining condensed water, which is produced when the refrigeration circuit is operating, from the at least one goods presentation and air circulation space (2). At least a portion of the at least one drain conduit (36; 42) is filled with a granulate material (34) or provided with a movable flap (48) allowing water to pass through the drain conduit (36; 42) and blocking air from passing through the drain conduit (36; 42).
US09888781B2
An extendible sofa has a base assembly, a slide out assembly and a seat assembly. The base assembly has a base assembly frame that forms a seat, and the base assembly frame has a guide. The slide-out assembly is slidably connected to the base assembly by way of the guide. The guide facilitates movement of the slide-out assembly between a compact position and an extended position in which the slide-out assembly extends out away from the base assembly to provide additional seating. The slide-out assembly has a seat guide. The seat assembly has a seat frame slidably connected to the seat guide, and the seat guide facilitates movement of the seat assembly between a stowed position in which the seat assembly is housed within the slide-out assembly and a seat position.
US09888776B2
A seating/reclining furniture comprising a seat part, a backrest part, and a cantilever support structure. A foot support device is provided which comprises a support frame and a first and a second foot support portion, and the first foot support portion is pivotally mounted on the support frame and can be adjusted between a storage position and a working position. The second foot support portion can be adjusted linearly relative to the first foot support portion between a retracted position and an extended position. The foot support device comprises a working device which causes the first foot support portion to be pivoted relative to the support frame by means of a first fitting and the second foot support portion to be moved relative to the first foot support portion by means of a second fitting independently of a change of the relative position of the backrest and the seat part.
US09888774B2
An exemplary embodiment includes a cabinet having at least one drawer with selectable access for storing items, such as medications. A slidable cover with a first opening allows for closure and/or access to items in an interior of the drawer. The cabinet further includes an actuator coupled to the cover and a controller coupled to the actuator to control movement of the first opening relative to the drawer interior in response to signals generated from a user interface.
US09888772B2
A storage rack system includes a horizontal support surface. A rack is hingedly coupled to the horizontal support surface. The rack is selectively positioned in a stored position having the rack being coextensive with the horizontal support surface. The rack is positioned in a deployed position having the rack extending downwardly from the horizontal support surface. Thus, the rack is accessible. Thee rack stores a plurality of fishing rods. A pulley unit is coupled between the horizontal support surface and the rack. Thus, the pulley unit may be manipulated. The pulley unit selectively urges the rack between the stored position and the deployed position.
US09888771B2
Storage panels for safes, such as gun safes. Some embodiments may comprise an interior storage panel configured so as to be positioned at least partially outside of a safe in an open position, and may be configured so as to extend along and be positioned at least substantially parallel to the safe door in a closed position with the safe door closed. In some embodiments, the interior storage panel may be configured to be repositioned between the open position and the closed position by rotating the interior storage panel about a pivot axis opposite from a pivot axis of the safe door. In some embodiments, the interior storage panel may be configured to extend away from a side of the safe when opened opposite from a side of the safe from which the safe door extends.
US09888766B2
A lifting mechanism with support function includes pivot arm component composed of a first pivot arm and a second pivot arm parallel to each other. The first and second pivot arms each have two ends thereof pivotally connected to a fixation joint and an active joint respectively, and the pivotally connected points connecting the first link, the second link, the fixation joint and the active joint jointly define a parallelogram. One end of an adjustable damper pivotally connects to the pivot arm component, and the other end thereof pivotally connects to the fixation joint or the active joint via an adjustment component, so the adjustable damper can be controlled to extend/retract or be locked; the adjustment component includes a first pivot seat capable of relatively moving to change the support angle of the adjustable damper to adjust the damping support force provided from the adjustable damper.
US09888741B2
A shoe including a sole having specific characteristics, namely a width, a length, a thickness and a front/rear profile, where the sole is made with materials having a certain type of deformation and lateral reinforcements emerging from the sole and surrounding the upper that are suitable for significantly increasing both performance, such as speed and reduced fatigue, and user comfort, such as reduced impact on knees, back, leg muscles, of the shoe, which are particularly suited for use when jogging or walking on uneven outdoor surfaces, as well as for jogging or walking on roads. Furthermore, the characteristics of the sole, such as the spike surface and deformation when contacting the ground, improve safety for a user by providing enhanced grip on sloping terrain as well as on snow-covered or wet terrain.
US09888735B2
Provided is a clothing as well as a clothing article having a similar structure of the clothing, the clothing comprising a base layer (200) having an inner surface and an outer surface; the inner surface being substantially planar and forming a first fluid passage (400) with human skin (200); the outer surface being formed as a flow-disturbing face or the outer surface being attached with components having flow-disturbing face; the base layer being provided with at least one through opening (500), through which the first fluid passage being communicated with the flow-disturbing face. The clothing and the clothing article of the present invention is particularly suitable for sports.
US09888732B2
A device includes a collar and at least one pad. The collar is configured for wearing by a user, the collar having a plurality of pad receptacles. The at least one pad is configured for coupling with a selected one of the plurality of pad receptacles, the pad having an elastic portion configured to limit movement of a user.
US09888727B2
An exemplary heating assembly includes a substrate, a heating part formed on the substrate, an electrode part connected with the heating part, and a liquid conducting body configured for absorbing tobacco liquid. The liquid conducting body is in tight contact with the substrate. The liquid conducting body is capable of conveying the tobacco liquid to the substrate.
US09888723B2
An electronic vapor device is disclosed comprising a vapor outlet, a first container for storing a vaporizable material, a second container for storing a non-vaporizable material, a vaporizer component coupled to the first container configured for vaporizing the vaporizable material at a vaporization rate to generate a first vapor and for providing the first vapor to the vapor outlet, and a nebulizer component coupled to the second container configured for nebulizing the non-vaporizable material at a nebulization rate to generate a second vapor and for providing the second vapor to the vapor outlet.
US09888717B2
An electronic cigarette case with a cigarette lighter comprises: a case body, a case cover buckled with the case body, the cigarette lighter located in the case body, a battery located in the case body and used for supplying power to the cigarette lighter, and a charger located in the case body and used for charging the battery. Because the cigarette lighter is built in the electronic cigarette case, the problem of inconvenience in smoking is avoided that a smoker leaves a lighter when the smoker has a conventional cigarette, and personalized requirements of the smoker are met to some extent.
US09888714B2
Provided are systems and methods comprising receiving, from an input device, a first signal indicating a desired rate of flow of vapor to each of at least two tubes of an electronic vapor device, receiving, from the input device, a second signal indicating a selection of whether each of the at least two tubes is to receive vapor from a first vaporizable material or a second vaporizable material, and causing the electronic vaporization device to provide vapor to each of the at least two tubes from the respective selected vaporizable materials at the desired rate of flow.
US09888702B2
A coffee cherry is harvested, preferably in a sub-ripe state, and quick-dried to provide a basis for numerous nutritional products. Such coffee cherries and portions thereof may be particularly characterized by their extremely low concentration of mycotoxins, including various aflatoxins, fumonisins, ochratoxins, and/or vomitoxin (DON, deoxynivalenol).
US09888685B2
The invention relates to pesticidal mixtures comprising as active compounds 1) at least one cyanosulfoximine compound I of the formula I wherein R1, R2 and G are defined in the description; and 2) at least one active compound II selected from a group A comprising acteylcholine esterase inhibitors, GABA-gated chloride channel antagonists, sodium channel modulators, nicotinic acetylcholine receptor agonists/antagonists, chloride channel activators, juvenile hormone mimics, compounds affecting the oxidative phosphorylation, inhibitors of the chitin biosynthesis, moulting disruptors, inhibitors of the MET, voltage-dependent sodium channel blockers, inhibitors of the lipid synthesis and other compounds as defined in the description, in synergistically effective amounts. The invention relates further to methods and use of these mixtures for combating insects, arachnids or nematodes in and on plants, and for protecting such plants being infested with pests and also for protecting seeds.
US09888684B2
The present invention relates to compositions including medium chain peroxycarboxylic acid, methods for making these compositions, and methods for reducing the population of a microorganism. The compositions can include advantageously high levels of the medium chain peroxycarboxylic acid, can be readily made, and/or can exhibit reduced odor.
US09888679B2
The present invention relates to the use of polysulfated polysaccharides in combination with progenitor cells to improve the viability of the progenitor cells including improving the cryopreservation of the progenitor cells and provides novel compositions, methods and uses. The present invention also relates to the use of polysulfated polysaccharides to regulate the proliferation and differentiation of progenitor cells.
US09888678B1
A fishing reel includes a frame and a crank shaft mounted to the frame. A kick lever is provided for selective engagement with teeth of a ratchet element keyed to the crank shaft. The kick lever selectively engages the ratchet element to place the reel in one of a cast state and a retrieve state. In one embodiment, the kick lever defines a base portion, a support post, a tooth engaging post and a horizontal reinforcing member that define a window. The window receives an attachment member that slidably secures the kick lever and prevents the kick lever from vertical movement during heavy loads. The unique design of the kick lever prevents the kick lever from moving in undesired directions, thereby ensuring that smooth performance of the reel and prevention of jamming of the mechanism.
US09888676B2
A blade body component of a fishing lure formed from a material that includes a first side and a second side, wherein a surface relief grating image effect component is positioned on at least one side of the blade body component. In certain embodiments, the blade body component includes a curvature produced by a curving device. The blade body may be part of a quick change blade system that allows the user to quickly and easily remove and replace one or more of the blade body component on a fishing lure by using a combination of a quick change clevis and a clasp.
US09888675B2
Genetically modified non-human animals and methods and compositions for making and using them are provided, wherein the genetic modification comprises a deletion in an immunoglobulin constant region CH1 gene (optionally a deletion in a hinge region) of an IgG, IgA, IgD, and/or IgE, and wherein the mouse is capable of expressing a functional IgM. Genetically modified mice are described, including mice having a functional IgM gene and modified to have a deletion of a CH1 domain and a hinge region in a heavy chain constant domain that is not an IgM, e.g., in an IgG heavy chain constant domain. Genetically modified mice that make human variable/mouse constant chimeric heavy chain antibodies (antibodies that lack a light chain), fully mouse heavy chain antibodies, or fully human heavy chain antibodies are provided.
US09888671B2
A disposable diaper for pets having a shortest straight line point being further on a stomach-side waist area side than a diaper center point, and comprising: a rear-side waist area; a stomach-side waist area; a crotch area; a flap section provided in the stomach-side waist area and having an end section in the rear-side direction; a diaper longitudinal direction center line; the diaper center point; a tail insertion opening; an absorbent core; an attachment section arranged in the flap section; an attachment section intermediate point; an attachment area that receives the attachment section; and the shortest straight line point being a point on the diaper longitudinal direction center line at the shortest direct distance, via a rear-side end section of the flap section in a straight line from the attachment section center point to the diaper longitudinal direction center line.
US09888665B2
An animal enclosure including a plurality of members defining an interior of the enclosure. One of the plurality of members includes a first member having a frame structure and door assembly formed by a plurality of interconnected horizontal and vertical wires. At least two of the horizontal wires of the frame structure form a hook positioned inside the defined opening. The door assembly is coupled to the frame and moves between an open and closed positions. The door assembly includes a first door and a second door removably coupled to one another. The enclosure also includes a latch assembly for releasing the door assembly from the frame structure. In the closed position, at least one horizontal wire of the first door and at least one horizontal wire of the second door are coupled to the hooks formed by the at least two horizontal wires of the frame structure.
US09888658B1
A novel maize variety designated X03K062 and seed, plants and plant parts thereof are produced by crossing inbred maize varieties. Methods for producing a maize plant by crossing hybrid maize variety X03K062 with another maize plant are disclosed. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into X03K062 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. This invention relates to the maize variety X03K062, the seed, the plant produced from the seed, and variants, mutants, and minor modifications of maize variety X03K062. This invention further relates to methods for producing maize varieties derived from maize variety X03K062.
US09888656B1
A novel maize variety designated X00K393 and seed, plants and plant parts thereof are produced by crossing inbred maize varieties. Methods for producing a maize plant by crossing hybrid maize variety X00K393 with another maize plant are disclosed. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into X00K393 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. This invention relates to the maize variety X00K393, the seed, the plant produced from the seed, and variants, mutants, and minor modifications of maize variety X00K393. This invention further relates to methods for producing maize varieties derived from maize variety X00K393.
US09888654B1
A novel maize variety designated X08K233 and seed, plants and plant parts thereof are produced by crossing inbred maize varieties. Methods for producing a maize plant by crossing hybrid maize variety X08K233 with another maize plant are disclosed. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into X08K233 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. This invention relates to the maize variety X08K233, the seed, the plant produced from the seed, and variants, mutants, and minor modifications of maize variety X08K233. This invention further relates to methods for producing maize varieties derived from maize variety X08K233.
US09888649B2
The invention provides seed and plants of sweet corn hybrid SVSK0391 and the parent lines thereof. The invention thus relates to the plants, seeds and tissue cultures of sweet corn hybrid SVSK0391 and the parent lines thereof, and to methods for producing a sweet corn plant produced by crossing such plants with themselves or with another sweet corn plant, such as a plant of another genotype. The invention further relates to seeds and plants produced by such crossing. The invention further relates to parts of such plants, including the parts of such plants.
US09888643B2
A novel maize variety designated X00H315 and seed, plants and plant parts thereof are produced by crossing inbred maize varieties. Methods for producing a maize plant by crossing hybrid maize variety X00H315 with another maize plant are disclosed. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into X00H315 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. This invention relates to the maize variety X00H315, the seed, the plant produced from the seed, and variants, mutants, and minor modifications of maize variety X00H315. This invention further relates to methods for producing maize varieties derived from maize variety X00H315.
US09888640B2
The present invention is in the field of soybean variety CC1310866 breeding and development. The present invention particularly relates to the soybean variety CC1310866 and its seed, cells, germplasm, plant parts, and progeny, and methods of using CC1310866 in a breeding program.
US09888639B2
The present invention is in the field of soybean variety CC1313450 breeding and development. The present invention particularly relates to the soybean variety CC1313450 and its seed, cells, germplasm, plant parts, and progeny, and methods of using CC1313450 in a breeding program.
US09888635B2
A vegetable preservation and growing case includes a thermally-insulated case body for vegetable growing or preservation. An electrical control component is electrically controlling the thermally-insulated case. A pipeline component is circularly supplying a nutrient solution to the thermally-insulated case body under an action of gravity. The preservation and growing case allows the freshness of a vegetable to be preserved for an extended period of time, has a simple structure, and is easy to maintain.
US09888626B2
A mower blade includes two symmetrical body portions disposed on either side of an axis of rotation, wherein each body portion includes a straight leading edge having a first sharpened edge formed along at least a portion of the leading edge, and a curved trailing edge having a second sharpened edge formed along at least a portion of the trailing edge, so that each body portion tapers to a rounded end.
US09888623B2
At least one example embodiment discloses a seed monitoring system including a light source configured to emit light in an interior of a seed tube, a plurality of light receivers, each of the plurality of light receivers configured to receive light in at least two sectors of a plurality of sectors of a plane in the interior of the seed tube and generate a sensing signal corresponding to the received light, a processing system including a plurality of conditioning channels, the processing system configured to process the sensing signals to generate conditioned signals and a controller configured to generate a seed count value based on the generated conditioned signals.
US09894812B2
An inverter case is provided on a transaxle of a vehicle so as to be inclined downward toward a vehicle front side, and the inverter case includes: a refrigerant passage connection portion provided on a front side surface of the inverter case in a longitudinal direction of the vehicle, the refrigerant passage connection portion having a shaft seal structure; a refrigerant passage member disposed on the front side surface of the inverter case and connected to the refrigerant passage connection portion by the shaft seal structure; and a projecting portion provided on an upper part of the front side surface of the inverter case, the projecting portion being configured such that a front side end of the projecting portion is placed at the vehicle front side relative to a front side end of the refrigerant passage member in the longitudinal direction of the vehicle.
US09894803B1
Heat sinks and thermal cooling systems are disclosed. The heat sinks and thermal cooling systems include fins, which extend away from a surface of a base of the heat sink, and which are located in a finned region on the surface. The heat sinks and thermal cooling systems also include one or more heat pipes that are positioned and shaped in a way so that a first portion of each heat pipe is in contact with the surface of the base, while at least a second portion of each heat pipe is raised above the surface of the base in into contact with fins in the finned region. Raising the heat pipes away from the surface of the base prevents components in contact with, or adjacent to, the base from being heated by the heat pipes.
US09894788B2
A field replaceable power supply cartridge is provided for coupling with a socket. The cartridge has a latch mechanism that can be actuated by the user to couple the cartridge to the socket, such that latches of the cartridge releasably engage recessed portions in the socket. The cartridge has a key feature that corresponds to a key feature on the socket, allowing the cartridge to be coupled to the socket in only one orientation, thereby preventing the incorrect electrical connection between the cartridge and the socket. The cartridge can have a multi-pin electrical connector for coupling to a corresponding connector on the socket. The socket can be a relatively short socket, where the electrical wires are bottom fed, or can be a relatively tall socket, where the electrical wires are side fed via one or more openings in the body of the socket.
US09894782B2
A foldable display device and a display apparatus are provided. The foldable display device includes a supporting back plate and a display screen arranged in the front side of the supporting back plate. The supporting back plate includes a first supporting part and a second supporting part, and the first supporting part and the second supporting part may bend towards to the reverse side of the supporting back plate through a folding connection. One end of the display screen is fixedly connected to the first supporting part, and the other end of the display screen is slidably connected to the second supporting part.
US09894780B2
A method of manufacturing a resin multilayer substrate with a cavity, includes stacking insulation substrates including thermoplastic resins and thermocompression-bonding the insulation substrates. At least one of the insulation substrates is formed by affixing a peelable carrier film to one main surface of the insulation substrate, making a cut in the insulation substrate having the carrier film affixed thereto, the cut being designed to form the cavity, penetrating the insulation substrate in a thickness direction and not penetrating the carrier film in a thickness direction, and removing the carrier film and a portion of the insulation substrate that is cut out by the cut.
US09894771B2
An Occam process (solderless manufacturing) that employs a component support fixture that provides permanent or temporary support for components during subsequent processing in a solderless process for electrically connecting the components to circuits. The component support fixture provides oversized compartments for housing the components which may have varying sizes. The compartments are provided with vent holes or apertures for venting air or excess glue as the component support is pressed against the components during manufacture.
US09894770B2
Disclosed is an embedded electronic component which can improve reliability of connection with external wiring and efficiency of an embedding process by including: a contact pad provided on at least one surface of a body portion and made of a conductive material; a first insulating layer for covering the at least one surface of the body portion; a first pad in contact with a surface of the contact pad and made of a conductive material; a rearrangement portion provided on a surface of the first insulating layer to be in contact with the first pad; a second pad provided on the surface of the first insulating layer to be in contact with the rearrangement portion; and a second insulating layer having an opening to expose a portion of the second pad while covering the first insulating layer, the first pad, the rearrangement portion, and the second pad.
US09894761B2
A prepreg includes a resin composition including: (A) at least one of an epoxy resin having a naphthalene skeleton and a phenolic hardener having a naphthalene skeleton; (B) a polymer having at least the structures of formulae (2) and (3) among formulae (1), (2) and (3) and having a weight-average molecular weight of from 200,000 to 850,000 inclusive; and (C) an inorganic filler: wherein x:y:z (molar fraction)=0:0.95:0.05 to 0.2:0.6:0.2 (where x+y+z≦1, 0≦x≦0.2, 0.6≦y≦0.95, 0.05≦z≦0.2); R1 represents a hydrogen atom or a methyl group and R2 includes at least one of a glycidyl group and an epoxidized alkyl group among a hydrogen atom, an alkyl group, a glycidyl group and an epoxidized alkyl group in formula (2); and R3 represents a hydrogen atom or a methyl group and R4 represents Ph (phenyl group), —COOCH2Ph or —COO(CH2)2Ph in formula (3).
US09894760B2
A method for making conformal non-planar multi-layer circuitry is described. The method can include providing a substrate having a non-planar surface and depositing a first conformal dielectric layer on the substrate, the first conformal dielectric layer conforming to the non-planar surface of the substrate and having a non-planar surface. The method can also include applying a first conformal circuitry layer on the first conformal dielectric layer. The method can include depositing a second conformal dielectric layer on the first conformal circuitry layer, the second conformal dielectric layer conforming to a non-planar surface of the first conformal circuitry layer, and applying a second conformal circuitry layer on the second conformal dielectric layer. Successive layers can be sequentially deposited. Microvias may provide electrical connections between circuit layers.
US09894756B2
Some aspects of this disclosure generally are related to improving the robustness of a flexible circuit structure, for example, by providing fault-tolerant electrical pathways for flow of electric current through the flexible circuit structure. In some embodiments, such fault tolerance is enhanced by way of a conductive mesh provided between an adjacent pair of resistive elements. Some aspects are related to improved voltage, current, or voltage and current measurement associated with various pairs of adjacent resistive elements at least when the various pairs have differing distances between them.
US09894755B2
A flexible display and a method of manufacturing the same are disclosed. In one aspect, the flexible display includes a flexible display panel including an active area configured to display an image and an inactive area surrounding the active area. The flexible display also includes a plurality of wires formed over the flexible display panel in the inactive area and configured to transmit an electric signal to the active area. The inactive area includes a plurality of edges that are bent with respect to the active area of the flexible display panel. A bending hole is formed at each corner where two adjacent edges of the flexible display panel meet and each of the corners is folded so as to define a folding region.
US09894749B2
Tamper-respondent assemblies and methods of fabrication are provided which include at least one tamper-respondent sensor having unexposed circuit lines forming, at least in part, one or more tamper-detect network(s), and the tamper-respondent sensor having at least one external bond region. The tamper-respondent assembly further includes at least one conductive trace and an adhesive. The conductive trace(s) forms, at least in part, the one or more tamper-detect network(s), and is exposed, at least in part, on the tamper-respondent sensor(s) within the external bond region(s). The adhesive contacts the conductive trace(s) within the external bond region(s) of the tamper-respondent sensor(s), and the adhesive, in part, facilitates securing the at least one tamper-respondent sensor within the tamper-respondent assembly. In enhanced embodiments, the conductive trace(s) is a chemically compromisable conductor susceptible to damage during a chemical attack on the adhesive within the external bond region(s).
US09894746B2
Target windows for isotope production systems are provided. One target window includes a plurality of foil members in a stacked arrangement. The foil members have sides, and wherein the side of a least one of the foil members engages the side of at least one of the other foil members. Additionally, at least two of the foil members are formed from different materials.
US09894743B2
An apparatus for generating extreme ultraviolet light may include: a chamber having an opening through which a laser beam is introduced into the chamber; a reference member on which the chamber is mounted; a target supply unit for supplying a target material to be irradiated by the laser beam to a predetermined region inside the chamber; a laser beam focusing optical system for focusing the laser beam in the predetermined region inside the chamber to turn the target material into plasma; and a collector mirror for collecting the extreme ultraviolet light emitted from the plasma.
US09894740B1
A lighting fixture includes an LED light source that outputs light for general illumination in response to a drive signal, and a driver module configured to provide the drive signal in response to an intelligent lighting module (ILM) instruction. An ILM that is separate from the driver module is provided and has a first plurality of sensors, a first communication interface, a second communication interface, and first control circuitry. The control circuitry of the ILM is configured to communicate with at least one remote entity via the first communication interface as well as generate the ILM instruction for the driver module based on sensor data gathered from the first plurality of sensors, remote entities, or a combination thereof. The ILM instruction is provided to the driver module via the second communication interface and used by the driver module to control the drive signal for the LED array.
US09894739B2
Method for the operation and the expansion of a network of lights, each light in the network including a control module which is assigned to a group, each control module being in communication with a group controller as well as control modules in the same group. The network can be expanded by installing (19) new lights with their associated control modules, and each new control module scans (20) its environment and transmits environmental information to a central server where the environmental information is analyzed and the new control modules are allocated (21) into groups. After allocation to a group in which control modules may be moved from one group to another or a new group is formed, the new control modules are available for normal operation. This process is repeated for each new light and associated control module.
US09894738B2
There is provided a portable light-emitting apparatus including: a near-field wireless communication unit for transmitting and receiving a light emission mode to and from another light-emitting apparatus; and a switching unit for starting control of the light-emitting apparatus according to the light emission mode received by the near-field wireless communication unit in response to a switching instruction originating from at least one of an action using the light-emitting apparatus and an action using another light-emitting apparatus. As one example, when a switching instruction is outputted by touching another light-emitting apparatus, it is possible for a plurality of light-emitting apparatuses to successively emit light in the manner of a torch relay.
US09894731B2
A method for detecting a failure of at least one light emitting diode in a light emitting diode arrangement to which a supply current is applied by a constant-current source via a supply terminal and in which a respective luminous state of the light emitting diodes is set individually or in groups by means of a respective switching element by respective short-circuiting is disclosed, wherein a voltage signal of a chain voltage dropped across the light emitting diodes and dependent on the respective switching state of the switching elements is tapped off by a circuit apparatus at the supply terminal. The voltage signal is fed to an analog maximum value detector of the circuit apparatus, the maximum value detector is operated for a predetermined measurement duration and a maximum value signal of the voltage signal is provided at an output of the maximum value detector after the measurement duration.
US09894727B2
A LED driver having at least one Integrated Circuit (IC), the IC programmable using a hardware description language; a first electronic switch operable to provide a first switching time period to control power factor voltage, the first switching time period programmable by the at least one IC; and a second electronic switch operable to provide a second switching time period to regulate ripple free constant DC electrical current flowing into the at least one LED, the second switching time period is programmable by the at least one IC.
US09894723B2
A solid-state light source (SSLS) structure with integrated control. In one embodiment, a SSLS control circuit can be integrated with a SSLS structure formed from a multiple of SSLSs. The SSLS control circuit controls the total operating current of the SSLS structure to within a predetermined total operating current limit by selectively limiting the current in individual SSLSs or in groups of SSLSs as each are turned on according to a sequential order. The SSLS control circuit limits the current in each of the individual SSLSs or groups of SSLSs as function of the saturation current of the SSLSs. In one embodiment, the individual SSLSs or groups of SSLSs has a turn on voltage corresponding to a voltage causing a preceding SSLS or group of SSLSs in the sequential order to saturate current.
US09894718B1
A driver circuit provides current to a light source from a resonant tank having a single inductive element. The driver circuit is coupled to DC power source having a power rail and a ground, and includes a power inverter providing AC input to the tank, which further includes a DC blocking capacitor and a primary winding of the inductive element coupled in series between the output of the inverter and the ground. A leakage inductance of the inductive element provides resonant inductance for the tank. The inductive element further distributes power output from the resonant tank to a plurality of secondary windings coupled to an output rectifier. A resonant capacitor coupled across output ends of the secondary windings provides resonant capacitance for the tank. The output voltages across the secondary windings are clamped to a value based in part on a turns ratio between respective secondary windings.
US09894716B2
A heating device for a cooking point in a hob has three independent and separate long heating elements which are arranged on a support of the heating device along concentric circles. The support has a central region around the center point, an outer region adjoining an outer edge, and an intermediate region between the central region and outer region. A rod-type thermostat engages over the heating device for the purpose of temperature detection. The first and the third heating element are connected to an energy supply over the rod-type thermostat. A second heating element is connected to an energy supply without interconnection of the rod-type thermostat, wherein the second heating element is arranged on the support in the central region, in the intermediate region and in the outer region.
US09894713B2
A method of controlling a base station system is provided. The method comprises generating and transmitting a control signal arranged to cause a radio equipment controller to control a first radio equipment from a plurality of radio equipment at a first time; and generating and transmitting a control signal arranged to cause the radio equipment controller to control a second radio equipment from the plurality of radio equipment instead of the first radio equipment at a later time; wherein each of the plurality of radio equipment is coupled to a respective antenna having a respective coverage area. Also provided is a controller and a computer program product configured to control a base station system.
US09894708B2
For LTE cellular data and Wi-Fi P2P technology coexistence scenario, a user equipment can generate in-device coexistence (IDC) indication message to the base station for DRX-based IDC solution. LTE data scheduling is described by a set of DRX parameters, while Wi-Fi P2P data scheduling is described by Opportunistic Power Saving (OppoPS) and Notification of Absence (NoA) parameters. When generating the IDC indication message for Wi-Fi P2P group client (GC), the DRX parameters must be selected carefully to maximize efficiency. Even though Wi-Fi shares less time, with proper time alignment, its coexistence performance could be better. For Wi-Fi P2P group owner (GO) with IDC TDM scheduling constraints, OppoPS and NoA should be aligned with DRX parameters to achieve best performance.
US09894705B2
Radio access networks and particularly enhancements for diverse data applications may benefit from a self-adjusting discontinuous reception (DRX) pattern. According to certain embodiments, for example, a method may include configuring a discontinuous reception pattern of a user equipment and adjusting the discontinuous reception pattern at the user equipment autonomously with respect to a base station.
US09894699B2
Methods, corresponding apparatuses, and non-transitory computer readable mediums for a Proximity-based Service are provided. A method comprises receiving, from at least one user equipment, a resource utilization indication that indicates resources used by at least one user equipment for a ProSe device-to-device discovery procedure. The method also comprises determining, based on the received resource utilization indication, resources for the at least one user equipment to perform a subsequent ProSe device-to-device discovery procedure. The method additionally comprises signaling the determined resource to the at least one user equipment. With the claimed inventions, utilization efficiency of the radio resources may be improved and the complexity and overhead in allocating the resource for ProSe D2D discovery procedure may be lowered.
US09894698B2
Embodiments of a communication system, a base station (BS), a user equipment (UE), and a discovery method for device-to-device (D2D) communication are provided. The communication system includes a base station and multiple UEs. Each of the UEs uses one of multiple carrier frequency bands for communication. The BS obtains D2D communication requests of the UEs by the carrier frequency bands, and groups the UEs into multiple groups according to locations of the UEs. The BS allocates a discovery resource pool of a predefined carrier frequency band to the UEs in the same group and enables each of the UEs to transmit a discovery message corresponding to each of the UEs' own in the discovery resource pool.
US09894691B1
Systems and methods are provided for establishing a bi-directional communication link with an implantable medical device. The systems and methods include an implantable medical device (IMD) and an external instrument configured to establish a wireless bi-directional communication link there between over a wireless protocol. The wireless bi-directional communication link is established based on a scanning interval. The external instrument includes one or more processors electrically coupled to a radio frequency (RF) circuit and a memory device. The one or more processors are configured to define the scanning interval based on an advertising schedule received from the IMD.
US09894687B2
Methods and devices are provided. Devices asynchronously transmit, without diversity, bursts including information encoded using a low rate FEC code having a code rate no higher than ½. A terminal receives transmitted multiple overlapping bursts. The terminal detects and decodes bursts in a window of burst times, performs an iteration of an iterative interference cancellation process, and when at least one burst of at least a portion of the window remains incorrectly decoded, another iteration of the iterative cancellation process is performed as long as a maximum number of repeated iterations has not yet been performed. When all of the bursts in at least the portion of the window are correctly decoded, the window is advanced by an amount of burst time, at least the portion of the window is updated, and the iterations may be repeated. Correctly decoded bursts may be passed to a next process or device.
US09894685B2
A licensed assisted access network system is provided. The licensed assisted access network system includes a mobile station and a first base station. The mobile station determines a use status of an unlicensed band and generates first available unlicensed channel group information. The mobile station transmits the first available unlicensed channel group information to the first base station. The first base station selects a first unlicensed channel according to the first available unlicensed channel group information. The first base station initializes a communication schedule assessment procedure with the mobile station through the first unlicensed channel.
US09894683B2
According to some aspects, a base station may transmit a control message to a wireless device. The control message may comprise configuration parameters for a control channel associated with sets of resource blocks in one or more subframes of a plurality of subframes. The configuration parameters may indicate the one or more subframes in which the resource blocks of the control channel are configured. The configuration parameters may further indicate a starting symbol, such as an offset number of symbols, for the control channel and an associated downlink data channel within the one or more subframes. The base station may transmit, via the control channel, scheduling information for a packet. The base station may receive the packet and transmit an acknowledgement via a feedback channel beginning at the first symbol of a subframe in the plurality of subframes.
US09894674B2
An apparatus and method for implementing a system solution for co-existence between a first service and a second service including accepting a first service selection for a first wireless system on a mobile terminal; performing a data transport using the first service selection on the mobile terminal; accepting a second service selection for a second wireless system on the mobile terminal; implementing a suspension of the data transport using the first service selection on the mobile terminal; and redirecting the data transport using a different wireless system.
US09894668B2
The present invention discloses a method for performing a CoMP operation in a wireless communication system and an apparatus for the method. A method for performing an Inter-eNB CoMP (Coordinated Multi-Point) operation in a wireless communication system comprises receiving, by a first eNB, a message requesting initiation of a CoMP operation from a second eNB; transmitting, by the first eNB, to the second eNB a message requesting information about gain expected from a CoMP operation carried out in the second eNB; receiving, by the first eNB, the information about gain expected from the second eNB; coordinating, by the first eNB, resources for a CoMP operation based on the information of expected gain; and transmitting, by the first eNB, the resource coordination result to the second eNB.
US09894664B2
A radio base station and a method therein for scheduling an uplink radio resource to a first user equipment in a wireless communication system which employs CDMA are provided. The method includes measuring an Interference Suppression (IS) gain for each user equipment in a set of user equipments currently being served by the radio base station. The method further includes determining a user constellation pertaining to information regarding the different user equipments in the set of user equipments and their respective bitrates, and updating a table of IS gains with the measured IS gain in bins corresponding to the determined user constellation. The method further includes predicting a load based on at least the updated table, and scheduling the uplink radio resource to the first user equipment at least partly based on the predicted load.
US09894648B2
Methods and systems for providing Device to Device (D2D) proximity services in wireless communication networks are disclosed. In an embodiment, the method includes comparing a set of predefined proximity service parameters for a plurality of UEs with associated thresholds within a set of thresholds; creating a UE proximity group comprising a set of neighboring UEs selected from the plurality of UEs based on the comparing, wherein the set of neighboring UEs communicate amongst each other through at least one Base Station (BS) bypassing a core network of the wireless communication network; monitoring each of the set of predefined proximity service parameters to determine deviation with an associated threshold; and modifying the UE proximity group in response to determining deviation between at least one of the set of predefined proximity service parameters and an associated threshold.
US09894641B2
A user terminal for multiple-user wireless communication is provided, comprising a transmit buffer configured to store uplink data for transmission. The user terminal comprises a processor configured to generate a request to transmit frame in response to uplink data being present in the transmit buffer, and initiate a transmit timer for determining when to transmit the request to transmit frame. The user terminal comprises a transmitter configured to transmit the request to transmit frame when the transmit timer expires or when the uplink data present in the transmit buffer exceeds a threshold amount. The user terminal comprises a receiver configured to receive a clear to transmit frame from an access point based on the transmitted request to transmit frame. The transmitter is further configured to transmit the uplink data present in the transmit buffer, concurrently with at least one other user terminal transmitting uplink data, to the access point at a specified time based on receiving the clear to transmit frame addressed to the user terminal.
US09894637B2
Methods, systems, and apparatuses for wireless communication are described. A user equipment (UE) may establish a dynamic coverage enhancement (CE) configuration and then autonomously transition from one CE level to another while in idle mode. The network may blindly detect the CE change during a paging procedure. For example, a mobility management entity (MME) may store dynamic CE information, and it may provide the dynamic CE information to base stations when the UE is paged. In some cases, the base stations may autonomously retransmit paging messages at different CE levels based on the dynamic CE information. In other examples, the MME may direct the base station to retransmit at different CE levels.
US09894635B2
A location configuration information response (250) comprises a single frame of data. The response includes a data field having a length equal to the length indicated in the length field and including data indicating yaw, pitch and roll orientation parameter values of the subject. A location configuration information request (249) comprises a single frame of data. The request includes a data field indicating an orientation request.
US09894626B2
Methods, systems, and devices are described for wireless communication. The method may include determining, at a wireless device, a logical identifier (ID) as a pseudo-random function of a physical device ID of the wireless device and a synchronization channel index, where the synchronization channel index corresponds to an instance of a periodically repeating synchronization channel in a radio frame. The wireless device may be a base station in a serving cell, such that the synchronization channel may be to synchronize a downlink to communicate with a user equipment (UE) operating in a narrow-band cellular internet of things. The method may also include generating a secondary synchronization signal (SSS) for each instance of the periodically repeating synchronization channel in the frame based at least in part on the logical ID and the corresponding synchronization channel index, and transmitting the frame from the wireless device.
US09894619B2
Some OFDM symbols transmitted temporally continuously by a base station include data signals that are not orthogonal to each other and are directed to user devices. A reference signal is arranged in the OFDM symbols temporally intermittently. The base station determines, according to reception qualities at user devices, downlink data signal transmission powers for transmitting downlink data signals. The base station reduces a downlink data signal transmission power in an OFDM symbol in which the reference signal is arranged to be lower than a downlink data signal transmission power in an OFDM symbol in which the reference signal is not arranged. The base station determines a downlink reference signal transmission power to be higher than the downlink data signal transmission power of a data signal in the OFDM symbol in which the reference signal is not arranged.
US09894609B2
A system, device and method are described for operating a communication device communicating with a wireless network. The method comprises in a power save mode wherein a communication subsystem of the communication device has been deactivated: for a first period beginning at a first instance, re-activating the subsystem, executing an action relating to a link layer connection condition, and then de-activating the subsystem; and for a second period beginning at a second instance, re-activating the subsystem, executing an action relating to a network layer connection condition, and then de-activating the subsystem. For the method, the first period is repeated on a cycle based on a first frequency timed to allow the communication device to process a beacon signal from the wireless network; and the second period is repeated on a cycle based on a second frequency of occurrence of an Address Resolution Protocol request in the wireless network.
US09894594B2
A method for operating a first access point of a first plurality of access points comprising access points participating in cumulative beacon operations includes generating a cumulative beacon including basic service set identifiers (BSSIDs) and service set identifiers (SSIDs) of each access point in the first plurality of access points, and sending the cumulative beacon.
US09894593B2
The invention concerns a wireless communication network that is particularly innovative and robust when said the network, comprising a plurality of nodes, has a dynamic topology. A method implemented by a communicating electronic device acting as a free node of said the network can request, on demand, a procedure for affiliation with a second device that is a member of a cluster. Affiliated with the cluster, a device implementing the method can communicate with a third device acting as cluster head in the same way as a member of the cluster. Such an invention makes it possible, in particular, to operate a traceability system for containers cooperating respectively with such devices on a storage area or a transport platform.
US09894590B2
There is disclosed a method of staging real-time data in proximity to a mobile device. The method includes determining a geographic location associated with the mobile device and identifying a storage device located in proximity to the determined geographic location. The method also includes enabling real-time data published by the mobile device or provided to the mobile device to be stored on the identified storage device.
US09894588B2
The present invention pertains to a method and device for preserving mobility information in terminal state transition and effectively re-accessing in a heterogeneous cell network in a mobile communication system. A method for estimating a mobility state of a terminal in a mobile communication system according to one embodiment of the present invention may comprise the steps of: receiving, by the terminal, system information from a serving cell during an idle state; calculating mobility state information by using the received system information; storing the mobility state information; and transmitting the mobility state information to a base station when the terminal is connected to the base station. According to one embodiment of the present invention, when an idle state of a terminal is changed to a connection state in a mobile communication system, a mobility state of the terminal can be more effectively estimated.
US09894579B2
The present invention relates to an improved method for handover of a mobile node from E-UTRAN to UTRAN in a scenario where SMS is the only service of the mobile node. The improved handover method allows saving radio resources by establishing the signalling connection for SMS exchange in the target network, and avoiding the data connection in the target network, since it is not used. The MME takes the decision to establish or not the data connection in the target UTRAN, and accordingly instructs the SGSN and UE to set the corresponding PDP contexts for the data connection to a “preserved” state, so as to avoid the establishment of same. Embodiments further relate to improved SMS delivery for IDLE mode UEs that activate ISR so as to avoid the involvement of the MSC server. Instead, packet-switched domain nodes are to be involved only.
US09894570B2
Methods and systems of performing cell change for a circuit-switched call without a mobile station receiving a description of resources in a target cell are provided. In some embodiments, a command is generated at the serving cell which indicates to the mobile station to perform a cell change without first receiving a description of resources in the target cell. In some embodiments, a command is generated at the target cell which may be like a handover command, but which indicates to the mobile station to perform the cell change without an allocation of resources.
US09894569B2
A method and apparatus for applying assistance information for traffic steering between a 3rd generation partnership project (3GPP) access network and a non-3GPP access network in a wireless communication system is provided. A user equipment (UE) receives assistance information for traffic steering through a dedicated signaling from an eNodeB (eNB), and starts a timer upon entering an idle mode. The UE applies the assistance information received through the dedicated signaling until the timer expires. After the timer expires, the UE applies assistance information received through a broadcast signaling.
US09894562B2
An apparatus and method for managing wireless transmission capacity, comprising storing, at a server, available wireless transmission capacity obtained from a wireless transmission capacity provider, reserving by the server at least part of said available wireless transmission capacity for a first user, updating said stored information based on said reserved wireless transmission capacity, receiving by the server an indication about wireless transmission capacity need concerning another user, detecting that said wireless transmission capacity need cannot be met, and taking action by the server to increase wireless transmission capacity available for allocation for said another user.
US09894552B2
Disclosed are methods, circuits, apparatus, systems and functionally associated computer executable code for providing connectivity between a mobile communication device communicatively coupled to an access point of a mobile communication network and a remote server. According to some embodiments, there may be provided a data buffer at or in communicative proximity with the access point and which responds to receipt of data packets from the remote server with a packet receipt acknowledgement emulating a packet receipt acknowledgment of the mobile communication device.
US09894534B2
The present disclosure relates to a method and system in a wireless network for radar detection in certain bands e.g. bands normally used for unlicensed access. In one broad aspect, a method is provided for a network node configured to control wireless transmissions in a frequency band also used for radar transmissions. In that method, the network node controls the wireless transmissions using a transmission cycle pattern defined by a transmit on time and a transmit off time. The method includes after a wireless transmission during the transmit-on time of a first transmission cycle, detecting, during the transmit-off time of the first transmission cycle, at least one radar pulse in the frequency band and extending the transmit off time of a second transmission cycle based on the at least one radar pulse detected. Advantageously, in some implementations, extending the transmit off time when one or more radar pulses are detected provides more time to detect a larger number of pulses which as a result, may improve radar detection accuracy.
US09894530B2
Methods and network nodes of a wireless telecommunications system are disclosed. One method of controlling transmissions with a base station of a wireless telecommunications system comprises the steps of: determining a set of neighboring base stations, each base station in the set of neighboring base stations utilizing an identical carrier and scrambling code to support transmissions with that base station; and allocating base stations in the set of neighboring base stations different spreading codes for transmissions with those base stations. By allocating each base station in the set of base stations sharing the same carrier and scrambling code different spreading codes, interference in transmissions between the base stations can be controlled.
US09894529B2
The present disclosure provides a spectrum management apparatus and method, as well as an apparatus and method for base station side and user device side of a wireless communication system. The spectrum management apparatus includes: an acquiring unit, configured to acquire spectrum utilization information of at least one wireless communication system on a predetermined frequency band; a determining unit, configured to determine, according to the spectrum utilization information, spectrum utilization efficiency of a corresponding wireless communication system; and an adjusting unit, configured to adjust, based on the spectrum utilization efficiency, spectrum sensing parameters of the corresponding wireless communication system on the predetermined frequency band.
US09894521B2
A device may receive, from a mobile device, first encrypted information, encrypted by a content provider device using a first private key, and at least one unencrypted identifier. The device may decrypt, using a first public key, the first encrypted information to obtain first information that may include second encrypted information, encrypted using a second public key. The device may decrypt, using a second private key, the second encrypted information to obtain second information that may include at least one first identifier and at least one second identifier corresponding to a toll-free data service campaign that may be provided by a content provider. The device may allow toll-free data service traffic, for the mobile device, based on whether the at least one first identifier corresponds to the at least one unencrypted identifier and the traffic includes at least one third identifier that corresponds to the at least one second identifier.
US09894515B2
An information processing device configured to communicate with a plurality of mobile terminals, the information processing device includes a memory and a processor coupled to the memory and configured to acquire, from the plurality of mobile terminals, information related to movements of the plurality of mobile terminals, identify, based on the information, movement patterns of the plurality of mobile terminals, identify, based on the movement patterns, a queue including at least two mobile terminals of the plurality of mobile terminals, identify, based on the information of the mobile terminals included in the queue, a waiting time that elapses before a first mobile terminal that is one of the plurality of mobile terminals and that is included in the queue reaches a head of the queue, and output the identified waiting time.
US09894512B2
A BLE-Mesh device includes a controller coupled to a memory and to a transceiver adapted to be coupled to an antenna, wherein the controller implements an applications layer including BLE and Mesh applications, and a BLE stack and a mesh stack. The BLE-Mesh device has a switchable high-speed and low-speed mode and a speed switching algorithm for implementing a method of communications in BLE-mesh network. A broadcast ping is sent to neighborhood devices with a time to live (TTL)=1. A manufacturer's ID is analyzed to identify in a manufacturer's ID field in pongs received to determine a higher-speed capable device or a lower-speed device. A higher-speed data rate is utilized for mesh communications if a percentage of higher-speed capable devices is≧a threshold percentage or a lower-speed data rate is utilized for the mesh communications if the percentage of higher-speed capable devices is
US09894502B2
A system may be configured to determine a floor of a building in which the user device is located at a time a call was placed. The information, indicating the determined floor, may be provided to a callee, such as a public safety answering point (“PSAP”). The floor may be determined based on, for example, comparing an altitude of the user device and/or a list of networks or devices that are visible to the user device, to a set of reference information.
US09894501B2
Methods, systems, and apparatus can be used to provide handover of on-hold sessions in converged networks. In various example implementations, an on-hold session between a mobile communication device and a fixed packet network-connected peer CPE can be handed over from a fixed packet domain to a cellular domain, and vice versa. In various example implementations, an on-hold session between a mobile communication device and a PSTN-connected peer CPE can be handed over from a fixed packet domain to a cellular domain, and vice versa.
US09894499B2
In an instant messaging device, a selection is received from a user, where the selection specifying a plurality of contacts to participate in an instant messaging session. At least one attribute type corresponding to the at least one intended recipient is retrieved in response to detecting a trigger event relating to a message intended for at least one recipient among the plurality of contacts. A verification operation is retrieved for each of the retrieved at least one attribute type. At least one retrieved verification operations is executed. The message is sent to the at least one intended recipient in response to successful execution of the at least one of the retrieved verification operations.
US09894490B2
The subject matter disclosed herein relates to a system and method for determining indoor context information relating to a location of a mobile device. Indoor context information may be utilized by a mobile device or a network element to obtain an estimate of a location of the mobile device within an indoor environment.
US09894486B2
A method of tracking a service queue using a single-point signal monitor in which at least one customer carries a wireless device may include: receiving a received signal strength from the wireless device as a trace; identify first segments of the trace containing mostly positive sloped received signal strength; identify second segments of the trace containing mostly negative sloped received signal; extract attributes from the first and second segments as child variables for two parent nodes in a Bayesian Network in which the two parent nodes respectively model a beginning of service and a leaving period for a service queue; and inputting the extracted attributes into Bayesian Network; and determining a beginning of service and leaving period using the Bayesian Network. The method may also include determining critical time points in a trace using a K-L divergence technique.
US09894485B2
A method and apparatus for location sharing, consisting of sending a location report by a location determining device to a plurality of network enabled devices over a peer-to-peer network, the location determining device being associated with a first digital key pair. A first of the plurality of network enabled devices, associated with a second digital key pair, performs a validation computation on the location report and submits a validation computation result and the location report to a remainder of the plurality of network enabled devices for inclusion in a shared ledger. Including the location report creates commercially-valued credits associated with the public key of the second digital key pair recorded in the shared ledger. A transfer of commercially-valued credits from association with the first public key of the first digital key pair to the public key of the second digital key pair is also recorded in the shared ledger.
US09894480B2
A lost tracking device associated with a tracking system can be located by leveraging one or more community members by inviting these members to join a search party. Search party criteria can be identified and candidate search party members can be selected and invited based on the search party criteria. When invited candidate search party members accept the invitations, they are added to the search party. A last known location of the tracking device can be provided to the search party members, and the search party can remain in effect until the lost tracking device is located. The location of the lost tracking device is provided to the tracking system, which forwards it to the owner of the lost tracking device. A reward can be provided by the owner of the lost tracking device to the tracking system, which releases the reward to the search party member that located the lost tracking device.
US09894479B2
A platform that facilities preservation of user privacy with respect to location-based applications executing on mobile computing devices is described. The platform registers triggers that are set forth by location-based applications, where a trigger specifies one or more rules and includes a location constraint. The platform causes a sensor on the mobile computing device to output location data, and the platform determines if the trigger has been satisfied by comparing the location constraint with the location data. If the trigger is satisfied, the platform transmits a callback to the application. Accordingly, the application does not receive location data from the sensor.
US09894477B1
Disclosed embodiments provide systems, methods, and computer program products for associating mobile devices with identities of individuals, and tracking such individuals using the location of respective devices. Initially, a user registration process is performed to register an individual for a tracking list. A unique identifier is wirelessly detected from a mobile device in proximity to the individual. The unique identifier is added to the tracking list. The location of the mobile device within the venue is tracked using the unique identifier. When the individual exits the venue, the departure is recorded, and the unique identifier is removed from the tracking list.
US09894472B2
A mobile device (200) for receiving an audio signal from a source (390) via a base station (300) is disclosed. The mobile device comprises a first wireless communication interface (220) operable to communicate using a first mode of wireless communication; a second wireless communication interface (230)_operable to communicate using a second mode of wireless communication, the second mode having a shorter range than the first mode; and a controller (210) configured to switch from receiving the audio signal from the base station via the first wireless communication interface to receiving the audio signal via the second wireless communication interface when the mobile device is proximate to the base station.
US09894467B2
A method and apparatus for starting or stopping a device-to-device (D2D) operation in a wireless communication system is provided. A user equipment (UE) supporting proximity services (ProSe) receives system information which indicates starting or stopping a D2D operation from a network, and starts or stops the D2D operation according to the system information. The system information may include a D2D start/end time which indicates when the D2D operation is started or stopped.
US09894466B2
A transmission method comprises: connecting a first wireless device to a second wireless device; determining by the first wireless device whether a silence time is assigned to the second wireless device; setting a communication period with the second wireless device according to the assigned silence time if the silence time assigned to the second wireless device is recorded in the first wireless device; and determining by the first wireless device the silence time according to a traffic transmitted from the second wireless device if the silence time assigned to the second wireless device is not recorded in the first wireless device.
US09894462B2
A business can register a finite state machine with a server. This finite state machine can express a tree structure of menus. The registration can cause the finite state machine to be mapped to the business's telephone number on the server. A mobile device can receive user input that manifests the intent to make a telephone call. In response to receiving the user input, the mobile device can determine that the telephone number that the user intends to call is mapped to a business's registered finite state machine on the server. The mobile device can then cause menus of selectable options, indicated in the business's registered finite state machine, to be displayed to the user in an interactive manner instead of placing the telephone call that the user intended to make.
US09894458B2
A base station may include logic configured to determine system throughput values for a plurality of modulation and coding schemes based on data throughput values and based on a number of user equipment (UE) devices serviced by the base station; determine a modulation and coding scheme, of the plurality of coding schemes, that is associated with a highest system throughput; and determine radio frequency (RF) conditions associated with the base station. The logic may further be configured to define a Multimedia Broadcast Multicast Service (MBMS) area based on the determined RF conditions and the selected modulation and coding scheme and provide an update to the UE devices serviced by the base station, wherein UE devices located within the defined MBMS area are sent the update using MBMS and UE devices located outside the defined MBMS area are sent the update using unicast.
US09894455B2
A sound processing device includes a shift detection unit that detects a shift of a listening point on which a user listens to a sound in a sound field space from a standard reference listening point, and a correction unit that corrects a sound signal based on first sound field correction data for correcting a sound field when the listening point is the standard reference listening point and second sound field correction data for correcting a sound field of the listening point when the listening point is shifted from the standard reference listening point.
US09894445B2
A hearing device comprises a receiver, an input buffer and a sample processor, the receiver being adapted to receive samples of a digital audio signal and feed received samples as a digital input signal to the input buffer, the sample processor being adapted to process the buffered samples to provide samples of a digital output signal such that the digital output signal is a sample-rate converted representation of the digital input signal with a predetermined target sample rate. The hearing device further comprises a latency controller adapted to estimate the quality of reception of the digital audio signal and to control the processing of the buffered samples in dependence on the estimated quality of reception.
US09894441B2
A method and an apparatus for customizing audio data processing are provided. The method includes receiving audio data through a wireless communication channel from an external device; decoding the received audio data; reducing noise of the decoded audio data; identifying hearing characteristics of a user by testing hearing abilities of the user at a plurality of frequency bands; adjusting a dynamic range of each of the plurality of frequency bands based on the hearing characteristics; processing the noise-reduced audio data based on the adjusted dynamic range of each of the plurality of frequency bands; and outputting the processed audio data.
US09894439B1
A computing device includes a first housing and a second housing attached by a hinge. The first housing includes a first microphone and the second housing includes a second microphone. After determining that an angle between the first and second housing has changed to a current angle, the computing device may determine a distance between the first microphone and the second microphone based on the current angle. A first audio signal from the first microphone and a second audio signal from the second microphone may each be modified (e.g., using a beamforming algorithm) to create first and second modified audio signals. The first and second modified audio signals may include less noise than the first and second audio signals. The first and second modified audio signals may be sent to an output jack or to an audio application.
US09894433B2
A speaker driver assembly for use in a speaker system is provided. The speaker driver assembly includes at least one centrally located high frequency sound driver and at least one mid-range frequency sound driver located to either side of the high frequency sound driver. A waveguide wall in the front of the speaker driver assembly directs the high frequency sound waves outwards from a centrally located opening. The waveguide wall has a plurality of small apertures in front of each mid-range frequency driver that are angled outwardly to allow mid-range sound waves to pass through the apertures while minimizing diffraction of high frequency sound waves passing by the apertures in order to generate a coherent sound wave front.
US09894429B2
An integrated loudspeaker assembly along with associated methods and systems for enhancing audio output from a consumer electronic device including such an integrated loudspeaker assembly are disclosed. More particularly an integrated loudspeaker assembly configured to utilize the enclosure of an associated consumer electronic device for back volume is disclosed. Methods and systems for optimizing the audio performance of a consumer electronic device with an integrated loudspeaker assembly are also disclosed.
US09894416B2
A video receiving apparatus includes a receiver, a first display, an extractor, an information forming controller, a number-of-viewer detector, a communicator, and a display controller, leading to appropriate display of configuration information and associated information of a video content. The extractor extracts a partial content from the video content. The information forming controller forms the configuration information from the partial content. The number-of-viewer detector detects the number of viewers present within a predetermined area. The communicator receives an identifier transmitted from a mobile terminal having a second display. The display controller can selectively display the configuration information on the second display of the mobile terminal identified by the identifier, and displays the configuration information on at least one of the first and second displays based on the number of the viewers and the number of the identifiers.
US09894409B2
A portable electronic device with a touch-sensitive display (such as a cellular telephone) provides a wireless remote control for an entertainment device (such as a consumer-electronic device). Based on device-state information that specifies a current state of the entertainment device (which is determined by an audio/video (A/V) hub that communicates with the entertainment device) and one or more related states of the entertainment device, the A/V hub may generate user-interface information that specifies a user interface that includes one or more virtual command icons. Note that the one or more related states are related to the current state in a state diagram by corresponding operations that transition the entertainment device from the current state to the one or more related states. Then, the A/V hub provides the user interface to the portable electronic device. In this way, the A/V hub device dynamically adapts the user interface.
US09894397B2
In one embodiment, a method includes (a) discerning whether an average packet delay in a media streaming session is increasing or decreasing over a first defined time window, (b) discerning whether an average jitter in the media streaming session is increasing or decreasing over a second defined time window, (c) in response to (a) and (b), calculating a specific bit-rate quantity corresponding to a change in bit-rate, and (d) controlling a bit-rate of the media streaming session in accordance with the specific bit-rate quantity.
US09894396B1
In one aspect, an example method includes (i) accessing a first set of ordered content items and a second set of active/inactive status attributes; (ii) identifying a subset of the first set based on each content item of the subset corresponding to an active status attribute in the second set; (iii) using the content items of the identified subset to generate a plurality of media items, each generated media item including the content items of the identified subset and being a respective type of media item; (iv) determining that a particular content item of the first set satisfies a condition, wherein the particular content item corresponds to a particular active/inactive status attribute of the second set; (v) based on the determination, modifying the particular active/inactive status attribute; and (vi) after modifying the particular active/inactive status attribute, repeating the identifying and using acts, thereby causing modification of the generated media items.
US09894388B2
The present invention discloses an inter-frame predictive coding method and a coder. Inter-frame predictive coding is sequentially performed on frames in multiple groups of pictures by using a group of pictures as a unit; a correlation between the reference B frame and a GPB frame in the same group of pictures is used; and when the maximum depth of the CTU in the same position in the GPB frame is smaller, a quantity of mode decisions performed on the CTU in the reference B frame may be relatively small, so that an objective of reducing complexity of an inter-frame predictive coding process of the reference B frame is achieved.
US09894383B2
Embodiments of the present invention re-use at least a portion of motion information of the corresponding block for the motion information of the current block if a corresponding reference picture corresponding to a reference picture pointed by the corresponding block is in a current reference picture list of the current block. If the corresponding reference picture is not in the current reference picture list of the current block, the motion information of the current block is determined using an alternative process, where at least a portion of the motion information, which was used in the previous case, is not re-used for the current block according to the alternative process.
US09894377B2
An interlayer video decoding method and apparatus and an interlayer video encoding method and apparatus are provided. The decoding method includes: reconstructing, based on encoding information obtained from a bitstream, a first layer image and a first layer depth map; determining whether a disparity vector is predictable using peripheral blocks of a second layer current block; and when the disparity vector is not predictable using the peripheral blocks, determining a disparity vector of the second layer current block using a default disparity vector and the reconstructed first layer depth map.
US09894374B2
A method for encoding high dynamic range (HDR) images involves providing a lower dynamic range (LDR) image, generating a prediction function for estimating the values for pixels in the HDR image based on the values of corresponding pixels in the LDR image, and obtaining a residual frame based on differences between the pixel values of the HDR image and estimated pixel values. The LDR image, prediction function and residual frame can all be encoded in data from which either the LDR image of HDR image can be recreated.
US09894369B2
An image decoding method supporting a plurality of layers according to the present invention may comprise the steps of: when an initial reference picture list of a current picture is configured, receiving flag information indicating whether reference picture set information of a reference layer to which the current picture refers is used; generating the initial reference picture list on the basis of the flag information; and predicting the current picture on the basis of the initial reference picture list. Accordingly, the present invention provides a method for generating a reference picture list including a picture of a layer, which is different from a layer to be currently encoded and decoded, and an apparatus using the same.
US09894368B2
A higher coding efficiency for coding a significance map indicating positions of significant transform coefficients within a transform coefficient block is achieved by the scan order by which the sequentially extracted syntax elements indicating, for associated positions within the transform coefficient block, as to whether at the respective position a significant or insignificant transform coefficient is situated, are sequentially associated to the positions of the transform coefficient block, among the positions of the transform coefficient block depends on the positions of the significant transform coefficients indicated by previously associated syntax elements. Alternatively, the first-type elements may be context-adaptively entropy decoded using contexts which are individually selected for each of the syntax elements dependent on a number of significant transform coefficients in a neighborhood of the respective syntax element, indicated as being significant by any of the preceding syntax elements.
US09894359B2
By either subsampling neighbor pixels and deriving an illumination variation parameter, or deriving one normalization shift value of two normalization shift values for normalizing parameters which are used when deriving the illumination variation parameter, with a dependency on the other normalization shift value, an amount of calculation for illumination compensation is reduced.
US09894355B2
The present technology relates to an image processing apparatus and method capable of preventing an increase in a cost of the apparatus.A setting unit sets restriction information for restricting a size of a block of an image and a prediction method to be applied to the block having the size. An inter-prediction unit generates a prediction image according to the restriction information. An encoder 1000 encodes the block using the prediction image and generates an encoded stream. Then, the encoder 1000 transmits the encoded stream and the restriction information. The present technology can be applied to a case of encoding/decoding an image, and the like.
US09894344B2
An example device includes first and second cameras and a touchscreen user interface configured to concurrently display first and second buttons and a real time image captured by the selected one of the cameras. The first button is operable for selecting between the first and second cameras, and the second button is operable for taking a picture using the selected one of the cameras.
US09894336B2
Monochromatic cameras and methods for using such cameras to obtain a still or video color image of an object or scene. The image sensor of such cameras is clear, without a color filter array. A diffused-dispersed and optionally randomized image of the object or scene obtained at the image sensor is processed directly into a number R
US09894334B2
An image processing circuit includes a front stage signal processing circuit that performs processing of input data and outputs the data and a rear stage signal processing circuit that performs processing which is to be performed on the data obtained after processing of the input data performed by the front stage signal processing circuit and outputs the data. The image processing circuit is configured to be switchable to one state of a first state that performs processing of the input data using the front stage signal processing circuit, subsequently performs processing of the data using the rear stage signal processing circuit, and outputs the data, a second state that performs processing of the input data using the front stage signal processing circuit and outputs the data, and a third state that performs processing of the input data using the rear stage signal processing circuit and outputs the data.
US09894332B2
A projection system includes an invisible light projector, an imaging unit, an image generator, and a visible light projector. The invisible light projector projects a predetermined invisible light image onto the object via invisible light. The imaging unit captures an image of the invisible light projected from the invisible light projector. The image generator measures a shape of the object based on the image captured by the imaging unit to generate image data showing image content for projection onto the object in accordance with the measured shape. The visible light projector projects the image content shown by the image data onto the object via visible light. The invisible light projector emits pulsed invisible light to project the measurement pattern. The image generator generates the image data based on an image captured in accordance with a timing for the pulsed light emission.
US09894331B2
A projector device and a heat dissipation system thereof are provided. The heat dissipation system includes a heat dissipating target chip and a heat dissipating module. The heat dissipating target chip has a bottom surface having a heat dissipating area. The heat dissipating module has a heat dissipating body and a heat passage. The heat dissipating body includes a connection end facing the bottom surface, and the heat passage extends out from the connection end and is heat exchange connected to the heat dissipating area. The heat passage has a first cross-section and a second cross-section, wherein the second cross-section is farther away to the heat dissipating area than the first cross-section. The second cross-section area is larger than the first cross-section area.
US09894328B2
A device for communicating including a housing including a camera, a microphone, a speaker, a button, a battery, a sensor, non-volatile memory, a processor, and a wireless communications module, wherein the non-volatile memory stores code operable by the processor for switching the processor from low-power mode to active mode in response to an activation trigger, receiving, from the one of the microphone and the camera, outbound audio and video signals, then sending a signal to a server via the wireless communications module during active mode, the signal including one or more of an alert signal, a signal based on the outbound audio signal, and a signal based on the outbound video signal, receiving from the server an inbound audio signal and outputting a signal based on the inbound audio signal via the speaker, and switching the processor from active mode to low-power mode in response to a deactivation trigger.
US09894324B2
A method and a system for using compression sensing to provide low data rate transmission and low computational complexity to determine anomalies in video data obtained by a video camera or other motion detection device. The video data is divided into varying sized video blocks based on an anticipated size of objects of interest within the video, and based on a distance between a video camera and the objects of interest. Features are extracted from the video data of each block to detect anomalies if a feature vector is outside of an “allowed range.” By utilizing varying sized video blocks, anomalies are more effectively and efficiently detected in the video data.
US09894319B2
A video communication apparatus is described, which includes a receiver for receiving video data from an internet telephony service over a communication channel, a display screen for playing the received video data received by the receiver, a wireless module for communication with a handset, and a processor configured to coordinate playing of the received video data on the display screen in synchronization with playing, by the handset, of audio data received by the handset from the internet telephony service. A handset is also described, which includes a receiver to receive audio data from an internet telephony service over a communication channel, an audio output to play the received audio data received by the receiver, a wireless module to communicate with a display device, and a processor. The processor can synchronize, using the wireless module, play of the received audio data on the audio output with display, by the display device, of video data received by the display device from the internet telephony service.
US09894318B1
Method for output control of videos from multiple available sources and user terminal using the same
A method for control of video output applied to multiple available video sources, the method being executed by a user terminal having a touch-sensitive display which comprises a plurality of sub-regions for displaying contents from multi-channel video sources. The sub-regions comprise at least a first sub-region and a second sub-region. A touch operation on the touch-sensitive display is detected and includes a sliding operation. Contents of the first sub-region and contents of the second sub-region are exchanged according to start position and end position of the sliding operation. Users are able to control the output layouts of the contents from the multi-channel video sources by operating the user terminal according to individual needs.
US09894309B2
A ramp signal generator may include a reference current generation unit suitable for generating a reference current based on a gain; a ramp signal generation unit suitable for generating a ramp signal according to the reference current; a replica current supply unit suitable for supplying a replica current using the reference current generation unit; and an offset compensation unit suitable for compensating for an offset of the ramp signal generated by the ramp signal generation unit using the replica current.
US09894308B2
Provided is an imaging apparatus, including: a vertical scanning circuit configured to output the reset signal and the image signal sequentially from each of a plurality of pixels by selecting the plurality of pixels sequentially; and an amplifier unit configured to output a plurality of image signals obtained by amplifying one image signal that is output from one of the plurality of pixels at a plurality of gains including a first gain and a second gain, in which, in a reading period, which is a period between selection of a first pixel by the vertical scanning circuit out of the plurality of pixels and subsequent selection of a second pixel out of the plurality of pixels, a number of times the amplifier unit is reset is less than a number of the plurality of amplified image signals.
US09894303B2
An imaging device includes: a first unit pixel cell including a first electrode, a second electrode facing the first electrode, a first photoelectric conversion layer between the first electrode and the second electrode, the first photoelectric conversion layer generating first signal charge, and a first signal detection circuit connected to the first electrode, the first signal detection circuit detecting the first signal charge; and a voltage supply circuit. The voltage supply circuit supplies a first voltage to the second electrode during a first period when the first unit pixel cell accumulates the first signal charge. The voltage supply circuit supplies a second voltage to at least one of the first electrode and the second electrode during a second period other than the first period, the second period including a first moment at which a difference in potential between the first electrode and the second electrode is zero.
US09894297B2
An imaging device includes a pixel cell including: a first photoelectric converter that generates a first electrical signal; and a first signal detection circuit that detects the first electrical signal. The first signal detection circuit includes: a first transistor one of a source and a drain of which is electrically connected to the first photoelectric converter; a first capacitor having first and second ends, the first end being electrically connected to the other of the source and the drain of the first transistor, a reference voltage being applied to the second end; and a second transistor having a gate electrically connected to the first photoelectric converter. The pixel cell outputs, in one frame period, a first image signal and a second image signal in sequence, the first image signal being output when the first transistor is off, the second image signal being output when the first transistor is on.
US09894296B1
A method of processing an image includes receiving pixel data from a pixel array, the pixel data including a plurality of linear pixel responses from a corresponding plurality of linear pixel circuits of the pixel array and a plurality of logarithmic pixel responses from a corresponding plurality of logarithmic pixel circuits; determining whether a linear or logarithmic pixel response is clipped; calculating a plurality of directionally-interpolated output pixel values for corresponding ones of the plurality of linear pixel circuits and the plurality of logarithmic pixel circuits; in a case where the linear or logarithmic pixel response is clipped, using a corresponding directionally—interpolated output pixel value as an output pixel value; in a case where the linear or logarithmic pixel response is not clipped, using the linear pixel response or the logarithmic pixel response as the output pixel value; and constructing an output image using a plurality of the output pixel values.
US09894280B2
A display control apparatus includes a display control unit configured to control a display unit to display a main region where an image is displayed and a sub region where a list of object regions in the image is displayed, the sub region being smaller than the main region, and a selection unit configured to receive a selection instruction to select one of the object regions from the list of object regions displayed in the sub region. The display control unit is configured to control the display unit to display an image focused on an object region selected according to the selection instruction received by the selection unit.
US09894279B2
A handheld triaxial holder with a control stick comprises a handheld part, a fixing device, three motors orthogonally arranged in space, a control stick which is attached to the handheld part and provided with a navigation key of the control stick and a function button. The motor is provided with a slip ring inside its hollow bearing, so that the control line passing through it would not rotate along with it and three motors may freely rotate 360 degrees. The handheld triaxial holder with a control stick has a small size to carry, and is applicable for small shooting equipment. The motors are capable of rotating 360 degrees and facilitate multi-angle shooting. The handheld triaxial holder is provided with a control stick for controlling its rotation movement, and has a good effect on quickly stabilizing shooting equipment during moving shooting. It may also output videos and charge the shooting equipment.
US09894277B2
An imaging device sets a first area and a second area other than the first area on a captured image; sets a main subject based on the captured image or another image; periodically detects the position of the main subject on the captured image; and performs control depending on a detection result so that it is indicated that the main subject exists only in the first area when the main subject does not exist in the second area, and it is indicated that the main subject does not exist only in the first area when the main subject exists in the second area.
US09894270B2
An image processing apparatus is configured to capture an object image, generate a RAW image, perform simple development on the RAW image during the image capturing operation, and store not only the developed image but also the RAW image. In a predetermined interval, in an idle state, or in predetermined enlargement processing, the image processing apparatus reads a RAW file stored in a storage medium and performs high-quality image development to generate an image having higher image quality than that obtained by the simple development. If development processing has been completed by a high-quality image development unit, the image processing apparatus replaces the image obtained by the simple development with the image obtained by the high-quality image development and reproduces the image obtained by the high-quality image development.
US09894265B1
A portable electronic device includes an input device, an input device housing, a display, and a display housing coupled to the input device housing. The display housing is moveable relative to the i housing by sliding between an extended position in which the input device is exposed and a contracted position in which the input device is covered by the display housing. The portable electronic device also includes a digital camera housed by the display housing. The input device housing includes an auxiliary camera lens fixed to a body such that the auxiliary camera lens is aligned with the digital camera for obtaining digital images utilizing the auxiliary camera lens when the display housing is in the contracted position, and the auxiliary camera lens is out of alignment with the digital camera for obtaining digital images without the auxiliary camera lens when the display housing is in the extended position.
US09894262B2
There is provided a display control apparatus including: a display control unit configured to cause a display apparatus to display a live preview image generated based on image data obtained through an image sensor, and one or more processed images generated using respective image processing conditions based on one of the image data which has been obtained at some time point; and a determination unit configured to determine whether or not a predetermined user operation has been recognized. If it is determined that the predetermined user operation has been recognized, the display control unit updates the one or more processed images to be displayed.
US09894260B2
A method for controlling intelligent equipment includes receiving an image acquisition request sent from an intelligent mattress. The image acquisition request contains an identifier (ID) of the intelligent mattress and is triggered when a user uses the intelligent mattress. The method further includes sending the image acquisition request to an intelligent photographing device associated with the intelligent mattress based on the ID of the intelligent mattress, receiving eyeball information of the user and device identification information, determining a target intelligent device based on the device identification information, and controlling the target intelligent device based on the eyeball information.
US09894252B2
An image processing apparatus capable of generating a plurality of output images having different focus positions by reconstructing an input image, includes a storage unit storing image pickup condition information, and an image processing unit generating the output image from the input image using the image pickup condition information, and the image processing unit obtains the input image that is information of an object space viewed from a plurality of viewpoints that is obtained via an imaging optical system and an image pickup element having a plurality of pixels, calculates an average pixel value of a pixel group of the input image of the same region, and substitutes each pixel value of the pixel group by the average pixel value, and performs combination such that the pixels substituted by the average pixel value are shifted from each other to generate the output image.
US09894251B2
A control of gobos defend by records in the gobo. The gobos are formed by menued shapes.
US09894250B2
A unit acquires first image data expressing a color of an image and second image data expressing a feature of the image. A unit color-separates the first image data into first and second color material amount data. A unit generates inverted data by inverting the second image data. A unit generates first corrected data from the first color material amount data and the inverted data and generates second corrected data from the second color material amount data and the second image data. A unit generates, based on the first corrected data, first data indicating on dot printing positions during a printing and scanning operation, generates, based on the second corrected data, second data indicating on dot printing positions in the operation, and generates, based on the first and second data, image forming data.
US09894248B2
A control apparatus includes a control unit, and a raster-image processor that performs color correction to correct colors of a user printing device into colors of a standard printing device by using a multidimensional LUT and performs color conversion by using a printer profile for the standard printing device and a target profile. The control unit creates the multidimensional LUT including a first LUT and a second LUT, and compares chromas of each fully saturated secondary color of the user printing device, the standard printing device and the target colors. On judging that the chroma of one fully saturated secondary color of the user printing device is greater than that of the standard printing device, the control unit instructs the raster-image processor to perform the color correction while specifying use of the first or second LUT according to a comparison result of the chromas.
US09894247B2
An image forming apparatus is provided, in which the image forming apparatus includes a user database in which user identification information for identifying an user of the image forming apparatus is registered, an operation panel for receiving a key operation input, a secure program used for determining whether a user service can be provided on the basis of the user identification information in the user database and another user identification information input by the user.
US09894241B2
A printing apparatus including a USB interface displays a selection screen for a user to select an OS type of an information processing apparatus that communicates via the USB interface when the printing apparatus starts up. The printing apparatus determines a configuration of the USB interface based on the OS type selected on the selection screen.
US09894234B2
A driving device is used in an image reading apparatus, and reciprocates a scanning unit for reading an image on an original. The driving device comprises a pull member, a driving pulley which transmits driving force to the pull member, a following pulley which applies tension to the pull member and a pulley holder having a pulley axis which holds the following pulley rotatably. Then, the pulley axis has a lock pawl capable of locking an upper end portion of the following pulley and canceling engagement with the following pulley by being tilted toward a side of an axial center by elastic deformation. Furthermore, the lock pawl is arranged at a side of a tension acting direction from the pull member to the following pulley except the farthest position from the driving pulley among positions in a circumferential direction of the pulley axis. It is possible to attach and detach the following pulley easily at a time of maintenance or the like.
US09894231B2
Provided is an image-forming device that improves convenience for a user. The image-forming device includes a plurality of power-supply stages, remaining paper amount detection sensors, and a system control unit. A remaining paper amount detection sensor detects the remaining paper amount in a paper-supply stage. When the remaining paper amount that is detected by the remaining paper amount detection sensor is less than a fixed value, the system control unit sets the paper-supply stage having a paper amount that is less than the fixed value as a FAX use only paper-supply stage.
US09894226B2
Information processing apparatus, setting condition specification method for image forming apparatus
An information processing apparatus can be worn by a user of an image forming apparatus, and includes a camera, a visual line detecting portion, a target image recognizing portion, a positional condition determining portion, and a wireless communication portion. The target image recognizing portion, when a positional condition among setting conditions for image-formation-related processes is specified, recognizes an image of a specification target that is included in a visual field image photographed by the camera, the specification target being a target of specification of the positional condition. The positional condition determining portion determines a specified positional condition based on a position in the image of the specification target recognized by the target image recognizing portion, the position corresponding to the visual line direction detected by the visual line detecting portion. The wireless communication portion wirelessly transmits information of the specified positional condition to the image forming apparatus.
US09894223B2
A server system includes: a reception section that receives captured image information and metadata from a terminal device connected to the server system through a network, the captured image information being information about a captured image captured using the terminal device, and the metadata being added to the captured image; an insertion image selection section that selects an insertion image based on the received metadata, the insertion image being an image differing from the acquired captured image; and an image set generation section that generates image set information in which the insertion image is inserted into the captured image information.
US09894219B2
A maintenance system includes an image forming apparatus that performs image formation by a setting depending on the replacement part using a replaceably configured replacement part and a portable terminal that performs near field communication with the portable terminal. The portable terminal includes an image reading part that reads part information of the replacement part from a printed part affixed to the replacement part and a near filed communication part that transmits the part information read by the image reading part via the near filed communication. The image forming apparatus includes a non-contact IC tag in which the part information is written based on power generated from the near filed communication and an reflection processing part that reads the part information from the IC tag at the time of power on and reflects the part information in the setting.
US09894217B2
An image forming apparatus including a plurality of processing units capable of performing different support processing for a user asking for support, and a remote support apparatus operated by an operator are connected via a communication path. The remote support apparatus transmits to the image forming apparatus a request to perform the support using the selected processing unit, or a request to switch the processing unit to a selected specific processing unit and a request to perform the support. The image forming apparatus allows the processing unit which follows the request to perform the support, to perform the support, and switches the processing unit according to the request to switch the processing unit to allow the switched processing unit to perform the support. Further, the image forming apparatus returns a result which should be returned, among results of the performed support, to the remote support apparatus.
US09894215B1
A method may include determining a number of user devices that can access data services in a wireless network and storing information identifying the determined number of user devices for each of a number of sectors for each of a number of periods of time. The method may also include receiving a request from a first user device associated with a first user for access to data services during a first period of time, accessing the stored information to determine whether to grant the request and providing access to data services via the wireless network to the first user device. The method may further include excluding data usage by the first user device during the first period of time from being applied against a data limit associated with the user's data plan.
US09894214B2
The present invention discloses a method and an apparatus for enabling subscriber lines to join a DSL vectoring system the DSL vectoring system and can shorten overall joining time of subscriber lines in a DSL system. The method includes grouping subscriber lines into at least two groups according to time when the subscriber lines request to go online, where the at least two groups of subscriber lines that are obtained after the grouping include a first group of subscriber lines and a second group of subscriber lines; starting a joining process for all the subscriber lines in the first group of subscriber lines; and during the joining process of the first group of subscriber lines, putting all the subscriber lines in the second group of subscriber lines into a joining process.
US09894206B2
Contact centers comprise agents, human and automated, interacting with customers over a network to accomplish an objective for the interaction. While a blunt, factual exchange may appear to be the most expeditious means to accomplish the objective, often this is not the case. Humans often respond better when the interaction comprises a mix of progress (e.g., portions of the interaction directed towards the objective) and banter (e.g., portions of the interaction not directed to the progress). Determining the mix may be provided by analyzing historic interactions and their success. A current interaction may be analyzed and when the mix is outside an acceptable range and an automated agent may be configured to alter the mix accordingly or, when the agent is a human, signal the agent to make the alteration. Success may be continually monitored and the target mix adjusted based on subsequent interactions.
US09894205B1
An agent's performance is measured using a predictive model calculating an expected probability of success for each outbound communication, such as a call, handled by the agent that has reached the desired (“right”) party. An agent's cumulative actual performance value is maintained based on each “successful” contact, as indicated by a disposition code provided by the agent. A cumulative expected probability value of a “successful” communication is also maintained based on each call that reaches the right party where the expected probability of a “successful” call is determined by the predictive model. The agent's performance value can be determined by comparing the cumulative actual performance value with the cumulative expected probability of success value. The agent's performance value can then be compared to the performance value of other agents to identify agents performing above-expectations or below-expectations.
US09894200B2
A method and an apparatus for dialing a phone number, where the method for dialing the phone number includes obtaining, by a communications terminal from a number record of a called party, root-level number information of the called party, number information of sub-levels 1 to j, and a relationship between the root-level number information and the number information of sub-levels 1 to j, calling the called party for the second time according to the root-level number information, and sending, according to a relationship between the root-level number information and sub-level i number information, the sub-level i number information corresponding to an ith input prompt of the called party after the second call succeeds, where i≧1 and i≦j. Therefore, information can be automatically entered to the called party according to an input prompt of the called party.
US09894192B2
A protective case is configured to receive a mobile device and to magnetically attach to another article and includes a front face mechanically connected to a plurality of side faces (the front face and side faces for detachably connecting to a mobile device), and a back face comprising at least one magnet for magnetically coupling an article comprising at least one magnet to said protective case.
US09894191B2
A mobile terminal comprises: a case having an electric mounting portion with electronic components installed therein and having an ear jack holder part on the outer surface thereof; and ear jack connected to the ear jack holder part and having a plug hole into which a connecting plug is inserted; a plurality of first terminals equipped inside the plug hole; a second terminal connected to the first terminal and exposed to the outside of the ear jack; an antenna carrier connected to the back side of the case and having an antenna pattern formed on the surface thereof; and an ear jack electrode pattern formed in the antenna carrier, one end thereof being connected to the second terminal, wherein the mobile terminal has an ear jack structure outside the case, and thereby can prevent water from flowing into the mobile terminal through the ear jack.
US09894186B2
A first Core Network (CN) node (e.g., Gateway GPRS Support Node), a second CN node (e.g., Serving GPRS Support Node) and a wireless access node (e.g., Base Station Subsystem) are described herein that are configured to efficiently deliver a network triggered report notification to a wireless device (e.g., Internet of Things device).
US09894180B2
A device is provided that is connected with a content centric network. The device includes a request reception unit that receives a request packet that requests data that are generated by the device. The device also includes a data transmission unit that transmits the requested data to a CCN network in a case where the data that are requested by the request packet, which is received by the request reception unit, are present in the device. The device further includes a negative acknowledgement unit that transmits a packet that indicates a negative acknowledgement, which includes information about a generation time as a time when the requested data are generated to the CCN network, in a case where the data that are requested by the request packet that is received by the request reception unit are absent in the device.
US09894176B2
A multi-source peer content distribution system transfers content files from multiple, distributed peer computers to any requesting computer. The content distribution network coordinates file transfers through a mediation system including a content catalog and a host broker system. The content catalog contains an identification of each content file, the segmented subunits of each file, and the peer caches to which the subunits have been distributed. The host broker system receives content file requests issued over a network from requesting computers. In response, manifest files identifying the request corresponding content subunits and distributed cache locations are returned. The requesting computers can then retrieve and assemble the corresponding content subunits from the peer computers to obtain the requested content file.
US09894173B2
A computer implemented method determines validity of web-based interactions. Web-based interaction data relating to a web-based interaction may be accessed. The web-based interaction data may include aggregate measure data that may include a number of unique queries per web-based session. The validity of the web-based interaction may be determined based on the aggregate measure data.
US09894169B2
A method and system for generating contextual activity streams are provided. The method comprises receiving unstructured data collected by an agent operable on a client node from a plurality of data sources, wherein the collected unstructured data is of a user of the client node; analyzing the collected unstructured data to identify at least one tag in the collected unstructured data; determining a context of the collected unstructured data based in part on the at least one identified tag; creating a contextual activity stream; inserting contextual data items gathered from a plurality of social networks into the created contextual activity stream, wherein the contextual data items are data items shared by connections of the user and have a substantially similar context to the determined context; and causing a display of contextual data items in the contextual activity stream over the client node.
US09894166B2
A registration method and system for a common service entity (CSE) relate to the field of machine type communication; solve the problem that a CSE registration mechanism cannot implement an application interactive function. The method includes: an originator CSE sending a CSE resource creation request message to a receiver CSE; the receiver CSE detecting whether a resource corresponding to an identifier of the originator CSE exists in local; the receiver CSE creating a resource for the originator CSE when no resource corresponding to the identifier of the originator CSE exists in local, setting a resource name according to the identifier of the originator CSE, and saving a type of the originator CSE as an attribute, and generating a CSE resource creation response message indicating that the resource creation is successful; the receiver CSE sending the CSE resource creation response message to the originator CSE.
US09894165B2
Exemplary methods for distributed multi-component service placement in a resource pool include utilizing a hierarchy of agents associated with computing resources of a cloud architecture. A root agent in the hierarchy can receive service requests specifying resource requirements and optionally location or affinity constraints, transform these into service request descriptions, and pass the service request descriptions down through the hierarchy to arrive at leaf nodes. The leaf nodes can each, perhaps in parallel, generate solution encodings indicating possible placements of some or all of the components of the service request that one or more computing devices associated with each agent can locally provide while still satisfying the resource requirements. The generated solution encodings can be passed back up and be consolidated as they flow through the hierarchy, allowing the root agent to quickly and accurately determine whether the service request may be fulfilled, and optionally place the service.
US09894164B2
An computing system includes: a communication unit configured to receive a discovery request, including a client presence factor, having a scan pattern for discovering a target device; a control unit, coupled to the communication unit, configured to: determine a target device coordinate based on the discovery request for identifying a client device relative to the target device, determine a device connectivity based on the target device coordinate, the client presence factor, or a combination thereof for establishing a backhaul communication between the client device and the target device, and a user interface, coupled to the control unit, configured to present a device information based on a trust level for displaying the device information of the client device having the device connectivity of connected with the target device.
US09894159B2
A network device receives a definition for a data product of consumer Internet-of-Things (IoT) data and registers multiple machine-type communications (MTC)-devices for collection of consumer IoT data. The MTC devices provide the consumer IoT data with heterogeneous formats. The registering identifies a profile for each MTC device and particular data types authorized for collection. The network device receives consumer IoT data generated by the multiple MTC devices and extracts the particular data types from the IoT data. The network device normalizes the extracted data to include a uniform data format, and aggregates the normalized IOT data into clusters that exclude device identifiers. The network device constructs the clusters into a data portfolio that meets the definition for the data product.
US09894158B2
Techniques for autonomously establishing, maintaining, and repairing of a wireless communication network among multiple autonomous mobile nodes (AMN) are provided. The multiple AMNs are flown towards a first node. A tentacle is established with the first node and extended to cover a second node over a distance, thereby establishing a wireless communication network between the first node and the second node via the multiple AMNs. Any damage to the established wireless communication network or tentacle may be autonomously detected and repaired by using spare AMNs. Further, the communication network may be used to enable autonomous detection, tracking of the second node, as well as autonomous detection of a contamination area, based on data received from one or more sensors onboard the AMNs deployed in the air.
US09894148B2
In one embodiment, a system comprises a client interface configured to receive an application and a parameter associated with the application, a vendor interface configured to receive vendor-specific information from vendor-specific computing environments, and an environment analyzer configured to determine a first vendor-specific computing environment from the vendor-specific computing environments for hosting the application based on the application parameter. The client interface is further configured to communicate a request for approval to host the application in the first vendor-specific computing environment and receive an indication to not host the application using the first vendor-specific computing environment. The environment analyzer is further configured to, in response to receiving the indication to not host the application using the first vendor-specific computing environment, determine a second vendor-specific computing environment from the vendor-specific computing environments for hosting the application.
US09894143B1
Methods and systems for implementing a pre-processing and processing pipeline for a queue client are disclosed. A queue client receives, from a queue service, data indicative of an estimated time to process a first message in a queue. The queue client initiates processing of the first message. The queue client receives, from the queue service, data indicative of an estimated time to pre-process a second message in the queue. The queue client initiates pre-processing of the second message during the processing of the first message. The pre-processing of the second message is scheduled based on the estimated time to process the first message and the estimated time to pre-process the second message.
US09894141B2
Secure and remote operation of a remote computer from a local computer over a network includes authenticating a remote computer for connection to a computer over the network and/or a local computer for connection to a remote computer over the network; establishing a secure connection therebetween; and integrating a desktop of a remote computer on a display of a local computer. Functions that are performed may include one or more of: integrating a file structure of accessible files accessed at the second or first computer, into a file structure contained at the first or second computer, respectively; at least one of integrating a desktop of the second computer on a display of the first computer and integrating a desktop of the first computer on a display of the second computer; and directly operating the second computer from the first computer or the first computer from the second computer.
US09894140B2
A method and system for managing download of a file. In response to a request from a client computer to establish a session to download the file beginning at a specified location after a start of the file, an estimated length of a portion of the file beginning at the specified location is estimated, a time window for enabling the client computer to avoid a redundant download of a portion of the file by terminating the session within the time window is computed, and the download of the file is suspended for the time window. If the session is not terminated within the time window, then download of the file is automatically resumed following the length in further response to the request. If the session is terminated within the time window, then download of the file is not automatically resumed following the length in further response to the request.
US09894133B2
Provided is a method for identifying and controlling traffic in a wireless communication system. The method includes receiving, by a gateway, a rule corresponding to a determined policy and packet filter information from a policy server upon receiving an Internet Protocol (IP) session establishment request from a User Equipment (UE); installing a packet filter according to the received packet filter information; and after a Transmission Control Protocol (TCP) session is established between the UE and a content server, identifying traffic using the packet filter and transmitting the identified traffic to a Radio Access Network (RAN) to schedule packet responsive to a Hyper Text Transfer Protocol (HTTP) request being from the UE after a Transmission Control Protocol (TCP) session is established between the UE and a content server.
US09894128B2
The disclosure is related to selective transcoding performed between a calling party and a called party. Such transcoding method may include receiving a call connection request message from a calling user equipment, determining whether transcoding is required for communication between the calling user equipment and a called user equipment based on the received call connection request message, and initiating the transcoding when the transcoding is determined as required.
US09894123B2
A method for sharing a control right and a host device are provided. The method of sharing the control right is adapted to the host device of an interactive whiteboard system. The method includes the following steps. A scanning process is executed to receive an online notification signal broadcast by a first client device, wherein the online notification signal includes a weight value and device information of the first client device; it is determined whether the control right of the interactive whiteboard system is released or not, and when the control right of the interactive whiteboard system is not released, it is determined whether to share the control right of the interactive whiteboard system to the first client device according to the weight value. When the control right is determined to be shared to the first client device, a control right notification signal is transmitted to the first client device.
US09894118B2
Access to a user profile of a user device at a location may be provided to a destination device upon detecting that the location is within a proximity of a destination location. An expiring token may be generated, associated with the user profile, and communicated to the second device. Access to the user profile provided to the destination device may be terminated upon an expiration of the expiring token.
US09894114B2
A method, system and computer program product for adjusting a display of social media updates to varying degrees of richness. A level of importance for each social media update is identified and assigned to the update. The importance of the social media update can be defined by various aspects, such as topics or people of interest to the user. Furthermore, a current condition of a user's environment (e.g., current workload of the user) is determined. The social media updates are then displayed in a social networking feed with a particular degree of richness at a particular location based on the level of importance of the social media updates, the current condition of the user's environment, and/or the user's interactions with existing updates currently displayed. In this manner, the amount of time required by the user to determine which updates are important to the user is reduced.
US09894113B2
A method for suggesting applications applied by a terminal compatible with its operating system, is disclosed. One aspect of the method includes receiving a link for accessing the downloading of the application and restoring a message suggesting to the user the downloading; The method further includes determining at least one data structure including identifiers; selecting at least one identifier; generating from the identifier a domain name including an indication of the operating system; and sending the domain name to a server capable of providing a corresponding link for accessing the domain name. Lastly, the access link is received in response to said sending step. A system and device for implementing the method are also disclosed.
US09894107B2
A control module arranged to manage a hosted communications platform, the hosted communications platform being located between a telecommunications network and a subscriber communications network, the subscriber communications network being associated with a subscriber to the hosted communications platform, the subscriber being associated with a plurality of users. The module comprises a first communications interface arranged to interface with the telecommunications network, and processing means arranged to configure the hosted communications platform for use with two or more subscribers, each subscriber comprising a respective subscriber communications network. The module further comprises a second communications interface arranged to interface with the hosted communications platform. For each subscriber, the processing means is arranged to form a partition on the hosted communications platform.
US09894094B2
The present disclosure discloses a method, server, and system for automatically rating the reputation of a web site, wherein the method comprises: when a web address of the web site is triggered and intercepted, detecting whether the web address of the web site is a malicious web address or a non-malicious web address; making statistics of the number of malicious and non-malicious visits to the web addresses under the web site during a predefined time period and saving the statistics to a database; and reading records from the database and calculating an average reputation of the web site by weighting the statistics of visiting the web site during the predefined time period and history statistics. The present disclosure is able to mark the reputation of a web site in time and efficiently, thus improving the security of using the network.
US09894081B2
A method and device for avoiding manipulation of a data transmission. A message containing a message authentication code is received at a processing unit, the message from the processing unit is transferred to a hardware module, a check value as a function of the received message is computed in the hardware module, the received message authentication code and the check value are compared in the hardware module, a result of the comparison is transferred from the hardware module to the processing unit as an output variable, the message authentication code received in the message from the processing unit is checked in the processing unit based on the output variable.
US09894079B2
System calls to a kernel of a mobile computing device are monitored. A particular system call is intercepted relating to input/output (I/O) functionality of the mobile computing device. A data loss prevention (DLP) policy is identified that is applicable to the particular system call. An action is performed on the particular system call based at least in part on the DLP policy.
US09894076B2
In an approach to data protection and sharing, a computer retrieves social network data of a first user, and obtains a relationship grade between the first user and a second user, and a level associated with the personal data of the first user. Then it is determined whether the second user qualifies to access the personal data of the first user, based, at least in part, on the relationship grade and the level associated with the personal data. If it is determined that the second user qualifies to access the personal data of the first user, the second user is permitted to access the personal data.
US09894069B2
Secret application and maintenance policy data is generated for different classes of data. The class of data to be protected is determined and the secret application and maintenance policy data for the determined class of the data to be protected is identified and obtained. Required secrets data representing one or more secrets to be applied to the data to be protected is obtained and then automatically scheduled for application to the data to be protected in accordance with the secret application and maintenance policy data for the determined class of the data to be protected. Maintenance of the one or more secrets is also automatically scheduled in accordance with the secret application and maintenance policy data for the determined class of the data to be protected.
US09894065B2
The present invention relates to a security management method and an apparatus for group communication when a terminal interacts and communicates with a mobile communication system. The security management method for group communication performed in a server, which manages the group communication in the mobile communication system according to one embodiment of the present invention, includes the steps of: generating a session security key for session protection in the group communication, and mapping the session security key to a group identifier for identifying a specific group to which a terminal using the group communication belongs; transmitting the group identifier and the session security key to the terminal; and generating a traffic key for protecting traffic and transmitting the group identifier and the traffic key to the terminal.
US09894053B2
Embodiments of the present application relate to a method, a system, and a computer program product for authenticating a service. A method for authenticating a service is provided. The method includes receiving a first service request from a first terminal, generating a first link address that is used to link to an access location based on the received first service request, determining a preset terminal identifier corresponding to a second terminal, the preset terminal identifier being a terminal identifier preset by the user, sending the first link address to the second terminal, receiving a first link request, determining an issued terminal identifier based on the first link request, comparing the determined issued terminal identifier with the preset terminal identifier of the second terminal, and performing a next processing operation on the first service request based on the comparison result.
US09894052B2
A method and apparatus for location authentication of the user are disclosed. In the method and apparatus, the location of the user is authenticated if one or more conditions for geographic proximity associated with two or more devices of the user are satisfied. Upon the location of the user being authenticated, the user may be granted access to a service.
US09894048B2
Communications methods and appliances are described. According to one embodiment, a communications method includes prior to deployment of an appliance, establishing a trusted association between the appliance and a certificate authority, during deployment of the appliance, associating the appliance with a communications address of a communications medium, using the certificate authority, creating a signed certificate including the communications address of the appliance, announcing the signed certificate using the appliance, after the announcing, extracting the communications address of the appliance from the signed certificate, and after the extracting, verifying the communications address of the appliance.
US09894046B2
A method of operating a server comprises receiving an authorization request comprising a password, accessing an expiry date for the password, transmitting a response comprising the expiry date, ascertaining whether the password has expired, and receiving a new password, if the password has expired. Optionally, the transmitted response further comprises a date representing the last use of the password and/or an integer value representing a retry parameter.
US09894038B2
A system includes a firewall, a first server located behind the firewall, and a second server located before the firewall. The second server is configured to receive a request for data, select an item code from a code database corresponding to the requested data, and transmit the item code to the first server, wherein the item code comprises a coded number representing an item in a secure database. The first server is configured to receive the item code from the second server and, if the item code corresponds to one of a plurality of codes of a code database maintained by the first server, send the data to the second server.
US09894037B2
A method and a network device are provided to transmit network packets through a network security device. The method, performed by the network device, receives a request to send a network packet from a first computing device to a second computing device over a network that includes the network device and the network security device. The network packet includes a first network interface identifier for identifying the first computing device and a second network interface identifier for identifying the second computing device. The method identifies third and fourth network interface identifiers that cause the network packet to be transmitted through the network security device. The method transmits the network packet over the network through the network security device using the third and fourth network interface identifiers. The method transmits the network packet to the second computing device using the first and second network interface identifiers.
US09894035B2
The present disclosure is directed to providing a network user the ability to travel between different zones or locations within a network environment, such as, for example, a hospitality location, without requiring a user to re-login to the new location, while requiring a user to re-login to other locations within the network environment.
US09894031B2
A method is provided in one example embodiment and includes detecting by a first network element at a first data center site a local connection of an endpoint identifier (“EID”), in which the EID was previously locally connected to a second network element at a second data center site and notifying a mapping server of the local connection of the EID to the first network element. The method further includes receiving from the mapping server identifying information for the second network element and communicating with the second network element using the identifying information to obtain service information for traffic associated with the EID. The method may also include applying a service identified by the service information to outgoing traffic from the EID as well as applying a service identified by the service information to incoming traffic for the EID.
US09894030B2
A method, device, computer storage medium, and apparatus for providing candidate words. The method comprises steps of: detecting user input; determining whether the current application environment is an information exchange application if user input is detected; determining an identifier of the communication counterpart in communication with the user if it is determined that the current application environment is an information exchange application; determining, based on the determined identifier of the communication counterpart, the social relationship between the user and the communication counterpart according to a social relationship automatic determination model, which is a model for determining the social relationship between the user and the communication counterpart; determining, based on a social relationship correction mapping table, whether the user input matches the determined social relationship, wherein the social relationship correction mapping table provides, based on the determined social relationship, correction candidate words corresponding to the social relationship; providing, based on the social relationship correction mapping table, correction candidates the determined social relationship if it is determined that the user input does not match the social relationship.
US09894029B1
A system, method, and computer-readable medium for identifying relevant content from a messaging platform. The method can include: identifying a context account; identifying a set of initial accounts of the messaging platform; selecting a set of relevant accounts from among the set of initial accounts; selecting a set of messages authored by the set of relevant accounts based at least on a recency of each of the set of messages; and providing the set of messages in response to a request.
US09894019B2
Methods, systems, and apparatuses, including computer programs encoded on computer-readable media, for receiving from responders conversation selection criteria and mode of communication information. A request for a conversation is received, from an initiator using a first communication mode that identifies a topic, but does not identify any responders. A conversation identifier is created. Possible responders are determined based on the topic and the conversation selection criteria. The topic of the conversation is sent to the possible responders, without identifying the initiator. A first response from a first responder is received using a second communication mode that is different than the first communication mode. The first response is mapped to the conversation based in part on the conversation identifier. The response is sent to the initiator using the first communication mode.
US09894018B2
A graphical user interface on a display device of a computer enables communications using a computer service. The graphical user interface includes a list of potential message recipients selected by a user as significant to the user. The graphical user interface also includes a mobile device identifier associated with one or more of the listed potential message recipients and a user account identifier associated with one or more of the listed potential message recipients. At least one of the listed potential recipients includes a mobile device identifier as the only available conduit for data delivery to the potential message recipient using the computer service.
US09894017B2
A communication system comprises: a physical machine; a switch control apparatus that controls a physical switch connected to the physical machine; and a virtual network management apparatus that manages a virtual network using the physical switch and at least one of the physical machine and a virtual machine operating on the physical machine. The physical machine comprises: a port information collection unit that collects port information of a NIC (Network Interface Card) assigned to the virtual network; and a port information notification unit that notifies the virtual network management apparatus of a correspondence between the NIC and the collected port information. The virtual network management apparatus instructs the switch control apparatus so that the physical switch uses the port information as a match condition.
US09894009B2
A client computing device establishes a plurality of subscriptions to store published data from data sources of the client device in a subscription buffer. In response to receiving, from a remote subscription dispatcher of a host computing device, a read request for data published by data sources of the client computing device, one or more data packets including published data stored in the subscription buffer are sent to the host computing device.
US09894004B2
A switch device includes a retaining unit, a switching processing unit, an identifying unit, and a rewriting unit. The retaining unit retains a flow table that maps each flow to a flag indicating whether the amount of transmitted data is equal to or more than a predetermined threshold. The switching processing unit stores a data packet received by a receiving buffer in one of a plurality of output queues provided for respective transmission ports based on the destination. The identifying unit identifies data packets included in a flow in which the amount of data is equal to or more than a predetermined threshold, from the data packets received by the receiving buffer. The rewriting unit refers to congestion notification information included in each of the identified data packets, and rewrites information indicating congestion to information indicating no congestion when the congestion notification information includes the information indicating congestion.
US09894001B2
An I/O circuit includes buffers, a storage module, accumulators, timers, and an arbiter. Each buffer corresponds to a respective virtual channel. Each buffer corresponds to a respective token bucket, and outputs a normal transmission request according to the amount of tokens and an accumulating signal. The storage module stores a lookup table including a plurality of weightings. Each accumulator corresponds to a respective buffer, accumulates a data volume according to the corresponding weighting, and outputs the accumulating signal. Each timer corresponds to a respective buffer, times waiting period after the corresponding buffer outputs the normal transmission request, and outputs a time-out transmission request when the waiting period exceeds a predetermined period. The arbiter receives the time-out transmission requests and the normal transmission requests, and selects one of the buffers from all of the time-out transmission requests and the normal transmission requests.
US09893999B2
Systems and methods for multi-channel signal processing by virtue of packet-based time-slicing with single processing core logic. The processing core logic is configured to receive data streams from the multiple communication channels at a data processing unit, and process data fragments of the data streams in a time-sliced manner. The processing core logic can switch from processing a first data fragment of a first data stream to processing a first data fragment of a second data stream at an end of a time slice, wherein the time slice is determined by a fragment boundary associated with the data fragment of the first data stream.
US09893995B1
The present disclosure describes several key features of an agent deployable on a service appliance: agent architecture/design, transport and channel abstractions of the agent, new message definition components, channel switching (e.g., platform independent processing), Channel state machine, platform dependent hooks (e.g., memory, timers), Service key data store, and Secure channel infrastructure. Many of these features alleviate the vendor of the service appliance from having to provide the features. The features and standardization thereof enable the system to be more robust (and increases code quality). Speed of integration is decreased while the risk of integration issues is also decreased. Updates to the agent can be deployed in a controlled and efficient manner. Furthermore, the agent can ensure security between a switch and the agent. The agent deployed and running on vendor appliances provides a unique way to present transport channels that run between the switch, agent, and other service appliance components.
US09893987B2
In one embodiment, a method includes sending a switch discovery signal to one or more of a plurality of switches, receiving a reply to the switch discovery signal from the one or more of the plurality of switches, each reply comprising a switch identifier (ID) and a quantity of ports, receiving configuration information identifying at least one virtual stack to create, determining a virtual topology for the at least one virtual stack based on the configuration information, creating a first virtual stack of the at least one virtual stack by assigning at least one switch port of a source switch to the first virtual stack of the at least one virtual stack in accordance with the configuration information, and storing the virtual topology in a mapping table local to a computer comprising the first computer processor.
US09893984B2
Embodiments of the present invention provide path MTU discovery of a network path, such as an IPv4 network. According to various embodiments of the invention, a node receives a packet at a node along the network path between a source node and a destination node, compares a MTU size of a next hop along the network path with the size of the packet, responsive to the MTU size of the next hop along the network path being less than the size of the packet and responsive to the packet supporting path MTU discovery, the node truncates the packet to the MTU size of the next hop, stores the MTU size in the portion of the packet reserved for PMTU size, and forwards the packet.
US09893983B2
Some embodiments provide a scalable framework to retrieve statistics relating different aggregated entities. In some embodiments, the aggregated entity is a pair of ports. The pair of ports can be physical ports of one or more physical forwarding elements. The pair of ports can be logical ports of one or more logical forwarding elements. In some embodiments, the aggregated entity is a machine or a group of machines. In some embodiments, the aggregated entity is an access control list (ACL).
US09893979B2
Previously available network management systems fail to adequately enable discovery of a network topology that includes both compliant and non-compliant networking devices. By contrast, and to that end, various implementations disclosed herein include systems, methods and apparatuses that determine whether or not a loop exists within uplink metadata associated with first and second compliant devices, wherein the loop in the uplink metadata is characterized by pointers provided to indicate that the first and second compliant devices operate to send externally addressed traffic to one another contrary to the operation of the first and second compliant devices within a network; and resolve the loop by adding a non-compliant device to topology-link map data associated with the first and second compliant devices in response to determining the existence of the loop, wherein the topology-link map data archives accessible information about the topology of the network based at least on the uplink metadata.
US09893963B2
The present technology may determine an anomaly in a portion of a distributed business application. Data can automatically be captured and analyzed for the portion of the application associated with the anomaly. By automatically capturing data for just the portion associated with the anomaly, the present technology reduces the resource and time requirements associated with other code-based solutions for monitoring transactions. A method for performing a diagnostic session for a request may begin with initiating collection of diagnostic data associated with a request. An application thread on each of two or more servers may be sampled. The application threads may be associated with the same business transaction and the business transaction may be associated with the request. The diagnostic data may be stored.
US09893956B2
A method for managing the configuration of a telecommunications network, the method comprises remotely creating a data file containing attributes of managed objects for one or more network elements of the network, uploading the data file to a management system of the network, inspecting the data file and identifying managed objects having attributes which have been created, varied or deleted, producing a database of the identified managed objects and the values thereof, and analysing the data in the database to manage the configuration of the telecommunications network accordingly. Also disclosed are an apparatus for performing the method, a management system incorporating the or apparatus and a telecommunications network incorporating the management system.
US09893954B2
A method of tuning a controller area network (CAN) communication model includes: measuring a CAN signal waveform, dividing the CAN signal waveform into a steady period and a dynamic period, determining a parameter for the steady period, determining a parameter for the dynamic period, modeling a CAN line using the parameter for the steady period and the parameter for the dynamic period, and performing error analysis on the CAN line.
US09893943B2
A method comprising determining at least one event criteria from a received event function request; determining an event impact from the at least one event criteria and a general function impact; determining whether the event impact interferes with at least one implemented function instance; and generating a coordination output based on the determination whether the event impact interferes.
US09893939B2
A method for transmitting and receiving a signal related to monitoring by a Service Capability Exposure Function (SCEF) in a wireless communication system is disclosed. The method includes receiving a first monitoring request containing first information related to monitoring configuration and deletion from a Service Capability Server/Application Server (SCS/AS), transmitting, to a Home Subscriber Server (HSS), a second monitoring request containing second information related to monitoring configuration and deletion, the second information being generated based on information related to the monitoring configuration and deletion, wherein the second monitoring request contains information indicating whether the second monitoring request is a request for deletion of all the monitoring configuration of a subscriber.
US09893932B2
Method and apparatus for pilot configuration in a mobile communications network There is provided a method of operating a central scheduler node in a mobile communications network when one or more mobile devices are located in the coverage area of a first base station and a second base station, the first base station and the second base station having a shared cell identity, the method comprising determining (101) the number of mobile devices that may benefit from a distributed multiple input/multiple output, D-MIMO, mode in which data is transmitted to a mobile device by the first base station and the second base station; and if the number of mobile devices that may benefit from a D-MIMO mode exceeds a threshold, causing (103, 107, 109) said mobile devices, the first base station and the second base station to be configured to operate in the D-MIMO mode.
US09893930B2
A method for processing data forwarding and a Service Provider-end Provider Edge (SPE) are disclosed, including the following steps: the SPE configuring data forwarding information which includes a corresponding relationship between Multi Segment Pseudo Wires (MSPW) information and forwarding information of an MSPW protection link group or a corresponding relationship between the MSPW information and forwarding information of other MSPW except the forwarding information of the MSPW protection link group (101); the SPE receiving a service message (102) carrying the MSPW information; the SPE querying the forwarding information of the MSPW protection link group or the forwarding information of other MSPW except the forwarding information of the MSPW protection link group (103); and the SPE performing label encapsulation and forwarding according to the queried-out forwarding information of the MSPW protection link group or forwarding information of other MSPW except the forwarding information of the MSPW protection link group (104).
US09893929B2
The present invention relates to a protection switching method and system for a Multi-Rooted Point-to-Multi-point Service in a Provider Backbone Bridge (PBB) network. In one embodiment, this is accomplished by assigning at least one communication device as Root node, a plurality of intermediate nodes and Leaf nodes, receiving, on at least one of the edge nodes (i.e. Root or leaf), the data packets from a client network interfacing with the PBB network, configuring all the communication edge devices to create a MAC-in-MAC data packet from the received data packet, configuring the Root node to add ISID R and leaf nodes to add ISID L in the I-tag of MAC-in-MAC data packets, determining a fault, if integrity check messages are not received in a predetermined time period between the Root node and the Leaf Nodes and switching the traffic by changing the designated backbone destination MAC address of the MAC-in-MAC data packets from the present root node MAC address to other available superior root node MAC address; wherein switching is performed when integrity failure is detected, or upon network operator request.
US09893926B2
A method of reception of signals transmitted by a FBMC transmitter using a block Alamouti coding. After demodulation in a base band, the received signal is sampled, with the sample blocks undergoing a sliding FFT before being de-multiplexed towards a first path during a first use of the channel and a second path during a second use of the channel. The vectors received on the first path are multiplied by a first and a second transfer matrix, conjugated to provide first and second vectors. The vectors received on a second path undergo time-reversal and complex conjugation and, if appropriate, multiplication by an imaginary factor, depending on the size of the blocks. The vectors thus obtained are multiplied by first and second transfer matrices to provide third and fourth vectors. The first and fourth (second and third vectors) are then combined and the combined vector is filtered and spectrally de-spread to give an estimate of the block transmitted by the first (second) antenna of the transmitter during the first use of the channel.
US09893925B1
In a wireless communication system, a client terminal may first establish time and frequency synchronization with the network. While establishing the time and frequency synchronization, a client terminal may need to detect additional parameters about the network, such as physical cell identity, before it can initiate communication with the wireless communication system. Detecting the network parameters in presence of time and frequency offsets increases the complexity of the initial cell search procedure that includes time and frequency synchronization as well as detection of network parameters. A method and apparatus are disclosed that achieve joint time and frequency synchronization by utilizing the relationship between frequency offset and the apparent timing shift. The joint time and frequency synchronization enables faster and more reliable synchronization with the wireless communication system.
US09893924B2
The disclosure relates to a module for a radio receiver. The module comprises an input terminal; an output terminal; a main signal path for communicating in-phase and quadrature signals between the input terminal and the output terminal; and a second signal path. The second signal path is connected in parallel with the main signal path and is configured to: extract in-phase and quadrature signals from the main signal path; filter the extracted in-phase and quadrature signals; detect an error in the filtered, extracted in-phase and quadrature signals; and apply a correction to in-phase and quadrature signals on the main signal path based on the error.
US09893913B2
A technique for cancelling or reducing crosstalk signals between controlled oscillators in an integrated circuit is provided. The technique involves an arrangement adapted to reduce a crosstalk signal generated by a first controlled oscillator to a second oscillator both comprised in the integrated circuit, wherein both controlled oscillators are configured to output a respective clock signal. The arrangement comprises a detector adapted to detect the crosstalk signal generated by the first controlled oscillator to the second controlled oscillator, a crosstalk cancellation circuit adapted to generate a cancellation signal having an amplitude substantially the same as that of the crosstalk signal and a phase substantially opposite to that of the crosstalk signal, and a cancellation signal injector adapted to introduce the cancellation signal into the second controlled oscillator.
US09893910B2
A non-transitory computer-readable medium storing instructions readable by a mobile terminal including a memory, an input interface, a first communication interface and a second communication interface, the instructions causing the mobile terminal to perform processes comprising: a storage processing of storing workflow information including device identification information and action identification information; a specifying processing of specifying the image processing apparatus, as a designated device; an information reception processing of receiving connection information from the designated device through the first communication interface; an extraction processing of extracting the workflow information coinciding with a first condition, among the workflow information; and an execution instruction processing of transmitting execution instruction information to the designated device through the second communication interface by using the connection information, wherein the execution instruction information is to instruct execution of the action identified by the action identification information.
US09893908B2
A system and method to facilitate real-time communications and content sharing among users over a network are described. In one preferred embodiment, multiple links to content information are dynamically generated for a sender user. Responsive to selection of a link by the sender user, the link and associated metadata information are communicated to at least one recipient user engaged in the real-time communications session with the sender user.
US09893904B2
One embodiment of the present invention provides a system for generating a message. During operation, the system receives user interaction event data. The user interaction event data describes explicit or implicit interactions of a user with a web application and/or mobile application. Next, the system modifies a graph describing the user's current context associated with the user based on an analysis of the user interaction event data, as interpreted by the system learning from previous processing of user interaction event data. The context graph includes information about the user's state, behavior, and interests, and some or all portions of the context graph may be shared between users. The system determines a set of rules associated with a group of users that includes the user, and then applies the determined set of rules to any context graph associated with the user to generate the message.
US09893895B2
Techniques for electronic signature processes are described. Some embodiments provide an electronic signature service (“ESS”) configured to facilitate the creation, storage, and management of electronic signature documents. In one embodiment, an electronic signature document may be associated with custody transfer rules that facilitate transfers of custody of an electronic signature document from one user or party to another. A custody transfer may results in a transfer of rights or capabilities to operate upon (e.g., modify, view, send, delete) an electronic signature document and/or its associated data. A custody transfer rule may be trigged by the occurrence of a particular event, such as the receipt of an electronic signature.
US09893893B2
A replaceable item for a host device includes a non-volatile memory and logic. The non-volatile memory stores passwords or authentication values, and/or a cryptographic key. The logic permits retrieval of a predetermined maximum number of the passwords from the non-volatile memory to authenticate the replaceable item within the host device. The predetermined maximum number of the passwords is less than the total number of the passwords.
US09893891B2
User identity is verified as a user migrates among different devices. When the user migrates from a device to a different device, key pairs may be generated. If the key pairs validate, the user may be verified to the different device.
US09893885B1
A computing device has a processor and a persistent memory, e.g., a fuse-based memory, storing two or more reduced sets of information. The processor is configured to derive a first cryptographic key using a first reduced set of information, e.g., prime numbers, and to use the first cryptographic key for performing cryptographic operations. The processor is also configured to detect a trigger event and, in response to the detected trigger event, derive a second cryptographic key using a second reduced set of information. The processor can then use the second cryptographic key for performing cryptographic operations.
US09893874B2
In one embodiment, a computer program product includes a computer readable storage medium having program instructions embodied therewith, the program instructions being executable by a processor to cause the processor to determine a lowest latency LAG port for each LAG in any path of a plurality of paths connecting a first device with a second device, and discover a configuration of a network fabric connecting the first device to the second device after determining the lowest latency LAG port for each LAG therein. The network fabric includes a plurality of devices interconnected with LAGs. Moreover, the embodied program instructions are executable by the processor to perform clock synchronization for each path of the plurality of paths and determine a latency for each path of the plurality of paths based on the clock synchronization and the lowest latency LAG port for each LAG included in the plurality of paths.
US09893855B2
The present invention discloses a method for transmitting a synchronization signal and a synchronization channel in a wireless communication system supporting Device-to-Device (D2D) communication; and an apparatus for the method. More specifically, a method for transmitting a D2D synchronization signal and a D2D synchronization channel in a wireless communication system supporting D2D communication comprises mapping the D2D synchronization signal and the D2D synchronization channel to a physical resource; and transmitting the mapped D2D synchronization signal and D2D synchronization channel to a UE, wherein the D2D synchronization signal is mapped to 64 subcarriers in the frequency domain, and the D2D synchronization channel is mapped to the same resource block as the D2D synchronization signal.
US09893848B2
A mobile communication system for providing carrier aggregation between digital units, and a method for processing a signal in the system are provided.The mobile communication system includes: a plurality of digital units connected to a core system and configured to process a radio digital signal; a blade server connected to at least two or more digital units and configured to perform resource allocation on signals processed by the connected digital units; and a plurality of radio units physically separated from the digital units, configured to convert and amplify digital signals received from the digital units, and transmit the same to a terminal, and configured to receive a signal transmitted from the terminal and transmit the received signal to the digital units. In the system, a mobile communication service is provided to the terminal by using carrier aggregation between radio units respectively connected to at least two or more digital units and using different frequencies.
US09893847B1
A wireless communication device and a digital self-interference estimation method thereof are provided. The wireless communication device, at respective timings, receives a plurality of self-interference signals and generates a plurality of ideal transmitting signals. The wireless communication device calculates a signal adjusting vector based on the self-interference signals and the ideal transmitting signals at different timings. The wireless communication device generates a main ideal transmitting signal at a main timing, and calculates, based on the signal adjusting vector, a main self-interference signal corresponding to the main timing according to the received self-interference and the main ideal transmitting signal.
US09893846B2
The present disclosure relates to a pre-5th-Generation (5G) or 5G communication system to be provided for supporting higher data rates Beyond 4th-Generation (4G) communication system such as Long Term Evolution (LTE). A base station and method thereof are provided for hybrid automatic retransmit request (HARQ) feedback in a wireless communication system. A method includes generating transmission beam information for transmitting hybrid automatic retransmit request (HARQ) feedback information for an uplink data packet received from a terminal; scheduling a HARQ feedback channel in a downlink subframe, based on the transmission beam information; and transmitting the HARQ feedback information, based on the HARQ feedback channel.
US09893840B2
A method and an apparatus for transmitting broadcast signals thereof are disclosed. The apparatus for transmitting broadcast signals, the apparatus comprises an input formatter for input formatting each data stream divided into a plurality of data transmission path, a generator for generating each of first signaling data and second signaling data, wherein the first signaling data and the second signaling data are processed respectively, wherein the first signaling data includes first information for the second signaling data and the second signaling data includes second information for at least one the data transmission path, wherein the second signaling data includes a static data and a dynamic data, an encoder for encoding, wherein the encoder processing: first encoding service data corresponding to each of the plurality of data transmission path, wherein each of the data transmission path carries at least one service component, second encoding the first signaling data and third encoding the second signaling data, a frame builder for building signal frames, wherein each of signal frames includes the encoded service data and the encoded first signaling data and the encoded second signaling data, a modulator for modulating the signal frames by an OFDM (Orthogonal Frequency Division Multiplex) scheme and a transmitter for transmitting the broadcast signals carrying the modulated signal frames.
US09893827B2
A control network communication arrangement includes a second protocol embedded into a first protocol in a way that modules supporting the second protocol may be aware of and utilize the first protocol whereas modules supporting only the first protocol may not be aware of the second protocol. Operation of modules using the second protocol does not disturb operation of the modules not configured to use or understand the second protocol. By one approach, the messages sent using the second protocol will be seen as messages sent using the first protocol but not having a message necessary to understand or as needing a particular response. In another approach, modules using the second protocol can be configured to send messages within a CAN message frame without being compatible with CAN.
US09893821B1
A networking device testing system includes a testing device that is connected to a load generator device and a networking device. The testing device includes a testing device chassis. First testing device connectors are included on the testing device chassis and are each connected to a respective networking device connectors on the networking device. Pairs of the first testing device connectors are coupled together such that traffic received through one of the first testing device connectors in each pair is directed to the other of the first testing device connectors in each pair. Second testing device connectors are included on the testing device chassis. At least one of the second testing device connectors is connected to the load generator device. Each of the second testing device connectors is coupled to a respective one of the first testing device connectors.
US09893820B2
A method of testing a phased array antenna that includes a plurality of antenna element pairs, each antenna element pair of the plurality of antenna element pairs including a first antenna element and a second antenna element, the method including: for each antenna element pair of the plurality of antenna element pairs, performing a first cross element gain measurement from the first antenna element to the second antenna element of that antenna element pair; and determining whether there is a problem associated with the phased array antenna by examining the first cross element gain measurements for the plurality of antenna element pairs.
US09893819B1
A method determines far field EVM of a DUT using over-the-air (OTA) testing, the DUT having a transmitter/receiver and an antenna that are integrated together such that there is no connection port for interfacing a test system for directly measuring the EVM. Modulated RF signals transmitted by the DUT propagate OTA via the antenna. The method includes performing a near field scan of a bounded radiation surface, which includes measurement points at which waveforms of a repeatedly transmitted modulated RF signal are measured; downconverting the waveforms to intermediate frequency (IF), and digitizing the IF waveforms; synthesizing digital waveforms corresponding to the IF waveforms; accounting for corresponding RF propagation in the far field for the digital waveforms; providing a modulated digital IF waveform using the digital waveforms for which RF propagation has been accounted; and calculating EVM of the DUT in the far field using the modulated digital IF waveform.
US09893816B2
Apparatuses including integrated circuit (IC) optical assemblies and processes for operation of IC optical assemblies are disclosed herein. In some embodiments, the IC optical assemblies include a transmitter component to provide light output having a particular beam direction, and a transmitter driver component. The transmitter component includes a light source optically coupled to a plurality of waveguides, a plurality of gratings, and a plurality of phase tuners. The transmitter driver component causes a light provided by the light source to be centered at a particular wavelength and a particular phase to be induced by each phase tuner of the plurality of phase tuners on a respective waveguide of the plurality of waveguides, in accordance with a feedback signal, to generate the light output having the particular beam direction.
US09893811B2
A ferrule for a fiber optic connector includes: a main body extending from a first end to a second end, the main body defining a bore extending from the first end to the second end; an end surface at the second end of the main body; and a raised portion on the end surface, the raised portion extending from the second end and surrounding the bore; wherein an optical fiber is configured to be positioned within the bore of the main body; and wherein the end surface is configured to be polished to remove the raised portion.
US09893802B2
A method and a user equipment (UE) for transmitting an uplink (UL) signal in a wireless communication system supporting carrier aggregation are discussed. The UE is configured with a plurality of cells. A first cell and a second cell operate in time division duplex (TDD) and have different TDD uplink-downlink (UL-DL) configurations. The method according to an embodiment includes determining a specific TDD UL-DL configuration having a smallest number of D subframes from among one or more TDD UL-DL configurations, each of the one or more TDD UL-DL configurations being configured as a D subframe in each D subframe of the first cell and the second cell, the D subframe indicating a downlink (DL) subframe or a subframe comprising a downlink period, a guard period, and an uplink period; and transmitting a control signal in a UL subframe in response to at least one downlink signal.
US09893799B2
A personal communications device for communications using a satellite in a satellite communications system. The personal communications device includes a location algorithm for determining the satellite location and the personal communications device location, a path algorithm for predicting an improved communication path between the satellite and the personal communications device, a position change algorithm for determining a recommended change in position of the personal communications device so as to position the personal communications device in the improved communication path.
US09893796B2
A mobile device (7) configured to provide relay capabilities in a communications system (1) by communicating network-level mobile device relaying capabilities and radio-level mobile device relaying capabilities from the mobile device (7) to a communications node (3) of the communications system (1) so that the mobile device (7) can relay communications between the communications node (3) and another mobile device (2). User subscription information related to relaying is also disclosed.
US09893793B2
A multi-antenna system is provided. The multi-antenna system includes a first antenna, a second antenna, a tunable circuit, and a frequency-divisional circuit. The first antenna is utilized to implement signals of a first frequency band. The second antenna is utilized to implement signals of a second frequency band. The second antenna is different from the first antenna, and frequencies of the second frequency band are greater than frequencies of the first frequency band. The tunable circuit is utilized to switch the signals of the first frequency band. The frequency-divisional circuit is utilized to suppress harmonics caused by the tunable circuit.
US09893791B2
A method and user equipment for transmitting channel state information (CSI) are provided. The method includes identifying a CSI configuration with a channel measurement information, a interference measurement information, an index for the CSI configuration, and information for a period and an offset; generating a CSI for the CSI configuration based on the channel measurement information and the interference measurement information; and transmitting the CSI for the CSI configuration based on the information for the period and the offset and the index for the CSI configuration.
US09893788B2
The present invention relates to a communication node with at least one antenna arrangement having four first antenna devices with corresponding antenna port pairs. Each pair of antenna ports comprising a corresponding first antenna port for a first polarization and second antenna port for a second orthogonal polarization. A beamforming arrangement comprises four beam ports and is configured to apply beam weights to each one of the antenna ports.The present invention also relates to a corresponding method.
US09893781B2
All data symbols used in data transmission of a modulated signal are precoded by hopping between precoding matrices so that the precoding matrix used to precode each data symbol and the precoding matrices used to precode data symbols that are adjacent to the data symbol in the frequency domain and the time domain all differ. A modulated signal with such data symbols arranged therein is transmitted.
US09893778B2
The present invention relates to a wireless communication system. A method for a terminal reporting channel state information in a wireless communication system, according to one embodiment of the present invention, comprises the steps of: receiving, from a second cell interfering with communication between a first cell and the terminal, a second precoding matrix indicator (PMI) determined based on the interference; and transmitting, to the first cell, the second PMI and a channel quality indicator (CQI).
US09893776B2
All data symbols used in data transmission of a modulated signal are precoded by switching between precoding matrices so that the precoding matrix used to precode each data symbol and the precoding matrices used to precode data symbols that are adjacent to the data symbol along the frequency axis and the time axis all differ. A modulated signal with such data symbols arranged therein is transmitted.
US09893769B2
A user who purchases content can temporarily transfer rights to play the content to another device, provided the device registered to have the rights in nearby.
US09893765B1
Devices include a primary transmission system, and first and second duplicate (dummy or non-transmitting) transmission systems. The primary transmission system includes a primary transmitter circuit receiving a data signal, a primary transmission line connected to the primary transmitter circuit, and a primary receiver circuit connected to the primary transmission line. The first duplicate transmission system is connected to the primary transmitter circuit, and supplies a transmission timing control signal to the primary transmitter circuit. The primary transmitter circuit stops transmitting (e.g., stops reducing the voltage of the primary transmission line) when the transmission timing control signal is received. The second duplicate transmission system is connected to the primary receiver circuit, and supplies an output timing control signal to the primary receiver circuit, and the primary receiver circuit outputs the data signal when the output timing control signal is received.
US09893762B2
Vector Control Entity and method therein for Disorderly Leaving Events, DLEs, causing Sudden Termination Change in a DSL system. The method comprises, when a DLE occurs on a line m in a vectored group of DSL lines, and the transmission on line m is, at least partly, continued: obtaining at least one error sample from CPEs connected to other lines in the vectored group of DSL lines, and calculating an estimate of the channel coefficients, H′, changed due to the DLE. The estimate is calculated based on the at least one error sample, and thus a channel estimate is provided. The method further comprises modifying a downstream precoder, based on the channel estimate, such that retraining of the other lines in the vectored group due to the DLE is avoided. The estimate of the channel coefficients is calculated based on the model H′=H+CΛH.
US09893758B2
In a particular aspect, a method includes receiving, at a long-term evolution (LTE) circuitry of wireless device from a wireless local area network (WLAN) circuitry of the wireless device while the LTE circuitry has control of at least one antenna of the wireless device, a request for control of the at least one antenna. Communications by the LTE circuitry using the at least one antenna corresponds to a first frequency band, communications by the WLAN circuitry using the at least one antenna correspond to a second frequency band, and the first frequency band at least partially overlaps the second frequency band. The method further includes sending a response from the LTE circuitry to the WLAN circuitry based on data included in the request.
US09893755B2
An electronic device has wireless communications circuitry including an adjustable antenna system coupled to a radio-frequency transceiver. The adjustable antenna system may include one or more adjustable electrical components that are controlled by storage and processing circuitry in the electronic device. The adjustable electrical components may include switches and components that can be adjusted between numerous different states. The adjustable electrical components may be coupled between antenna system components such as transmission line elements, matching network elements, antenna elements and antenna feeds. By adjusting the adjustable electrical components, the storage and processing circuitry can tune the adjustable antenna system to ensure that the adjustable antenna system covers communications bands of interest.
US09893737B1
An apparatus includes a series of analog-to-digital converter (ADC) stages and a comparison circuit coupled to a first ADC stage. The first ADC stage may be configured to compare an input signal to one or more conversion thresholds to generate a result. The first ADC stage may also be configured to generate an output signal based on a value of the result. In response to an assertion of a reset signal, the first ADC stage may be configured to set a level of the output signal voltage to a particular voltage. The comparison circuit may be configured to assert the reset signal in response to a determination that the input signal voltage exceeds an operating range defined by an upper overload threshold voltage and a lower overload threshold voltage.
US09893732B1
An integrated circuit includes rows of circuits. A first region of the integrated circuit includes a first portion of each of the rows of circuits, and a second region of the integrated circuit includes a second portion of each of the rows of circuits. The integrated circuit shifts functions for a first subset of the rows of circuits to a second subset of the rows of circuits in the first region based on a first defect in a first one of the rows of circuits in the first region. The integrated circuit shifts functions for a third subset of the rows of circuits to a fourth subset of the rows of circuits in the second region based on a second defect in a second one of the rows of circuits in the second region.
US09893729B2
A level shifter applied to a driving circuit of a display is disclosed. The level shifter at least includes a first stage of level shifting unit, a second stage of level shifting unit, and two third stage of level shifting units belonging to different power domains and used to perform boost conversion of voltage signals in different power domains. The first stage of level shifting unit includes eight transistors. The second stage of level shifting unit includes four transistors. The two third stage of level shifting units both include six transistors and two output terminals. The level shifter of the driving circuit in this invention makes the output terminals of the two third stage of level shifting units belonging to different power domains to synchronously output the voltage-shifted voltage signals.
US09893703B2
A multilayer electronic component includes a body including one or more ceramic layers or magnetic layers; an inductor part including coil portions disposed in the body to be perpendicular to a lower surface of the body; a plurality of internal electrodes disposed in the body to be perpendicular to the lower surface of the body; and an input terminal, an output terminal, and a ground terminal disposed on the lower surface of the body. The body includes a first capacitor part and a second capacitor part having different levels of capacitance. The first and second capacitor parts each include at least two among the plurality of internal electrodes and at least one of the ceramic layers or magnetic layers is interposed therebetween.
US09893701B1
A power filter circuit is provided for use in a package substrate for integrated circuits. A first power isolation circuit, having a first inductance, is configured to isolate power provided to one or more die connectors for provision to an integrated circuit die. A second power isolation circuit, having a second inductance, is configured to isolate power provided to one or more printed circuit board (PCB) connectors for provision to a PCB. A power plane electrically connects a first end of the first power isolation circuit to a first end of the second power isolation circuit, forming a “π” power filtering structure in some embodiments. A de-coupling capacitor can be provided as a surface-mount capacitor, or as an embedded capacitor in a core layer of an integrated circuit package.
US09893700B2
A LAN filtering circuit is discloses. The LAN filtering circuit includes an isolation transformer and a common-mode chock. The isolation transformer includes a first winding and a second winding coupling to each other. The first winding has a first tap, a second tap, and a center tap. A distance between the first tap and the second tap is not only larger than a distance between the first tap and the center tap but also larger than a distance between the second tap and the center tap. The common-mode chock includes a first input port, a second input port, and an input port arranged in a sequence order, the first tap is electrically connected to the first input port, the second tap is electrically connected to the second input port, and the center tap is electrically connected to the input port.
US09893691B2
In an impedance converter using an electron tube as an active element, output impedance can be made sufficiently low, and the number of circuit elements therefor is decreased and a circuit configuration therefor is made simple. Provided is an impedance converter having an electron tube cathode-follower connected. The impedance converter includes a bias diode that provides a bias voltage to a cathode of the electron tube, high resistance elements that provide a voltage of the bias diode to a grid of the electron tube, a load circuit connected to the electron tube, and a complementary emitter output circuit including two transistors, respective bases of which are connected to one end and the other end of the bias diode.
US09893686B2
Power amplifier with bias adjustment circuit. In some embodiments, a power amplifier can include an amplifying transistor configured to amplify a signal, and a bias circuit coupled to a bias node of the amplifying transistor and configured to provide a bias voltage at the bias node. The power amplifier can further include a bias adjustment circuit that couples an output node of the amplifying transistor and the bias circuit. The bias adjustment circuit can be configured to adjust the bias voltage in response to a potential difference between the output node and the bias node exceeding a threshold value.
US09893679B2
Methods, systems, and devices for high voltage and/or high frequency modulation. In one aspect, an optoelectronic modulation system includes an array of two or more photoconductive switch units each including a wide bandgap photoconductive material coupled between a first electrode and a second electrode, a light source optically coupled to the WBGP material of each photoconductive switch unit via a light path, in which the light path splits into multiple light paths to optically interface with each WBGP material, such that a time delay of emitted light exists along each subsequent split light path, and in which the WBGP material conducts an electrical signal when a light signal is transmitted to the WBGP material, and an output to transmit the electrical signal conducted by each photoconductive switch unit. The time delay of the photons emitted through the light path is substantially equivalent to the time delay of the electrical signal.
US09893671B2
Provided is an electric-motor control device, including: a command value calculation unit configured to calculate a command value directed to an electric motor based on a command value and a given moment-of-inertia value; a difference detection unit configured to detect a difference between the moment-of-inertia value and an estimated moment-of-inertia value; a moment-of-inertia value change unit configured to change at least anyone of the moment-of-inertia value and a correction coefficient for the moment-of-inertia value based on the difference; and a change restriction unit configured to restrict a change in the moment-of-inertia value or the correction coefficient when at least any one of the moment-of-inertia value and the correction coefficient is changed to decrease by the moment-of-inertia value change unit.
US09893661B2
The present invention relates to an anti-jerk control apparatus and method for an Hybrid Electric Vehicle (HEV).The anti-jerk control apparatus includes a model speed calculation unit for calculating a model speed of the motor in a state in which a vibration of a drive shaft is not considered. A vibration occurrence determination unit detects a speed vibration component while calculating a reference speed difference and an average speed difference from differences between the model speed and an actual speed of the motor, thus determining whether a vibration occurs on the drive shaft. A torque correction value calculation unit calculates a motor torque correction value for anti-jerk required to damp the vibration of the drive shaft, and controls torque of the motor if the vibration occurrence determination unit determines that the vibration occurs on the drive shaft.
US09893656B2
A resonant transducer includes a resonator, a resonator electrodes connected to an end part of the resonator, at least one fixed electrode arranged in the vicinity of the resonator, and a buried part formed between the fixed electrode and the resonator electrode. The resonator, the resonator electrodes and the fixed electrode are formed by the same active layer on a substrate.
US09893651B2
A linear vibration-wave motor being configured to apply a driving force to a lens barrel of an optical device includes a vibrator being operable to excite a vibration, a member to be contacted contacting the vibrator, the vibrator being arranged to move in a direction of the driving force with respect to the member to be contacted upon exciting the vibration, a vibrator support being fixed to the lens barrel and configured to support the vibrator, a pressurization member being operable to press the vibrator against the member to be contacted, a unit cover member including an opening extending in the direction of the driving force, and a unit base member having fixed thereto the member to be contacted and the unit cover member. The pressurization member is detachable from the vibrator support via the opening.
US09893642B2
A power module includes a multilayer circuit board, and first and second three-phase inverters, which are mounted on the multilayer circuit board to be stacked each other. A positive-electrode-side power source conductive trace of the first three-phase inverter and a negative-electrode-side power source conductive trace of the second three-phase inverter are disposed to at least partially face each other in a stacking direction of the multilayer circuit board, such that currents respectively flow through the power source conductive traces in opposite directions in a facing section. A negative-electrode-side power source conductive trace of the first three-phase inverter and a positive-electrode-side power source conductive trace of the second three-phase inverter are disposed to at least partially face each other in the stacking direction of the multilayer circuit board), such that currents respectively flow through the power source conductive traces in opposite directions in a facing section.
US09893638B1
Switched mode power supply (SMPS) with adaptive reference voltage for controlling an output transistor and method of operating the SMPS are described. The adaptive reference voltage is implemented using a timer that starts when the voltage on a conduction terminal of the output transistor reaches a reference voltage and stops when the current through the output transistor reaches zero. The voltage difference between a target voltage and a voltage accumulated when the timer was active is then sampled to produce a sampled voltage, which defines a new reference voltage if the accumulated voltage is not equal to the target voltage so that the reference voltage is adaptively adjusted in accordance with an operational characteristic of the output transistor.
US09893633B1
In one embodiment, a current-fed modular multilevel dual active-bridge DC-DC converter suitable for medium voltage direct current (MVDC) grid or high voltage direct current (HVDC) grid integration is described. The DAB modular converter and the current-fed DAB converter are soft-switched modular multilevel dual-active-bridge (DAB) converters having DC fault ride-through capability. In an additional embodiment a voltage-fed isolated modular dual active-bridge DC-DC converter for medium voltage direct current (MVDC) or high voltage direct current (HVDC) grids or systems is described. In specific embodiments, the converters may be coupled to a battery energy storage system (BESS), wherein the BESS comprises split-battery units and the interface of the isolated DC-DC converter connects the split-battery units to the MVDC or HVDC system. The converters can be implemented in single-phase or poly-phase configurations and can be controlled to maintain a desired DC output current under both normal and DC grid fault condition.
US09893631B2
A power transfer system includes DC-DC power conversion circuitry that has a first switch and a second switch on either side of a transformer connected via a common ground with a first capacitor and a second capacitor cross-connected across the transformer. A direction of power transfer is determined, and primary and secondary sides of the DC-DC power conversion circuitry are aligned based on the direction of power transfer. An amount of on-time for the first switch or the second switch is determined based on a quantity of power transfer through the DC-DC power conversion circuitry. The primary and secondary switches are controlled using switching.
US09893627B1
A cascade power system includes a non-isolated buck converter in cascade with an isolated Class-E resonant circuit, where the Class-E resonant circuit operates at high frequency, for example 4 Mhz. Further, the non-isolated buck converter is configured as a current source coupled to the Class-E resonant circuit which provides a buck converter output voltage as input to the Class-E resonant circuit. The Class-E resonant circuit includes capacitive isolation for the cascade power system output. The Class-E resonant circuit and the capacitive isolation are configured such that impedance matching for the resonant tank of the Class-E resonant circuit is independent of an output load condition.
US09893621B1
Various methods and devices that involve control circuits for power converters are disclosed. One method comprises controlling a switch using a control signal based on a comparison signal. The switch controls a transfer of power between an input node, which receives an input, and an output node. The method comprises measuring an output of the power converter, generating an error signal based on the output, generating a periodic ramp signal with a varying period, providing the error signal to a first input terminal of a comparator, providing the ramp signal to a second input terminal of the comparator, and generating the comparison signal based on the error signal and the ramp signal using the comparator. The method comprises increasing a slope of the ramp signal in response to an increase in the input, and increasing the slope of the ramp signal in response to a decrease in the varying period.
US09893613B1
To provide a DC/DC converter which does not need to switch a change direction of a control value depending on a power transmission direction between low voltage side and high voltage side, and can control a voltage of a charge and discharge capacitor. A DC/DC converter which controls voltage of a charge and discharge capacitor by a controller that performs a Δduty control which changes an ON duty ratio difference of semiconductor circuits, and a phase shift control which changes a phase difference of an ON period of semiconductor circuits.
US09893611B2
A method for controlling coil current of a magneto inductive, flow measuring device with a first value representing an overvoltage UO and a second value representing a holding voltage UH, wherein the first value is greater than the second value, characterized by steps as follows: setting a first switching point IS for the electrical current level, up to which a coil should be supplied with the overvoltage UO; applying an overvoltage UO until the electrical current level rises to the switching point IS set for the electrical current level; switching from the overvoltage UO to the holding voltage UH, in order to hold the electrical current level at a constant electrical current end value IH. Also intended is a magneto inductive, flow measuring device.
US09893606B1
A three-level chopper apparatus includes a protection switch circuit that changes a current pathway through which an overvoltage is applied to a second capacitor or a first capacitor to a current pathway through which no overvoltage is applied to the second capacitor or the first capacitor when a first switch or a second switch has a failure.
US09893597B2
Systems, methods, and apparatus for a homopolar generator charger with integral rechargeable battery
Systems, methods, and apparatus for providing a homopolar generator charger with an integral rechargeable battery. A method is provided for converting rotational kinetic energy to electrical energy for charging one or more battery cells. The method can include rotating, by a shaft, a rotor in a magnetic flux field to generate current, wherein the rotor comprises an electrically conductive portion having an inner diameter conductive connection surface and an outer diameter conductive connection surface, and wherein a voltage potential is induced between the inner and outer diameter connection surfaces upon rotation in the magnetic flux field. The method can also include selectively coupling the generated current from the rotating rotor to terminals of the one or more battery cells.
US09893595B2
A motor with a speed reducer, comprising a motor main body including a rotary shaft; a speed reducer portion including a worm and a worm wheel, a housing including a housing main body and a housing cover, the housing main body accommodating the speed reducer portion and being open to one side in an axial direction of the worm wheel; a circuit board accommodated in the housing, a power component disposed at one side of the circuit board; and a heat-receiving portion disposed at the housing main body, the heat-receiving portion being adjacent to the worm and disposed such that a part of the heat-receiving portion overlaps with the worm as viewed from the side thereof where the opening of the housing main body is disposed, and the heat-receiving portion touching against a face at the other side of the circuit board and receiving heat generated by the power component.
US09893593B2
A rotating electric machine includes a cooling frame. The cooling frame includes a flow passage through which the first liquid coolant circulates, a flow inlet connected to one end of the flow passage so as to make the first liquid coolant flow from the outside into the flow passage, and a flow outlet connected to the other end of the flow passage so as to make the first liquid coolant having flown through the flow passage flow to the outside. The machine is configured that, when the flow passage is divided into a front half portion closer to the flow inlet and a latter half portion closer to the flow outlet, the front half portion becomes a portion where the first liquid coolant mainly cools the second liquid coolant, and the latter half portion becomes a portion where the first liquid coolant mainly cools the gas coolant.
US09893587B2
An electronic pump includes a second housing, a rotor part, a stator part and a circuit board. A pump chamber is separated by a partition into a wet chamber allowing a working medium to pass through and at least one dry chamber where there is no working medium passing through, and the rotor part is arranged in the wet chamber. The electronic pump further includes a shaft, a sunken portion is formed at a top portion of the partition, and the shaft and a bottom of the sunken portion are fixed by injection molding. A portion where the rotor part is in contact with the shaft is a cooperation portion of the rotor part, and the cooperation portion is arranged in a cavity of the sunken portion.
US09893585B2
A mount for an electric motor, the mount comprising a sleeve for receiving a motor, the sleeve including plurality of elements projecting from a surface of the sleeve, wherein the plurality of elements include a vertex.
US09893584B2
An end winding support for an electric generator includes a pair of winding lead supports formed on opposite sides of a winding slot and separated by an upper slot width. Each of the winding lead supports includes a winding channel routed between a lead coupling port and the winding slot. The winding slot includes a base support and a pair of alignment members that define a transition between the base support and the winding lead supports. A lower slot width is defined along the base support between the alignment members and a ratio of the upper slot width to the lower slot width is between 1.024 and 1.053.
US09893578B2
Systems and methods for constructing electric motors in which rotor sections are individually keyed to a rotor shaft such that, in a resting position, the rotor sections are circumferentially shifted (“clocked”) with respect to each to mitigate effects of harmonic feedback, torsional flexibility and the like. In one embodiment, a system includes an electric drive, and an ESP coupled to it by a power cable. The ESP motor has a rotor in which multiple permanent-magnet rotor sections are mounted to a shaft. Within each rotor section, permanent magnets are positioned in two or more axially aligned rows. Adjacent rotor sections are clocked with respect to each other so that, in operation, the rows of permanent magnets in the different rotor sections are positioned to counter the harmonic feedback or to use torsional deflection to equalize torque contributions from the different rotor sections.
US09893563B2
The present subject matter is directed to a wind turbine electrical power configured to minimize power losses. The power system includes a generator having a generator stator and a generator rotor, a power converter electrically coupled to the generator, a main transformer electrically coupled to the power converter and the power grid, and an auxiliary transformer. More specifically, the main transformer is connected to the power grid via a voltage line comprising a voltage switch gear. Thus, the auxiliary transformer is connected directly to the voltage line, i.e. rather than being connected to the grid through the main transformer.
US09893561B2
A power supply conversion system receives an external power source to supply power to a load. The power supply conversion system includes at least one main power apparatus, at least one auxiliary power apparatus, a main switch, an auxiliary switch, and a control unit. The control unit turns on the main switch to restore the external power source when the control unit detects that the external power source is normally restored, and jointly supply power to the load with the auxiliary power apparatus. Especially, the output voltage of the main power apparatus is greater than the output voltage of the auxiliary power apparatus. In addition, the control unit disconnects the auxiliary power apparatus supplying power to the load when the control unit detects that the main power apparatus completely supplies power to the load.
US09893560B2
Provided is an alternating current (AC) and direct current (DC) power supply device in which normal power and power of a solar cell is used to supply not only AC power but also DC power, particularly, power of a solar cell is first supplied as DC power or is charged in a battery, and after battery charging, residual power is converted to AC power via an inverter so as to replace normal AC power or to transmit AC power to the outside. Accordingly, an SMPS power supply method in which AC and DC power are supplied at the same time may be provided, and moreover, power of a solar cell may be effectively used.
US09893549B2
It is inter alia disclosed to determining whether an object detected (160) based on at least one capacitance representative of at least one capacitance representative sensed by at least one capacitance sensing element (111, 112, 113) of an apparatus (100) corresponds to a predefined type of objects, the apparatus (100) further comprising a wireless charging unit (140), wherein the at least one capacitance sensing element (111, 112, 113) is at least partially placed in proximity to the wireless charging unit (140).
US09893531B2
A power supply system (101) includes a first power supply apparatus (111a) and a second power supply apparatus (111b) connected to a load in parallel, for supplying power to the load (115). The first supply apparatus (111a) includes a first controller that controls the output voltage of the first supply apparatus (111a) when a power supply from the first supply apparatus (111a) to the load 115 is equal to or greater than a power requirement by the load (115), and controls the output current of the first supply apparatus (111a) when the supplied power is less than the required power. The second power supply apparatus 111b includes a second controller that stops the second supply apparatus from supplying power (111b) when the power supply is equal to or greater than the power requirement, and controls the output voltage of the power supply apparatus (111b) when the power supply is less than the power requirement.
US09893526B2
Systems of networking power management systems are disclosed, wherein the systems receive control parameters from a control terminal and bring about demand response, curtailment, and other load management actions. One control terminal may be used to control many zones in different ways, and the load management actions may be automated to improve efficiency and predictability of the results of demand response actions. Some of the systems may be mobile and connectable to different sites in the network to respond to changing needs in the utility distribution grid. Large demand response requirements may be distributed among multiple sites or systems in order to encourage and enable participation in demand response programs by customers that would not traditionally be able to do so because of not being able to produce sufficient demand response results individually.
US09893522B2
A parallel filter arrangement with at least two filters supplying current in line side sensing configuration and a number of sensors for measuring current. The sensors are used to determine the amount of current being supplied by the filters and the amount of current being supplied by a source. The filters adjust their supplied current in order to reduce or eliminate the amount of reactive or harmonic current being supplied by a source.
US09893520B2
A switching device for switching bipolar DC currents in a high-voltage system includes at least two electromechanical switching units and a semiconductor switching arrangement. The electromechanical switching units have a first switching status and a second switching status. In the first switching status, the DC current can be passed via at least one of the electromechanical switching units without in this case flowing via the semiconductor switching arrangement. In the second switching status of the electromechanical switching units, the DC current can be passed via the semiconductor switching arrangement and can be switched off.
US09893519B1
A substrate is physically attached to the terminals of multiple different power sources. The substrate includes multiple electrical conductors. Each of the electrical conductors is immobilized along its length relative to the substrate. The electrical conductors include interconnect lines and sensing lines. The interconnect lines provide electrical communication between the power sources. At least one of the sensing lines carries an electrical signal indicating a voltage across one or more of the power sources. Electronics that are immobilized on the substrate employ the electrical signal to determine the voltage across the one or more power sources.
US09893517B2
Various implementations described herein are directed to an integrated circuit for electrostatic discharge (ESD) protection. The integrated circuit may include a detection stage having a resistor and a first capacitor cascaded with a second capacitor. The resistor and the first capacitor are arranged to define a triggering node configured to provide a triggering signal. The first capacitor and the second capacitor are arranged to define a reference node configured to provide a reference signal. The integrated circuit may include a first ESD clamping stage having a first transistor configured to provide a supply voltage to a first clamping transistor based on the triggering signal. The integrated circuit may include a second ESD clamping stage having a second transistor configured to receive the supply voltage from the first transistor and provide the supply voltage to a second clamping transistor based on the reference signal.
US09893506B2
A damping configuration for an oscillatably mounted, electrical energy transmission device includes a supporting frame which is connected to stationary abutments through a plurality of damping elements. A group of first and second damping elements which have damping rates dimensioned so as to differ from one another and which act in parallel, connect the supporting frame to the abutments. Favorable damping of both weaker and stronger movements, for example caused by an earthquake, is ensured due to a combination of damping elements having differently dimensioned damping rates.
US09893502B2
A base for an electrical outlet having a front surface and a back surface, at least one opening extending there through, the at least one opening having a size large enough to receive a socket face, at least one mounting screw aperture opening extending through the base, the mounting screw aperture having a first portion sized large enough to receive a mounting screw head, and at least a second portion extending into the first portion and through the base, the second portion sized large enough to allow a mounting screw shaft to extend through the base but small enough to disallow the mounting screw head from passing through the base, at least one keyhole cover removably secured within the first portion, and wherein the base is configured with the second portion of the mounting screw aperture accessible after the base is installed on the electrical outlet.
US09893492B2
A method of manufacturing a light emitting element includes, sequentially (a) forming a first light reflecting layer having a convex shape; (b) forming a layered structure body by layering a first compound semiconductor layer, an active layer, and a second compound semiconductor layer; (c) forming, on the second surface of the second compound semiconductor layer, a second electrode and a second light reflecting layer formed from a multilayer film; (d) fixing the second light reflecting layer to a support substrate; (e) removing the substrate for manufacturing a light emitting element, and exposing the first surface of the first compound semiconductor layer and the first light reflecting layer; (f) etching the first surface of the first compound semiconductor layer; and (g) forming a first electrode on at least the etched first surface of the first compound semiconductor layer.
US09893490B2
A laser power-supply device including a power-supply unit including a voltage input unit into which an AC voltage is inputted, a rectifier circuit, and a plurality of sub-switching regulator units, and a light-emitting unit, in which the plurality of sub-switching regulator units is connected in parallel to output of the rectifier circuit, the light-emitting unit includes a plurality of sub-light-emitting units, each of the sub-light-emitting units includes one light-emitting element row, a current is supplied to the one light-emitting element row from each of the plurality of sub-switching regulator units, and each of the sub-switching regulator units includes a switching circuit, a smoothing circuit, a current detection circuit that detects an output current, and a control circuit that controls the switching circuit on the basis of a current command value and the detected output current.
US09893481B2
Communications jacks include at least first through third jackwire contacts and a flexible substrate that has a first finger and a second finger. The first jackwire contact and the third jackwire contact are each mounted on the first finger and the second jackwire contact is mounted on the second finger.
US09893475B2
There is provided a connector including a signal pin that stretches in a first direction and transmits a signal, a substrate that has one surface on which the signal pin is formed, and an electric conductor layer that has ground potential, the electric conductor layer being formed on an opposite surface of the surface of the substrate on which the signal pin is formed.
US09893474B1
A cable, system, and method for cooling a semiconductor chip on an active cable. The active cable includes a heat sink that is thermally coupled to the semiconductor chip and movable from a retracted position to an extended position. The heat sink is in the retracted position when the active cable is not installed in a card connector in a computer case. After the active cable is installed in the card connector, the heat sink is urged to the extended position in which the heat sink is exposed to air flow circulation within the computer case.
US09893473B2
An electrical connector includes: an insulative housing having a base and a tongue; an upper and lower rows of contacts mounted in the insulative housing and exposed to the tongue; a shielding shell enclosing the insulative housing; and a pair of grounding pieces separated from each other and mounted in the insulative housing between the upper and lower rows of contacts, each grounding piece having a leg in contact with the shielding shell.
US09893470B2
A telecommunications cabling system, including: (a) an earthed support; and (b) at least one connection module mounted to the earthed support, including: (i) a housing for a plurality of electrical contact members, the housing having a plurality of recesses to receive wires of at least one shielded cable; (ii) at least one opening to receive an end of an electrical connector to place electrical contacts at the end of the electrical connector in direct or indirect electrical communication with at least some of the wires; and (iii) a shielding interface for the connection module; wherein the shielding interface is simultaneously contactable with shielding of the shielded cable, a corresponding shielding interface of the electrical connector, and the earthed support.
US09893466B2
A coaxial connector includes: a first joint and a second joint, a locking flange arranged at one end portion of the second joint; and a quick locking and separating mechanism that includes: a locking member fixedly arranged on a first end portion of the first joint and provided with a depression for accommodating the locking flange of the second joint; and a sliding sleeve arranged around the first joint and being slidable between a locking position in which the sliding sleeve locks the locking flange of the second joint in the depression of the locking member so as to connect the first joint and the second joint and an unlocking position in which the sliding sleeve allows the locking flange of the second joint to disengage from the depression of the locking member so as to allow the first joint to be separated from the second joint.
US09893463B1
A connector of a process field bus decentralized peripherals has a circuit board, two communicating cables each having two core wires and a shielding net layer, the two core wires coated by the shielding net layer, ends of the two core wires electrically connected to the circuit board, an inner shell mounted on the ends of the core wires by injection molding, a shielding layer covering the inner shell and the circuit board, the shielding layer electrically connected to the shielding net layers, and an outer shell mounted on the shielding layer by injection molding. Since the inner shell and the outer shell are formed by injection molding, the circuit board is tightly fixed in the connector. Further, the shielding layer is mounted between the inner shell and the outer shell to protect the circuit board from electromagnetic interference. Therefore, quality of the connector may be improved.
US09893461B2
A continuable waterproof cable includes a cable body, first, second and third transmitting members, and first and second waterproof elastic members. The cable body has a connecting end and a continuing end opposite to the connecting end. The first transmitting member and the first waterproof elastic member are disposed at the connecting end. The second transmitting member is disposed at the continuing end, coupled to the first transmitting member, and adapted to a first end of the first transmitting member. The second waterproof elastic member is disposed at the continuing end. The third transmitting member is in the cable body and has a fixed end and a free end. The fixed end is at the continuing end, the free end is detachably coupled to the first transmitting member and capable to be apart from the transmitting member by a force.
US09893454B2
A connector includes terminals connected to metal conductors of insulated wires each formed by covering the metal conductor with an insulation, a resin case member including a housing space for housing the terminals and an end opening that opens at one end, a resin lid member fitted to the end opening of the case member, and a molded resin portion formed by molding so as to cover at least the end opening of the case member fitted with the lid member. The case member includes first grooves that have a semicircular cross section and are formed on an inner surface facing the lid member, and the lid member includes second grooves that have a semicircular cross section and form, together with the first grooves, wire insertion holes for inserting the insulated wires.
US09893453B2
The present invention relates to an electrical connector in particular an electrical connector having at least two terminals that are connected wherein the electrical connector permit movement of each terminal relative to each other. The electrical connector has a first body part having a first terminal; the first terminal is connected to a second terminal formed in a second body part, the first and second body parts are connected together and can move with respect one to another thereby permitting variable angles to be created between an axis defined by the first terminal and an axis defined by the second terminal.
US09893450B2
An electrical connecting member includes a plurality of contact pieces for contacting with both a first conductive member and a second conductive member; and a holding member for holding the contact pieces. Each of the contact pieces includes a first contact portion for contacting with the first conductive member, a second contact portion for contacting with the second conductive member, and a held portion disposed between the first contact portion and the second contact portion and held with the holding member. The holding member includes a pair of base portions extending in parallel and a plurality of connecting portions for connecting the base portions. Each of the connecting portions includes a holding portion for holding each of the held portions of the contact pieces respectively so that the contact pieces are aligned in parallel with each other and are inclined relative to the base portions.
US09893444B2
A board-edge interconnection module features integrated capacitive coupling, which enables a board design employing the module to avoid having AC capacitors and flexible cables with bulky connectors. The recovered real estate enables further miniaturization, enabling the component to be used on a wide variety of devices, including ultra-mobile computing devices.
US09893437B2
A wire clamp is provided, having a body through which an aperture extends. An opening extending along a side of the body intersects with the aperture along its length. The wire clamp also includes a securing device configured to extend into the aperture.
US09893436B2
A connector configured to mechanically and electrically couple a first frame to a second frame includes a body, a first clamping member, a second clamping member, and a plurality of projections extending from the body and configured to contact at least one of the first frame and the second frame. The body includes a first end and a second end and defines a longitudinal axis extending between the first end and the second end. The body further includes a feature for engaging a fastener. The first clamping member is positioned adjacent the first end of the body and is configured to engage the first frame. The second clamping member is positioned adjacent the second end of the body and is configured to engage the second frame.
US09893431B2
A waveguide architecture for a dual-polarized antenna including multiple antenna elements. Aspects are directed to dual-polarized antenna architectures where each antenna element includes a polarizer having an individual waveguide with dual-polarization signal propagation and divided waveguides associated with each basis polarization. The waveguide architecture may include unit cells having corporate waveguide networks associated with each basis polarization connecting each divided waveguide of the polarizers of each antenna element in the unit cell with a respective common waveguide. The waveguide networks may have waveguide elements located within the unit-cell boundary with a small or minimized inter-element distance. Thus, unit cells may be positioned adjacent to each other in a waveguide device assembly for a dual-polarized antenna array without increased inter-element distance between antenna elements of adjacent unit cells. Antenna waveguide ports may be connected to unit cell common waveguides using elevation and azimuth waveguide networks of the corporate type.
US09893418B2
Disclosed are an antenna and a mobile device having the same. The antenna includes a plurality of radiators having a pillar shape; a connecting member for connecting the radiators with each other in series; and a ground member for grounding the radiators connected with each other through the connecting member.
US09893417B2
A satellite communications terminal for a ship may include an antenna with three antenna feeds operable at respective different frequencies, and communications circuitry coupled to the three antenna feeds and being configurable for a selected antenna feed. The terminal also includes a positioner to mount the antenna to the ship and point the antenna. A controller may select an antenna feed, configure the communications circuitry, and operate the positioner to point the antenna to a selected satellite all based upon the location of the ship and at least one selection rule. The selection rule may be a communications circuitry configuration rule and/or a service level agreement rule.
US09893414B2
An antenna assembly for aircraft including: a vertical tail of the aircraft including a front spar, a leading edge skin covering a leading portion of the front spar and a rib extended between the front spar and the leading edge skin; an antenna radiating element extending a length of the vertical tail and positioned between the leading edge skin and the front spar; a first metallic element included with or attached to the front spar; a second metallic element, wherein the second metallical element is electrically coupled to the antenna radiating element and to the first metallic element; an antenna coupler in electrical electrically connected to the antenna radiating element and the first metallic element, and wherein a closed looped electrical circuit is formed by the antenna radiating element, the first metallic element, the second metallic element and the antenna coupler.
US09893404B2
Embodiments of the present disclosure provide a radio frequency (RF) conductive medium for reducing the undesirable insertion loss of all RE hardware components and improving the Q factor or “quality factor” of RF resonant cavities. The RF conductive medium decreases the insertion loss of the RF device by including one or more conductive pathways in a transverse electromagnetic axis that are immune to skin effect loss and, by extension, are substantially free from resistance to the conduction of RF energy.
US09893402B2
Disclosed are various embodiments for superposition of guided surface wave launched along the surface of a lossy medium such as, e.g., a terrestrial medium by exciting a guided surface waveguide probe. In one example, among others, a system includes an array of guided surface waveguide probes configured to launch guided surface waves along a surface of a lossy conducting medium and an array control system configured to control operation of waveguide probes in the array via one or more feed networks. The array control circuit can control operation of the guided surface waveguide probes to maintain a predefined radiation pattern produced by the guided surface waves. In another example, a method includes providing voltage excitation to first and second guided surface waveguide probes to launch guided surface waves with the voltage excitation provided to the second guided surface waveguide probe delayed by a defined phase delay.
US09893400B2
A frequency band splitter is disclosed. The frequency band splitter includes a first, a second, and a third waveguides. A first narrow rectangular waveguide is utilized to connect the first waveguide to second waveguide. The first narrow rectangular waveguide has a first width to allow signals of a frequency band centered around a first frequency to be transmitted from the first waveguide to the second waveguide. A second narrow rectangular waveguide is utilized to connect the first waveguide to the third waveguide. The second narrow rectangular waveguide has a second width, which is different from the first width, to allow signals of a frequency band centered around a second frequency to be transmitted from the first waveguide to the third waveguide.
US09893399B2
An embodiment of the present invention discloses a waveguide filter, which includes a first waveguide at an upper layer and a second waveguide at a lower layer. The first waveguide and the second waveguide are isolated from each other by a metal isolation layer. The first waveguide forms a first resonant cavity. The second waveguide forms a second resonant cavity. The first resonant cavity and the second resonant cavity overlap each other. A coupling slot is disposed at the metal isolation layer in an overlapping area.
US09893396B2
A process for conditioning an electrochemical cell system comprising at least two electrochemical cells comprises selecting from the fuel electrodes of the electrochemical cells groups comprising: a charged group and a reset group. The process also comprises holding the fuel electrodes within the charged group at a predetermined state of charge associated with a set concentration of metal fuel ions in solution in the ionically conductive medium. The process further comprises resetting the fuel electrodes within the reset group. An electrochemical cell system includes a plurality of fuel electrodes and one or more controllers configured to regulate the concentration of reducible metal fuel ions in solution with an ionically conductive medium by maintaining a predetermined state of charge of at least one of the fuel electrodes, and initiate a charging, discharging, or resetting process on at least one other fuel electrode. Other features and embodiments are also disclosed.
US09893393B2
The present disclosure provides a method for removing gases generated in a lithium secondary battery using a cathode active material of the following formula (I) Li(LixMy−y′M′y′)O2−zAz (I) wherein, x, y, y′, and z satisfy 0
US09893390B2
The invention is directed toward a battery pack. The battery pack includes at least one electrochemical cell; a case; a plate; an indicator circuit; and a battery-to-internal volume ratio. The case includes at least one open end. The plate is placed over the at least one open end. The plate includes a terminal plate, a base plate, or any combination thereof. The indicator circuit includes an integrated circuit and an antenna. The indicator circuit is affixed to the plate. The battery-to-internal volume ratio is greater than about 0.52.
US09893384B2
A battery pack and transport coupler for enabling the battery pack to reduce the pack power capacity. The battery pack include a plurality of strings of battery cells and a switching network for coupling and decoupling the strings of battery cells from each other. When the plurality of strings of battery cells are coupled together in a default configuration the transport coupler includes a decoupler for decoupling the strings of battery cells and when the plurality of strings of battery cells are not coupled together in a default configuration the transport coupler includes a coupler for coupling the strings of battery cells for operation with an electronic device such as a power tool.
US09893379B2
A solid electrolyte contains an internal component and an external component coated on a surface of the internal component. The internal component is represented by a formula Li1+xMxZr2−x(PO4)3, M is one or more elements selected from a group consisting of Al, La, Cr, Ga, Y, and In, and 0.05≦x≦0.4. The external component contains a plastic deformable material and has a conductivity of about 10−7 S/cm to about 10−5S/cm. A method of preparing the solid electrolyte and a lithium ion battery including the solid electrolyte are also provided.
US09893376B2
Provided are a method of preparing an electrode assembly suitable for preparing a secondary battery having a structure that may increase a degree of freedom in the design of a device in which the secondary battery is installed, and a method of preparing a secondary battery.
US09893374B2
Disclosed is a composite electrolyte membrane comprising a microporous polymer substrate and a sulfonated polymer electrolyte. The composite electrolyte membrane comprises: a first polymer electrolyte layer formed of a first non-fluorinated or partially-fluorinated sulfonated polymer electrolyte; a non-fluorinated or partially-fluorinated microporous polymer substrate stacked on the first polymer electrolyte layer, wherein pores of the microporous polymer substrate are impregnated with a second non-fluorinated or partially-fluorinated sulfonated polymer electrolyte, and the first polymer electrolyte and the second polymer electrolyte are entangled with each other on an interface thereof; and a third polymer electrolyte layer formed on the microporous polymer substrate impregnated with the second polymer electrolyte by a third non-fluorinated or partially-fluorinated sulfonated polymer electrolyte, wherein the second polymer electrolyte and the third polymer electrolyte are entangled with each other on an interface thereof. A method for manufacturing the composite electrolyte membrane, and a membrane-electrode assembly (MEA) and a fuel cell comprising the composite electrolyte membrane are also disclosed.
US09893367B1
Provided is an interlayer for a thin electrolyte solid oxide cell, a thin electrolyte solid oxide cell including the same, and a method of forming the same. In various embodiments, functional elements (a fuel electrode, an electrolyte and a cathode) of the solid oxide cell are formed by means of a thin film process, and thus a nanostructure of the catalyst is not seriously lost due to agglomeration, different from a powder process. Thus, it is possible to accomplish catalyst activation according to a high specific surface area.
US09893361B1
The present disclosure is directed to electrochemical cells having injection molded or 3D printed components, such as cathodes, anodes, and/or electrolytes, and methods for making such electrochemical cells. The cathodes, anodes, and/or electrolytes can be formed from a binder resin and various conductive and active materials, mixtures of which are injected into a mold under heat and pressure to form the components of the electrochemical cells. The cathode can include conductive metallic powder, flakes, ribbons, fibers, wires, and/or nanotubes. Further, electrochemical arrays can be formed from multiple electrochemical cells having injection molded or 3D printed components.
US09893358B2
A binder composition for a rechargeable lithium battery, a method of preparing the same, and a rechargeable lithium battery including the same. The binder composition includes lithium polyacrylate and a solvent and has a viscosity of about 500 cps to about 5000 cps.
US09893357B2
A cathode mix for nonaqueous electrolyte secondary batteries includes a cathode active material having an olivine crystal structure, and polyvinyl pyrrolidone. Also, a nonaqueous electrolyte secondary battery includes: a cathode; an anode; and a nonaqueous electrolyte, wherein the cathode includes: a cathode active material having an olivine crystal structure; and polyvinyl pyrrolidone.
US09893352B2
In at least one embodiment, a method of scavenging hydrogen in a lithium-ion battery is provided. The method may comprise including an atomic intermetallic material in at least one of a positive electrode or a negative electrode of a lithium-ion battery and reacting hydrogen present inside the lithium-ion battery with the atomic intermetallic material to form a metal hydride. The method may include preparing a positive electrode slurry and a negative electrode slurry, each slurry including an active material and a binder, mixing an atomic intermetallic material including a proton absorbed state into at least one of the slurries, and casting the slurries to form a positive electrode and a negative electrode. The method may alternately include applying an atomic intermetallic material including a proton absorbed state to a surface of at least one of a lithium-ion battery positive electrode or negative electrode.
US09893350B2
The present invention relates to a lithium secondary battery, wherein a peak at 167 to 171 eV and a peak at 162 to 166 eV are present in XPS analysis of sulfur (S2p) of a positive electrode surface, and P169/P164 is in the range of 0.7 to 2.0 wherein the P 169/P 164 is the ratio between the intensity of the peak at 167 to 171 eV (P169) and the intensity of the peak at 162 to 166 eV (P164). The present invention can provide a lithium secondary battery having excellent cycle characteristics.
US09893348B2
In an aspect, a positive active material for a rechargeable lithium battery including: a compound that reversibly intercalates and deintercalates lithium; and a coating layer coating the compound and including a metal nitrate is disclosed. Since the positive active material is structurally stable during the charge and discharge, the obtained battery may have excellent battery capacity and cycle-life characteristics and also have high power.
US09893345B2
A rechargeable battery is provided, which includes a protection layer with an inversion plate, thereby improving safety by preventing the inversion plate from malfunctioning. In one example embodiment, the rechargeable battery includes an electrode assembly including a first electrode plate, a second electrode plate, and a separator disposed between the first electrode plate and the second electrode plate, a case accommodating the electrode assembly, and a cap assembly coupled to the case, wherein the cap assembly comprises a cap plate sealing the case and having a short-circuit opening, an inversion plate installed in the short-circuit opening of the cap plate, and a connection plate installed to cover the short-circuit opening of the cap plate, and a protection layer having a higher melting point than the cap plate is formed under the inversion plate.
US09893344B2
A safety device for preventing overcharging of a battery includes: a battery stack including a plurality of cells; a safety circuit connected to two or more cells and provided with an electrical conduction control unit that controls electrical conduction; and a closed circuit disposed between the cells connected to the safety circuit and provided with a switching unit which is switched on or off upon cell swelling, such that when cell swelling occurs, the switching unit is switched on by a pressing force, disabling the electrical conduction control unit of the safety circuit so electrical conduction between the cells is established via the switching unit, and when cell swelling occurs again, the switching unit is switched off, cutting off the electrical conduction between the cells.
US09893343B2
The present invention reduces or shuts off output electric power of a battery pack, which is connected to an electric device, depending on an abnormality. According to the present invention, a battery pack is detachably connected to an electric-device main body having a switch, and includes a first electric-power control circuit that outputs a first signal to the electric-device main body when the switch is operated, the first signal for allowing supply of electric power to the electric-device main body, a second switching element provided on an electric-power supply path that supplies electric power to the electric-device main body, and a second electric-power control circuit that outputs a second signal to the second switching element if an abnormality occurs in the battery pack, the second signal for reducing or shutting off the electric power supplied to the electric-device main body.
US09893339B2
A system for the storage of electric energy for a vehicle with electric propulsion; the storage system is provided with: a pack of chemical batteries, each of which has a cylindrical shape having a central symmetry axis and presents, at one end, a positive pole and, at an opposite end, a negative pole; the batteries are arranged in at least one row, in which all the chemical batteries of the row are parallel to each other and are arranged one next to the other with a predetermined pitch; and with a plurality of electrical connection elements for connecting the poles of the chemical batteries of a same row, so as to create groups of chemical batteries, in which the chemical batteries are connected to each other in parallel, and so as to connect the groups of chemical batteries to each other in series.
US09893338B2
A secondary battery includes a contact portion on a bottom retainer that contacts a bottom of a case, thus performing a tension function. The secondary battery includes an electrode assembly having a first electrode, a second electrode, and a separator between the first and second electrodes; a case accommodating the electrode assembly therein, having a top and a bottom and an opening in the top of the case; a cap plate closing the opening of the case; a bottom retainer on an upper surface of the bottom of the case, the bottom retainer including a support portion supporting the electrode assembly and at least one contact portion contacting the bottom of the case. As such, the contact portion may absorb external shocks, thus increasing durability and enhancing safety of the secondary battery.
US09893332B2
A car battery comprises: four lithium ferro-phosphate batteries serially connected and positioned within a battery case with the anode and cathode caps exposed and connected to each other, and each of the lithium ferro-phosphate batteries has a capacity of 10-20 ampere-hour. The car battery also comprises two wires respectively connected to the anode and cathode caps, and the wires are thus connected to the anode and cathode of the lithium ferro-phosphate batteries connected in series.
US09893331B2
A battery adhesion-fixation structure includes battery cells, a holder, an adhesive agent, bus bars, and an insulator. The holder includes holder holes for holding the battery cells therein. The adhesive agent adheres the battery cells with the holder within the holder holes. The bus bars electrically connect the battery cells with each other. The insulator intervenes between the bus bars and the holder. The bus bars include a bus-bar hole, and a terminal tab. The bus-bar hole faces face-to-face to an electrode terminal of the battery cells. The terminal tab projects into the bus-bar hole to be electrically connected with the electrode terminal. The insulator includes a face, and a dent opening in the face. The face opposes to the holder. The dent opens in the face, and accommodates the adhesive agent overflown toward the insulator therein.
US09893329B2
An electronic power supply device supplies electric power from a plurality of battery cells to an electronic power equipment and has an inner case for housing the plurality of battery cells and an outer case for housing the inner case. The electronic power supply device is designed to protect the plurality of battery cells from water damage and from an impact in the event that the electronic power supply device is accidentally dropped.
US09893326B2
A battery is provided that includes a laminate film having a metal layer and a thermal adhesive resin layer, a battery element which is covered with the laminate film, and leads which are connected to the battery element. The leads are sandwiched between opposing thermal adhesive resin layers, and extend outside the laminate film. The thermal adhesive resin layer has thermal adhesive resin and fine resin fibers.
US09893316B2
A display device, which includes a display region in which a plurality of pixels are arranged, includes a first organic insulating film, a first groove, which exists in a frame shape surrounding the display region to separate the first organic insulating film, a first inorganic partition portion, which is arranged in the first groove, and is made of an inorganic insulating material that exists in a frame shape surrounding the display region, a second organic insulating film formed above the first organic insulating film and the first inorganic partition portion, and a second groove, which exists in a frame shape surrounding the display region to separate the second organic insulating film, and is located inside the first groove in plan view.
US09893310B2
The present invention provides an OLED package structure and a packaging method. The structure includes a substrate (1), a package lid (2) opposite to the substrate (1), an OLED device (12) located between the substrate (1) and the package lid (2) and mounted on the substrate (1), a solid resin film (22) located between the substrate (1) and the package lid (2) and arranged on the package lid (2) to completely cover the OLED device (12), an inorganic protective frame (11) arranged on the substrate (1) and located outside an outer circumference of the solid resin film (22), adhesive (23) applied on the package lid (2) to bond the inorganic protective frame (11) and the package lid (2) to each other, and fritted glass (21) arranged outside an outer circumference of the inorganic protective frame (11) to bond the substrate (1) and the package lid (2) to each other. The present invention provides an arrangement where the inorganic protective frame is arranged inboard the fritted glass to effectively strengthen air tightness achieved with the fritted glass. Further, the solid resin film is arranged on the package lid to cover the OLED device so as to further strengthen the capability of the OLED package structure for blocking moisture and also, a gap in the interior of the sealed object is lessened so as to provide a sufficient mechanical strength to extend the lifespan of the OLED device.
