US11941817B2
Presented herein are systems and methods that provide for automated analysis of three-dimensional (3D) medical images of a subject in order to automatically identify specific 3D volumes within the 3D images that correspond to specific anatomical regions (e.g., organs and/or tissue). Notably, the image analysis approaches described herein are not limited to a single particular organ or portion of the body. Instead, they are robust and widely applicable, providing for consistent, efficient, and accurate detection of anatomical regions, including soft tissue organs, in the entire body. In certain embodiments, the accurate identification of one or more such volumes is used to automatically determine quantitative metrics that represent uptake of radiopharmaceuticals in particular organs and/or tissue regions. These uptake metrics can be used to assess disease state in a subject, determine a prognosis for a subject, and/or determine efficacy of a treatment modality.
US11941809B1
Systems, methods of and computer program products for predicting and detecting the onset of glaucoma are provided.
US11941808B2
A medical image processing device for visualizing an organ includes a processor. the processor is configured: to acquire volume data including the organ; to extract tubular tissues included in the organ; to designate an excision region that is a region to be excised in the organ; to determine whether or not to excise tubular tissues included in the excision region; and not to display tubular tissues to be excised in the excision region and to display tubular tissues not to be excised in the excision region on a display unit, when displaying a remaining region that is a range excluding the excision region in the organ.
US11941805B2
The present disclosure relates to systems and methods for image processing. The methods may include obtaining imaging data of a subject, generating a first image based on the imaging data, and generating at least two intermediate images based on the first image. At least one of the at least two intermediate images may be generated based on a machine learning model. And the at least two intermediate images may include a first intermediate image and a second intermediate image. The first intermediate image may include feature information of the first image, and the second intermediate image may have lower noise than the first image. The methods may further include generating, based on the first intermediate image and at least one of the first image or the second intermediate image, a target image of the subject.
US11941801B2
A device includes: a distribution information acquiring part configured to acquire, based on an image in which a plurality of cells that are cultivated in a predetermined area are imaged, distribution information relating to a distribution in the predetermined area of the plurality of cells; and a determination part configured to determine a cultivated state of the plurality of cells based on the distribution information acquired by the distribution information acquiring part.
US11941785B2
An electronic device may include scaling circuitry to scale input pixel data to a greater resolution. The directional scaling circuitry may include first interpolation circuitry to receive best mode data, including one or more angles corresponding to content of the image and interpolate first pixel values at first pixel positions diagonally offset from input pixel positions of the input pixel data based on the best mode data and input pixel values corresponding to the input pixel positions. The directional scaling circuitry may also include second interpolation circuitry to receive the best mode data and the input pixel values and interpolate second pixel values at second pixel positions horizontally or vertically offset from the input pixel positions based at least in part on the best mode data and the input pixel values.
US11941775B2
Embodiments of the present invention are directed to facilitating folding of virtual objects via a three-dimensional folding tool. In embodiments, a foldable virtual object having a set of one or more fold lines is presented. A user may select a particular fold line. Based on the user selection, a three-dimensional folding tool is presented in association with the selected fold line. The three-dimensional folding tool can include a first handle on a first panel adjacent to the selected fold line and a second handle on a second panel adjacent to the selected fold line. In accordance with detecting movement of the first handle in a direction, the first panel is folded or rotated about the fold line in the direction of the movement of the first handle, while the position of the second panel is maintained.
US11941756B2
This invention discloses a computer-implemented method for determining production values for producing a custom-tailored knitted garment for a limb of a person. A 3D scan device acquires a three-dimensional data of a limb. A height value describing the dimension of a knitting row in the lengthwise direction of the limb and a total length value for at least one lengthwise section of the garment are provided, and the number of knitting rows for one section of the garment is determined by dividing the total length value by the height value. A circumference information describing the circumference of the limb is derived by evaluating the three-dimensional dataset. A circumference value for each n-th knitting row or each knitting row except every n-th knitting row is determined from the circumference information. The circumference value is used for determining production values for the knitted garment.
US11941739B1
Systems and methods generate a modified three-dimensional mesh representation of an object using a trained neural network. A computer system receives a set of input values for posing an initial mesh defining a surface of a three-dimensional object. The computer system provides the input values to a neural network trained on posed meshes generated using a rigging model to generate mesh offset values based upon the set of input values and the initial mesh. The neural network includes an input layer, an output layer, and a plurality of intermediate layers. The computer system generates, by the output layer of the neural network, a set of offset values corresponding to a set of three-dimensional target points based on the set of input values. The offset values are applied to the initial mesh to generate a posed mesh. The computer system outputs the posed mesh for generating an animation frame.
US11941738B2
A three-dimensional (3D) model of a person may be obtained using a pre-trained neural network based on one or more images of the person. Such a model may be subject to estimation bias and/or other types of defects or errors. Described herein are systems, methods, and instrumentalities for refining the 3D model and/or the neural network used to generate the 3D model. The proposed techniques may extract information such as key body locations and/or a body shape from the images and refine the 3D model and/or the neural network using the extracted information. In examples, the 3D model and/or the neural network may be refined by minimizing a difference between the key body locations and/or body shape extracted from the images and corresponding key body locations and/or body shape determined from the 3D model. The refinement may be performed in an iterative and alternating manner.
US11941719B2
Various embodiments enable a robot, or other autonomous or semi-autonomous device or system, to receive data involving the performance of a task in the physical world. The data can be provided as input to a perception network to infer a set of percepts about the task, which can correspond to relationships between objects observed during the performance. The percepts can be provided as input to a plan generation network, which can infer a set of actions as part of a plan. Each action can correspond to one of the observed relationships. The plan can be reviewed and any corrections made, either manually or through another demonstration of the task. Once the plan is verified as correct, the plan (and any related data) can be provided as input to an execution network that can infer instructions to cause the robot, and/or another robot, to perform the task.
US11941714B2
Techniques described herein are directed to analyzing intellectual-property data according to provide various intellectual property related services to organizations. In particular implementations, information related to products and/or services may be obtained from a number of data sources. Additionally, information related to intellectual-property assets, such as patents, trademarks, copyrights, trade secrets, and know-how, may be obtained. In various situations, the intellectual-property assets may be mapped to respective products and/or services. The mappings between the products and/or services and intellectual-property assets may be used to provide intellectual property related services that correspond to the intellectual-property assets, such as valuation services, strategy-related services, or risk-related services.
US11941713B2
Systems and methods are disclosed for determining a pitch of a roof of a structure by analyzing one or more images showing the roof, at least one of the one or more image showing the roof obtained with a camera of a user device and an image not obtained by the user device. The system uses the one or more images including an image obtained by the user device to generate a report for determination of an amount of materials needed for a construction project, the report including at least one image showing the structure and an estimated area of the construction project.
US11941704B2
At least a method for determining risk behavior of a driver is described. While a vehicle is being driven, data is obtained related to the position and movement of a wireless communications device. The data may indicate the type of behavior exhibited by the driver while the vehicle is being driven.
US11941703B2
Methods and systems for facilitating photo-based estimation are described. In an aspect, a server is configured to send via a communications module to a remote computing device a first signal comprising a chat interface. The server may receive, via the communications module and from the remote computing device, a second signal representing input received at the remote computing device through the chat interface. The server may identify an account associated with the remote computing device and retrieve policy data associated with the identified account from the data store. The server may automatically evaluate the input and policy data against predetermined criteria to determine whether a claim has a low risk level and, when the claim is determined to have a low risk level, engage a photo-based estimation module.
US11941687B2
A system to manage a wardrobe and compile outfits includes a server computing device that includes a memory having stored thereon demographic data and a plurality of electronic fashion item models. Each electronic fashion item model is indicative of a fashion item. The electronic fashion item model includes a fashion item type and a fashion item color scheme. The electronic fashion item model is associated with one or more style genres. The system includes an application configured to, when executed by at least one processor, compile at least one virtual outfit. Each virtual outfit includes at least one electronic fashion item model. Each virtual outfit is compiled based on A) a selected event, B) the particular user's demographic data, and C) style genres.
US11941683B2
Systems and methods are provided for ingesting task-related data and providing task recommendations or generating tasks based on the ingested data. In certain embodiments, task-related data is obtained by a task facilitation service from third-party applications using a suitable interface, such as an application program interface (API), and the third-party applications may include plug-ins or extensions that facilitate communication between the applications and the task facilitation service. For example, task facilitation service may be configured to obtain and process data from websites and generate task recommendations based on the website data.
US11941682B2
A vehicle recommendation system recommends an eco-friendly vehicle over an internal combustion engine vehicle. The system includes a server that calculates a first recommendation score indicating suitability for recommendation of an eco-friendly vehicle based on a previously stored vehicle use record for the customer, receives vehicle use information for using the car sharing service from a customer terminal possessed by the customer, and calculates a second recommendation score indicating suitability for recommendation of the eco-friendly vehicle based on the vehicle use information. The server transmits recommendation information related to an internal combustion engine vehicle a hybrid vehicle, or an electric vehicle to the customer terminal based on at least one of a result of comparing the first recommended score with a predetermined first reference value or a result of comparing the second recommended score with a predetermined second reference value.
US11941677B2
An auto-styler device may provide a style-based or outfit-driven shopping experience. The auto-styler device may select a style definition that defines a style-conforming outfit based on rules that apply to a combination of a first item type and a second item type of the style-conforming outfit, and that defines a customized presentation for the style-conforming outfit. The auto-styler device may generate a style-conforming outfit with a first item of the first item type and a second item of the second item type in response to a collective style produced by the combination satisfying the rules. The auto-styler device may position and size a first image of the first item relative to a second image of the second item in a single interface based on the specified the customized presentation of the style definition, and may present or publish the resulting single interface on a merchant site.
US11941667B2
Embodiments set forth techniques for managing advertisement auctions on a client device. The method can include the steps of (1) receiving, from a server device, a plurality of objects, where each object is associated with a respective digital asset, and each object includes, in association with the respective digital asset (i) a server-derived digital asset vector, (ii) a server-derived predicted tap-through rate, and (iii) a bid amount. In turn, and for each object of the plurality of objects, the client device (2) generates a respective estimated cost per impression for the object based on the information provided by the server device as well as information derived by the client device. Subsequently, the client device (3) identifies, among the plurality of objects, the object associated with the highest respective estimated cost per impression, and (4) causes an advertisement for the respective digital asset associated with the identified object to be displayed.
US11941663B2
A location-aware electronic device is provided. The electronic device trains feature extraction layers, reconstruction layers, and classification layers. The training may be based on a reconstruction loss and/or a clustering loss. The electronic device processes a fingerprint to obtain an augmented fingerprint using randomization based on statistics of the fingerprint. The feature extraction layers provide feature data to both the reconstruction layers and the classification layers. The classification layers operate on the codes to obtain an estimated location label. An application processor operates on the estimated location label to provide a location-aware application result to a person.
US11941662B2
A dynamic digital advertising content system having a front end system and a back end system, and used to present product content to a user's computing device in the form of a digital circular. The back end system provides retailers and third party access to upload, and update, product content information for the digital circular, including videos and animations. The dynamic digital advertising content system can include integrations for third-parties such as digital coupon providers and loyalty program providers. The system permits users the ability to share with other users merchandise displayed in the digital circular and/or selected for a shopping list. Such shared content can be dynamically arranged for subsequent presentation on a computing device of the recipient. The digital circular is further customizable for individual retailers or retailer locations, as well as customizable based on detected histories and/or characteristics of the user receiving the digital circular.
US11941659B2
Systems and methods for scoring promotions are provided. A set of training offers are received, which include combinations of variable values. These combinations of variable values are converted into a vector value. The offers are paired and the vectors subtracted from one another, resulting in a pair vector. Metrics for the success of offers is collected, and are subtracted from one another for the paired offers to generate a raw score. This raw score is then normalized using the pair vector. The normalized scores are utilized to generate a model for the impact any variable value has on offer success, which may then be applied, using linear regression, to new offers to generate an expected level of success. The new scored offers are ranked and the top-ranked offers are selected for inclusion in a promotional campaign.
US11941658B2
Systems and methods are disclosed for measuring the effectiveness of a marketing and advertising campaign directed at consumers. The systems and methods receive data corresponding to consumers that were served impressions in the campaign, and match the data to identifiers for credit records of the consumers. Credit record activity information in the credit records related to products and services of the campaign can be retrieved and potentially depersonalized. The credit record activity information can be the basis of a campaign report for adjusting and optimizing the campaign, in the case of an in-flight campaign report, or future campaigns, in the case of a post-campaign report. More accurate measurement of the effectiveness of the campaign can be obtained due to linking of a consumer's activity with the campaign.
US11941651B2
Methods and systems for determining a set of lowest corresponding price data related to a salable unit are disclosed herein. An example method includes receiving an input indicative of the salable unit, the input including a current date. The example method further includes generating a set of comparable salable unit data based on the input. Each respective comparable salable unit data in the set of comparable salable unit data includes a respective prior date within a date threshold from the current date. The example method further includes determining the set of lowest corresponding price data by applying an exclusion model to the set of comparable salable unit data, and transmitting a notification of the set of lowest corresponding price data for display to a user. The example method further includes storing the set of lowest corresponding price data into an historical transaction log.
US11941648B2
The disclosure includes implementations for providing a recommendation to a driver of a second DSRC-equipped vehicle. The recommendation may describe an estimate of how long it would take the second DSRC-equipped vehicle to receive a roadside service from a drive-through business. A method according to some implementations may include receiving, by the second DSRC-equipped vehicle, a Dedicated Short Range Communication message (“DSRC message”) that includes path history data. The path history data may describe a path of a first DSRC-equipped vehicle over a plurality of different times while the first DSRC-equipped vehicle is located in a queue of the drive-through business. The method may include determining delay time data for the second DSRC-equipped vehicle based on the path history data for the first DSRC-equipped vehicle. The delay time data may describe the estimate. The method may include providing the recommendation to the driver. The recommendation may include the estimate.
US11941647B2
A data processing system includes a processor and associated memory implementing an enterprise data management (EDM) module configured to interact with an enterprise management system. A storage device coupled to the processor, implements an enterprise data management (EDM) database, which stores priority rules used to determine priority scores associated with a plurality of different entities associated with entity records. A communications interface coupled to the processor, transmits the priority rules, to an enterprise management system, and receives priority scores of individual entities, determined based on the priority rules, from the enterprise management system. The priority scores of the individual entities are stored in the EDM database in association with the priority rules, and the EDM module matches the entity records to entities based, at least in part, on the priority scores of the individual entities.
US11941643B2
Provided is a computer-implemented method for authenticating a user. The method includes registering a plurality of user accounts for a plurality of users based at least partially on user information and account data for each user of the plurality of users, the account data for each user including an account identifier associated with a portable payment device, generating an identity score for each user, registering a plurality of provider accounts for a plurality of third-party service providers based at least partially on third-party service provider data, receiving a request to authenticate a user of the plurality of users, receiving user credentials corresponding to a user account of the user, validating the user credentials based at least partially on the identity score of the user, and communicating an authentication response message to the third-party system in response to validating the user credentials.
US11941630B2
Systems and methods for verifying individuals prior to distribution of one or more benefits are disclosed. One example method includes receiving, at an interface peripheral of a payment card device, a biometric from an individual associated with the device and comparing the received biometric to a biometric reference stored in a memory of the device. The method also includes, in response to the received biometric matching the biometric reference, setting a biometric status in the memory of the device for an expiration interval and enabling the device for transactions to be funded by an account linked to the device, based on the biometric status being set. The method then includes, in response to expiration of the expiration interval, resetting the biometric status in the device and disabling the device for transactions to be funded by the account, based on the biometric status not being set.
US11941621B2
Systems, methods, articles of manufacture, and computer-readable media for secure authentication based on passport data stored in a contactless card associated with an account. An application may receive an indication to perform an operation. The application may receive encrypted data from the card. The application may receive an indication that the authentication server verified the encrypted data based on a private key. The application may receive encrypted passport data from the contactless card, the encrypted passport data for a passport associated with the account. The application may determine an attribute of the passport based at least in part on image data or text input. The application may decrypt the encrypted passport data based on the attribute of the passport. The application may initiate performance of the operation based on the received indication specifying that the authentication server verified the encrypted data and the decryption of the encrypted passport data.
US11941613B2
Systems and methods are provided for recording ownership information in a distributed ledger (such as a blockchain), and for performing application processing utilizing the distributed ledger. An example server computer system is configured to: record on a blockchain ownership information of an asset; to configure, for each owner of the asset, a digital wallet associated with a private cryptographic key and at least one blockchain address; using a blockchain address from a digital wallet to access ownership information in the blockchain; perform application processing using the accessed ownership information; and record in the blockchain, updated ownership information or other information associated with the ownership information in accordance with the performed application processing.
US11941610B2
The present disclosure provides a cryptocurrency securing system and a cryptocurrency securing method thereof. The system receives a cryptocurrency transaction information from a user device, and determines whether a policy data corresponding to the cryptocurrency transaction information is legal. When the policy data corresponding to the cryptocurrency transaction information is legal, the system derives a cryptocurrency private key information via a personal identification number of the user device. The system then encrypts the cryptocurrency transaction information via the cryptocurrency private key information for deriving an encrypted cryptocurrency transaction information, and broadcasts the encrypted cryptocurrency transaction information to a blockchain network.
US11941585B2
A local workspace access system is associated with a local workspace, reads badge data, and transmits the badge data. A workspace personalization management system receives the badge data, locates an organization associated with the badge data, and transmits the badge data to its associated organization. A server associated with the organization receives the badge data, locates a member of the organization who is associated with the badge data, and transmits the workspace configuration associated with the member to the workspace personalization management system. The workspace personalization management system transmits a keyable code to a messaging service device of the member and transmits the keyable code and the workspace configuration associated with the member to the local workspace access system. The local workspace access system receives member input of the keyable code, and verifies that the inputted keyable code matches the keyable code received from the workspace personalization management system.
US11941581B2
The disclosure relates to systems and methods for real-time detection of a very large number of items in a given constrained volume. Specifically, the disclosure relates to systems and methods for retrieving an optimized set of classifiers from a self-updating classifiers' database, configured to selectively and specifically identify products inserted into a cart in real time, from a database comprising a large number of stock-keeping items, whereby the inserted items' captured images serve simultaneously as training dataset, validation dataset and test dataset for the recognition/identification/re-identification of the product.
US11941579B2
An inventory management system managing a plurality of inventory items stored in a storage area. The inventory management system includes an autonomous vehicle configured to move within the storage area and a computing device communicatively coupled to the autonomous vehicle. The autonomous vehicle includes a beacon configured to facilitate detection of a current position of the autonomous vehicle based on signal triangulation, a sensor configured to detect information indicative of a number of inventory items at the current position of the autonomous vehicle, and a wireless data link configured to transmit a signal indicative of the number of inventory items. The computing device may detect a position of the autonomous vehicle based on the signal transmitted from the beacon, and update an inventory of the storage area based on the signal indicative of the number of inventory items.
US11941576B2
Providing restitution when an unattended package is damaged by improper storage or inclement weather
The present invention relates to a system and method for providing restitution to a beneficiary when a package shipped by an originating shipper to a destination address, by way of a designated package transport carrier, is left unattended and damaged due to improper storage or exposure to inclement weather at the destination address prior to the package recipient taking receipt of the package. In an exemplary embodiment, a beneficiary is compensated, in accordance with a package repayment plan, when at least: a missing or damaged package report was created by the designated package transport carrier, the report indicates the package was delivered to the destination address during the plan enforcement period, and the originating shipper and the designated package transport carrier declined to provide a suitable remedy. Other embodiments include authorizing coverage for an address and package value, charging a transaction fee for authorizing coverage, and identifying fraud.
US11941571B2
A method for delivering restricted items to users includes detecting that a user has selected a restricted item for delivery. A user profile is accessed, and authorization for delivery of the restricted item associated with the user profile is verified. Upon detecting a first authorization associated with the user profile, authorizing the dispatch of the restricted item to the user at a delivery location. The restricted item is transported to the delivery location by the mobile robot. The mobile robot has an item space with a lid and an electronic lock, which is locked during transit. A second authorization to confirm a user's identity before the user receives the restricted item. If the second authorization fails, communication is established between the user and a remote operator terminal via the mobile robot, and the remote operator terminal performs the second authorization and/or repeats the first authorization.
US11941570B2
A transport system S acquires load information of a load to be transported and environmental information obtained by sensing environment of the transport destination of the load, and determines a receiving time limit for the load in the environment of the transport destination on the basis of the acquired load information and the environmental information.
US11941568B2
A method for quality control monitoring of additive manufacturing processes comprising forming at least one channel in an additive manufacturing build platform, wherein the channel is formed in the upper surface of the build platform to a predetermined depth, and wherein the channel is formed in a predetermined pattern across the upper surface of the build platform; placing a sensor in the channel formed in the upper surface of the build platform, wherein the sensor gathers information relevant to an additive manufacturing process occurring on or in close proximity to the build platform; enclosing the sensor within the channel formed in the upper surface of the build platform with an additive manufacturing substrate, wherein components or parts are built directly on the substrate using an additive manufacturing process, and using the sensor to gather information about the components or parts and the additive manufacturing process itself.
US11941566B2
Various methods, apparatuses/systems, and media for managing metadata are disclosed. A processor extracts technical metadata corresponding to enterprise applications from a plurality of databases; builds a metadata repository in a graph database; builds a web-based metadata application based on developing a normalized representation for data flows corresponding to the extracted technical metadata by utilizing the graph database. The extracted technical metadata is stored onto the metadata repository in the graph database. The processor authenticates and authorizes a user to utilize the web-based metadata application; receives search criteria from the user; accesses the metadata repository in the graph database to retrieve the technical metadata and/or data lineage within the enterprise applications from the metadata repository based on received search criteria; and displays the technical metadata and/or the data lineage within the enterprise applications onto a user interface.
US11941564B2
A site server agent monitors a site server for an event associated with an update process that spans multiple resources associated with multiple systems. The agent hands the monitoring off to a remote connected systems manager when a state associated with the event does not change to an expected value within a configured period of time or based on a configured condition. Connected systems manager continues to monitor the state and elevates the event to a level two incident after a second configured period of time or based on a second configured condition. When the state has still not changed after a third configured period of time or based on a third configured condition, a level one incident is generated in an incident management system associated with the site for support staff to immediately investigate the update process and resources of the systems.
US11941563B1
An apparatus and method for fracking optimization, wherein the apparatus includes at least a processor, and a memory, wherein the memory containing instructions configuring the at least a processor to receive a reservoir datum from at least a sensing device, generate a production training data include a plurality of reservoir datums as input correlated to a plurality of optimal production parameters as output, train a fracking optimization machine-learning model using the production training data, determine an optimal production parameter as a function of the fracking optimization machine-learning model, and generating an optimal production plan as a function of the optimal production parameter.
US11941561B2
A subtask assignment system for assisting groups of workers to complete a task more efficiently. The task may comprise a physical assembly task of an object. The physical assembly task comprises a plurality of subtasks that must each be completed to complete the physical assembly task. The subtask assignment system may include an assignment server connected to a plurality of user devices via a network, each user device being operated by a particular worker. The assignment server may execute an assignment engine that receives inputs describing the overall task and group of workers, generates a task model representing the task based on the inputs, populates a parameters table based on the inputs, and automatically determines subtask assignments for the group of workers based on the task model and the parameters table. The assignment server determines an optimal subtask to assign to each worker based on the parameters.
US11941559B2
A method for automatically assessing project health and providing persona-based recommendations to improve the project health is provided. In some embodiments, the method includes identifying a set of metrics to be monitored for a project; calculating different levels of scores based on the set of metrics, each score being a health indicator of the project; analyzing the different levels of scores; identifying different levels of actions corresponding to the different levels of scores, an action being taken to improve an improvement area of the project; determining a user role of a user; identifying and providing a type of analytic view for the user based on the user role and analyzing the different levels of scores; and notifying the user to take the action corresponding to a level of scores based on the user role.
US11941553B1
The embodiment of the present disclosure discloses a method, an electronic device, and a storage medium for a ship route optimization. The method for the ship route optimization considers a dynamic feature of a multi-functional emergency rescue ship and an interference effect caused by an airflow, uses a movement model with kinematics non-holonomic constraints, such as a ship total cost assessment function to simulate the movement of the ship, and based on a sparrow search algorithm, learns how to apply the algorithm to a route plan of the emergency rescue ship. The method can improve the ship route optimization algorithm, improve an accuracy and practical applicability of a calculated plan. The method can effectively and accurately locate obstacles and hidden reefs, and consider effects of an airflow and a non-holonomic constraint effect, so as to make the route planning of the ship more efficient and intelligent.
US11941549B2
The management device of an autonomous driving vehicle includes a congestion rate calculation unit and a waiting place setting unit. The congestion rate calculation unit is able to calculate the congestion rate of a parking lot adjoining each of a plurality of commercial facilities. In a case where the congestion rate of a neighbor parking lot, or a parking lot in the neighborhood of a boarding place contained in reservation information for an autonomous driving vehicle reserved for dispatch, during a waiting time period before the scheduled boarding time, is less than a congestion threshold, the waiting place setting unit sets the neighbor parking lot as a waiting place for the autonomous driving vehicle to wait during the waiting time period.
US11941546B2
The invention is direct towards generating an expert template. The expert template is associated with an expert who can help guide a user. A user is associated with user goal data and a user goal. A user goal is an objective that the user wants to complete. A user is matched with an expert that matches the expert's field of expertise with the user's goals. An expert may provide input to the user regarding guidance and goals.
US11941544B2
Nominal values of parameters, and perturbations of the nominal values, that are associated with previously defined radiation treatment plans are accessed. For each treatment field of the treatment plans, a field-specific planning target volume (fsPTV) is determined based on those perturbations. At least one clinical target volume (CTV) and at least one organ-at-risk (OAR) volume are also delineated. Each OAR includes at least one sub-volume that is delineated based on spatial relationships between each OAR and the CTV and the fsPTV for each treatment field. Dose distributions for the sub-volumes are determined based on the nominal values and the perturbations. One or more dose prediction models are generated for each sub-volume. The dose prediction model(s) are trained using the dose distributions.
US11941541B2
Methods, computer program products and/or systems are provided that perform the following operations: obtaining a performance matrix representing accuracies obtained by executing a plurality of pipelines on a plurality of training data sets, wherein a pipeline comprises a series of operations performed on a data set; selecting a defined number of top pipelines as potential pipelines for a testing data set based, at least in part, on a similarity between the testing data set and each of the plurality of training data sets represented in the performance matrix; storing results from executing each of the potential pipelines as a new data set; determining a pipeline accuracy for each of the potential pipelines when executed against the testing data set; and providing a recommended pipeline for use with the testing data set based, at least in part, on the pipeline accuracy for each potential pipeline.
US11941535B2
This invention provides a computer-implemented method of modifying an algorithm operating on a computing system, and a device for implementing said method, the method comprising the steps of: applying the algorithm to a first set of inputs; determining a relevance score for a first input of the first set of inputs based on: a first effectiveness value of the first input, wherein the first effectiveness value represents a contribution of first input to the algorithm, and a first computational cost of the first input, wherein the 1 first computational cost represents the computational resources of using the first input in the algorithm; defining a second set of inputs based on the determined relevance score of the first input; and applying the algorithm to the second set of inputs.
US11941532B2
Disclosed is a method for adapting a deep learning framework to a hardware device based on a unified backend engine, which comprises the following steps: S1, adding the unified backend engine to the deep learning framework; S2, adding the unified backend engine to the hardware device; S3, converting a computational graph, wherein the computational graph compiled and generated by the deep learning framework is converted into an intermediate representation of the unified backend engine; S4, compiling the intermediate representation, wherein the unified backend engine compiles the intermediate representation on the hardware device to generate an executable object; S5, running the executable object, wherein the deep learning framework runs the executable object on the hardware device; S6: managing memory of the unified backend engine.
US11941531B1
Methods, systems, and apparatus, including computer programs encoded on a computer storage medium, for processing an input data element to generate a prediction output that characterizes the input data element. In one aspect, a method comprises: determining a respective attention weight between an input data element and each of a plurality of reference data elements; processing each of the reference data elements using the encoder neural network to generate a respective value embedding of each reference data element; determining a combined value embedding of the reference data elements based on (i) the respective value embedding of each reference data element, and (ii) the respective attention weight between the input data element and each reference data element; and processing the combined value embedding of the reference data elements using a prediction neural network to generate the prediction output that characterizes the input data element.
US11941530B2
The present invention concern systems and methods for maintaining diversity in AI and ML environments through the cooperation of various AI and ML systems such that they optimize for social and cultural diversity. The examination of behavior, infrastructure, and governance, mimicking of genetic biodiversity, and application of the foregoing to machine reasoning mitigates the tendency of systems to find optimized or single best solutions. AI and ML environments may thus derive multiple diverse solutions that contribute to richer ecosystems in which human beings may function and thrive.
US11941524B2
Methods and computer-readable media for repeated holdout validation include collecting independent data representing independent variables; collecting dependent data representing a dependent variable; correlating the independent data with the dependent data; creating a data set comprising the correlated independent and dependent data; generating a plurality of unique seeds; creating a plurality of training sets and a plurality of validation sets; associating each training set with a single validation set; training the neural network a plurality of times with the training sets and seeds to create a plurality of models; calculating accuracy metric values for the models using the validation sets associated with the training sets used to create respective models; performing a statistical analysis of the accuracy metric values; and ranking the independent variables by a strength of correlation of individual independent variables with the dependent variable, when a metric of the statistical analysis exceeds a threshold.
US11941523B2
Aspects described herein may allow for the application of stochastic gradient boosting techniques to the training of deep neural networks by disallowing gradient back propagation from examples that are correctly classified by the neural network model while still keeping correctly classified examples in the gradient averaging. Removing the gradient contribution from correctly classified examples may regularize the deep neural network and prevent the model from overfitting. Further aspects described herein may provide for scheduled boosting during the training of the deep neural network model conditioned on a mini-batch accuracy and/or a number of training iterations. The model training process may start un-boosted, using maximum likelihood objectives or another first loss function. Once a threshold mini-batch accuracy and/or number of iterations are reached, the model training process may begin using boosting by disallowing gradient back propagation from correctly classified examples while continue to average over all mini-batch examples.
US11941515B2
Disclosed are various embodiments of memristive devices comprising a number of nodes. Memristive fibers are used to form conductive and memristive paths in the devices. Each memristive fiber may couple one or more nodes to one or more other nodes. In one case, a memristive device includes a first node, a second node, and a memristive fiber. The memristive fiber includes a conductive core and a memristive shell surrounding at least a portion of the conductive core along at least a portion of the memristive fiber. The memristive fiber couples the first node to the second node through a portion of the memristive shell and at least a portion of the conductive core.
US11941513B2
Provided is a device for ensembling data received from prediction devices and a method of operating the same. The device includes a data manager, a learner, and a predictor. The data manager receives first and second device prediction results from first and second prediction devices, respectively. The learner may adjust a weight group of a prediction model for generating first and second item weights, first and second device weights, based on the first and second device prediction results. The first and second item weights depend on first and second item values, respectively, of the first and second device prediction results. The first device weight corresponds to the first prediction device, and the second device weight corresponds to the second prediction device. The predictor generates an ensemble result of the first and second device prediction results, based on the first and second item weights and the first and second device weights.
US11941511B1
Some embodiments of the invention provide a method for implementing a temporal convolution network (TCN) that includes several layers of machine-trained processing nodes. While processing one set of inputs that is provided to the TCN at a particular time, some of the processing nodes of the TCN use intermediate values computed by the processing nodes for other sets of inputs that were provided to the TCN at earlier times. To speed up the operation of the TCN and improve its efficiency, the method of some embodiments stores intermediate values computed by the TCN processing nodes for earlier sets of TCN inputs, so that these values can later be used for processing later set of TCN inputs.
US11941506B2
A system and method for determining abnormal conditions based on signals received from smart devices. The method includes receiving, via a controller and transmitted via one or more devices, one or more first signals indicative of one or more first statuses of the one or more devices. The method includes determining, via the controller and based on the one or more first statuses, a base model. The method includes receiving, via the controller and transmitted via the one or more devices, one or more second signals indicative of one or more second statuses of the one or more devices. The method includes comparing, via the controller, the one or more statuses to the base model and determining, via the controller and based on the comparison, an occurrence of an abnormal condition.
US11941503B2
A hybrid inference facility receives a sequence of data items. For each data item, the facility: forwards the data item to a server; subjects it to a local machine learning model to produce a local inference result for the data item; and the local inference result to a queue; aggregates the inference results contained by the queue to obtain an output inference result; and removes the oldest inference result from the queue. The facility receives from the server cloud inference results each obtained by applying a server machine learning model to one of the data items forwarded to the server. For each received cloud inference result, the facility substitutes the cloud inference result in the queue for the local inference result for the same data item.
US11941500B2
Disclosed is a system and a method for engagement of human agents for decision-making in a dynamically changing environment. An information request related to a problem requiring a decision is received. Further, problem data comprising metadata associated to the problem, and decision-making data is received. Then, an information type is determined for the information request. Subsequently a set of human agents from a list of one or more human agents is determined using an engagement model. Further, a request elicitation type is determined for the set of human agents using an elicitation model. Further, an input is received from the set of human agents. Further, the input is used to retrain the engagement model and the elicitation model. Finally, the decision-making data is continuously enhanced based on the input received, the request elicitation type, and the information type.
US11941495B2
An information processing device according to the present invention includes: a memory; and at least one processor coupled to the memory. The processor performs operations. The operations includes: extracting a feature of a period or a frequency in a plurality of pieces of time-series data acquired by measuring an object; classifying the pieces of time-series data into a group related to the feature; generating, for each of the groups, a model that represents a relationship among the pieces of time-series data classified into the group; and selecting the model in which strength of the relationship satisfies a predetermined condition.
US11941493B2
A method optimizes a training of a machine learning system. A conflict detection system discovers a conflict between a first training data and a second training data for a machine learning system, where the first training data and the second training data are ground truths that describe a same type of entity, and where the first training data and the second training data have different labels. In response to discovering the conflict between the first training data and the second training data for the machine learning system, an oracle adjusts the different labels of the first training data and the second training data. The machine learning system is then trained using the first training data and the second training data with the adjusted labels.
US11941484B2
A quantum contextual measurement is generated from a quantum device capable of performing continuous time evolution, by generating a first measurement result and a second measurement result and combining the first measurement result and the second measurement result to generate the quantum contextual measurement. The first measurement result may be generated by initializing the quantum device to a first initial quantum state, applying a first continuous time evolution to the first initial state to generate a first evolved state, and measuring the first evolved state to generate the first measurement result. A similar process may be applied to generate a second evolved state which is at least approximately equal to the first evolved state, and then applying another continuous time evolution to the second evolved state to generate a third evolved state, and measuring the third evolved state to generate the second measurement result.
US11941481B2
The present invention facilitates, in a two-dimensional symbol in which a region where additional data is recorded is provided in addition to a region where normal data is recorded, identification of colors of the regions where the respective data are recorded. Vertically and horizontally arranged first modules are provided, and by the coloration patterns of the first module, a finder pattern for detecting a symbol position, a timing pattern for specifying the center position of the first module, and a first recording region where first data can be recorded are formed. In at least a partial region, a second module is disposed in a portion that does not overlap the first module and includes an intermediate point between the first modules adjacent to each other, and a second recording region where second data can be recorded is formed by the coloration pattern of the second module.
US11941478B2
An apparatus for scanning and decoding barcodes includes an imager, a sample imaging area, and a processor. The imager is configured to capture images within a selectable field of view. The sample imaging area is configured to support a plurality of sample/tissue containers. Each sample/tissue container of the plurality of sample/tissue containers comprises a respective barcode. At least a portion of the plurality of sample/tissue containers are positioned within the field of view, such that a plurality of the respective barcodes is within the field of view. The processor is configured to receive captured images from the imager. The processor is configured to detect and decode each of the plurality of respective barcodes present in a first image of the captured images. The processor is also configured to define an associated region of interest for each barcode present in the first image.
US11941477B2
Systems and methods to validate RFID counts may be provided. A business may affix temporary or permanent location tags with barcodes throughout an area to be counted, and the location tags may then be recorded. Manual counters may perform a piece count of items associated with each location tag. RFID counters may perform an RFID read of items associated with each location tag. All RFID reads may be associated with their most likely location tag. The manual piece count may be compared to the total of RFID tags assigned to each location tag. Locations may be rejected where the totals do not match. Locations rejected by the manual piece count comparison may then be barcode scanned and compared to the RFID reads for each location tag required to be barcode scanned. Resolution may be performed for locations where the barcode item counts do not match the RFID item counts.
US11941475B2
A novel, miniaturized hand-held electronic peek device that is used to display real-time information to the magician/performer for entertainment purposes by consolidating information from all the electronic magic devices from multiple vendors to a single platform; wherein the device includes Bluetooth radio transceiver, a radio receiver, a high-resolution colour LCD, vibrator motor and charging port. These components are configured to receive radio signals from a myriad of electronic magic props items such as electronic dice, dominoes, poker chips, pens, crayons, cubes, motion sensors, movement sensors, magnet detectors and RFID/NFC Readers. The information that is communicated from electronic devices is communicated to the magician/performer through visual and haptic feedback.
US11941474B2
A card reader includes a pulling-out prevention member turnable between a closing position where a card moving passage is closed and an open position and preventing pulling-out of a card having been inserted into a card reader at the closing position. The pulling-out prevention member is provided with a main body member and a card abutting member which closes the card moving passage when the pulling-out prevention member is located at the closing position. A rear end of the card abutting member is capable of contacting with a front end of the card having been inserted into the card reader when the pulling-out prevention member is located at the closing position. The main body member of the pulling-out prevention member is formed of resin, and the card abutting member is formed of material having a strength higher than a strength of the resin.
US11941472B1
A communication system and method that includes a RFID tag writer to assign a unique identification to RFID tags, a series of personal communication devices, that have an RFID tag, a processor, a signal receiver and a display, and processors provide instructions to the displays to provide different light sequences in response to signals received, and a central controller that includes a processor, a transceiver and a memory, where the memory stores information relating to the RFID tags, user accounts and has an input device that allows users to be segregated into defined groups and stored, and the controller receives signals from tag readers and communication devices and transmit signals to the personal communication devices to affect the displays and the system uses a multiple gateways, to defined groups and each gateway transmitting on different frequencies and the system is configured to allow the communication devices to roam.
US11941468B2
A secure indicator includes a substrate, a barcode symbol that has a plurality of barcode modules provided on the substrate, and a security material positioned proximate the barcode symbol on the substrate. The security material is configured to be activated by irradiation at one or more predetermined activation wavelengths. Additionally, the barcode symbol is configured to be read (i) before the security material is activated and (ii) while the security material is activated.
US11941467B2
A display device includes a cover window comprising a flat portion and a curved portion connected to the flat portion; a printed layer disposed across the flat portion and the curved portion of the cover window; a buffer layer provided on the printed layer; a code printed layer provided on the buffer layer; and a plurality of grooves penetrating through the code printed layer.
US11941458B2
Examples described herein relate to migrating a virtualized execution environment from a first platform to a second platform while retaining use of namespace identifiers and permitting issuance of storage transactions by the virtualized execution environment. The first platform can include a first central processing unit or a first network interface. The second platform can include a central processing unit that is different that the first central processing unit and a network interface that is the same or different than the first network interface. The second platform can retain access permissions and target media format independent of one or more identifiers associated with the migrated virtualized execution environment at the second platform. Unperformed storage transactions can be migrated to the second platform for execution.
US11941453B2
The scheduling or allocation of images to nodes of a containerized computing environment is provided. Images that share layers (i.e. images that have one or more layers in common) are allocated to the same node. To determine whether different images share one or more layers, leveraging metadata that is associated with the images is provided. By analyzing metadata associated with the images, it may be determined if the images have one or more layers in common (i.e. comprise the same layer(s)). In this way, information that is already available with conventional images may be used.
US11941448B2
A computing device includes a processor and a machine-readable storage storing instructions. The instructions are executable by the processor to: determine a completed amount of data transferred for each of a plurality of data transfer jobs, each of the plurality of data transfer jobs to transfer data to a storage system; determine an estimated probability of failure for each of the plurality of data transfer jobs; and allocate computing resources of the storage system to the plurality of data transfer jobs based on the completed amount of data transferred and the estimated probability of failure of each of the plurality of data transfer jobs.
US11941440B2
A method includes: dequeuing a signal primitive from a signaling command queue in the set of command queues, the signal primitive pointing to a waiting command queue; in response to the signal primitive pointing to the waiting command queue, incrementing a number of pending signal primitives in the signal-wait counter matrix; dequeuing a wait primitive from the waiting command queue, the wait primitive pointing to the signaling command queue; in response to the wait primitive pointing to the signaling command queue, accessing the register to read the number of pending signal primitives; in response to the number of pending signal primitives indicating at least one pending signal primitive: decrementing the number of pending signal primitives; and dequeuing an instruction from the waiting command queue; and dispatching a control signal representing the instruction to a resource.
US11941438B2
Embodiments of the present disclosure provide a method, an electronic device, and a computer program product for using a virtual desktop. A method in one embodiment includes receiving, at a first edge node in a plurality of edge nodes, an instruction from a first set of input devices in a plurality of peripheral devices. The instruction is for use of a first virtual desktop deployed on the first edge node. The method further includes: using the first virtual desktop based on the instruction by using resources at the first edge node. The method further includes: sending data to an output device in the plurality of peripheral devices, wherein the data is associated with the use of the first virtual desktop. The solution for using a virtual desktop of the present application enables the use of a virtual desktop using resources at an edge node without requiring a client.
US11941429B2
A computer system including one or more processors and persistent, word-addressable memory implements a persistent atomic multi-word compare-and-swap operation. On entry, a list of persistent memory locations of words to be updated, respective expected current values contained the persistent memory locations and respective new values to write to the persistent memory locations are provided. The operation atomically performs the process of comparing the existing contents of the persistent memory locations to the respective current values and, should they match, updating the persistent memory locations with the new values and returning a successful status. Should any of the contents of the persistent memory locations not match a respective current value, the operation returns a failed status. The operation is performed such that the system can recover from any failure or interruption by restoring the list of persistent memory locations.
US11941422B2
Various approaches for exposing a virtual Non-Uniform Memory Access (NUMA) locality table to the guest OS of a VM running on NUMA system are provided. These approaches provide different tradeoffs between the accuracy of the virtual NUMA locality table and the ability of the system's hypervisor to migrate virtual NUMA nodes, with the general goal of enabling the guest OS to make more informed task placement/memory allocation decisions.
US11941408B2
During a boot-up processing of a computing device, such as an augmented reality wearable device, a static image and a bootup process progress bar may be encoded in a single image file, such as a bitmap image, and displayed in conjunction with updates that are applied to a hardware gamma table at various stages of the bootup process to create the effect of an animated progress bar.
US11941393B2
A system method of managing a software repository. The method including receiving a dataset comprising a set of computer instructions, retrieving feature-related data from the dataset, determining, by a machine learning model executing on the computing device, a function of the computer instructions based on the feature-related data, and generating a synopsis of the function of the computer instructions. The method can include transmitting the synopsis to a user interface and receiving feedback from a user indicative of whether the synopsis accurately describes the function of the computer instructions. If the feedback indicates that the synopsis accurately describes the function of the computer instructions, the method can include storing the synopsis in a memory of the computing device. If the feedback indicates that the synopsis inaccurately describes the function of the computer instructions, the method can include generating a revised synopsis of the function of the computer instructions.
US11941388B2
An update system includes: a first server that stores a control program; a second server that stores a common program; a difference extraction device that generates difference data between the common program and the control program; and a reprograming tool that transmits the difference data to a vehicle equipped with an ECU to be updated. The difference extraction device searches a search range by a search unit to find whether search target data of the control program is included in the common program, and generates the difference data. The search range includes, for example, an address of the search target data in the control program and addresses rearward of that address. An offset area is provided in a head area of the common program.
US11941384B2
A vehicle master device includes a rewrite specification data acquisition unit that is configured to acquire rewrite specification data from outside, a rewrite specification data analysis unit that is configured to analyze the rewrite specification data acquired by the rewrite specification data acquisition unit, a group generation unit that is configured to divide the plurality of rewrite target ECUs to generate a plurality of groups based on the rewrite specification data analyzed by the rewrite specification data analysis unit, and an instruction execution unit that is configured to instruct the plurality of rewrite target ECUs for each group of the plurality of groups generated by the group generation unit to perform at least one of installation, rollback, and activation.
US11941382B2
Disclosed herein is technology to use customized compiler attributes to check source code. An example method may include: accessing, by a processing device executing a compiler, a source code that comprises a compiler attribute associated with a programming construct, wherein the compiler attribute is defined in the source code; executing, by the processing device, a function of the compiler to check the programming construct at a location in the source code, wherein the function checks the programming construct by evaluating the compiler attribute associated with the programming construct; determining, by the processing device executing the compiler, whether to generate a message indicating a status of the check; and generating, by the processing device executing the compiler, object code based on the source code that comprises the compiler attribute.
US11941381B2
The invention provides methods and systems which enable additional functionality to be inserted into blockchain scripts with ease and in an effective and manner. According to one embodiment, the invention provides a blockchain-implemented method comprising the steps of arranging a plurality or selection of scripting language primitives to provide, upon execution, the functionality of a high-level scripting language primitive, wherein the scripting language is associated with a blockchain protocol; inserting the plurality of scripting language primitives at least once into a script; and inserting the script into blockchain transaction (Tx). The high-level scripting language primitive may perform, for example, an arithmetic operation such as multiplication or division. The scripting language primitives may be called op-codes, words or commands, and are native to the scripting language. The scripting language may be Script, and the blockchain protocol may be a version of the Bitcoin protocol.
US11941373B2
A deep learning model trained to learn to predict source code is tuned for a target source code generation task through reinforcement learning using a reward score that considers the quality of the source code predicted during the tuning process. The reward score is adjusted to consider code-quality factors and source code metrics. The code-quality factors account for the predicted source code having syntactic correctness, successful compilation, successful execution, successful invocation, readability, functional correctness, and coverage. The source code metrics generate a score based on how close the predicted source code is to a ground truth code.
US11941368B2
Certain embodiments of the disclosure relate to an apparatus and a method for translating a text included in an image by using an external electronic device in an electronic device. One method comprises displaying a picture comprising an object bearing text at a location within the picture on a display, extracting the text, generating another text from the extracted text, and automatically overlaying the another text on the object in another picture comprising the object at another location within the another picture on the display.
US11941359B2
Methods and systems for identifying anatomical phrases in medical text. Methods and systems described herein use a syntactic approach to generate lists of relevant terms and define a grammar on these terms. Methods and systems described then search for phrases in text that conform to the grammar.
US11941356B2
Embodiments described herein propose a densely connected Transformer architecture in which each Transformer layer takes advantages of all previous layers. Specifically, the input for each Transformer layer comes from the outputs of all its preceding layers; and the output information of each layer will be incorporated in all its subsequent layers. In this way, a L-layer Transformer network will have L(L+1)/2 connections. In this way, the dense connection allows the linguistic information learned by the lower layer to be directly propagated to all upper layers and encourages feature reuse throughout the network. Each layer is thus directly optimized from the loss function in the fashion of implicit deep supervision.
US11941338B2
Integrated circuits (IC) are provided. An IC includes a plurality of macros and a top channel. Each macro includes a macro boundary and a main pattern surrounded by the macro boundary. The top channel includes a plurality of first and second sub-channels. Each first sub-channel is arranged between a first macro and a second macro, and is formed by a plurality of first dummy boundary cells. Each second sub-channel is arranged between two of the second macros, and is formed by a plurality of second dummy boundary cells. The macro boundaries of the first macros are formed by the first dummy boundary cells, and the macro boundaries of the second macros are formed by the second dummy boundary cells. A first gate length of dummy patterns within the first dummy boundary cells is greater than a second gate length of dummy patterns within the second dummy boundary cells.
US11941332B2
Aspects of the disclosure relate to space model generation. A computing platform may receive space program data identifying parameters of a physical space. The computing platform may load a geometry model defining a plurality of design rules. The computing platform may generate space models for the physical space based on the space program data and the geometry model. Based on the geometry model, the computing platform may produce a score for each space model. Based on the scores, the computing platform may produce a ranked list of space models. The computing platform may generate user interface data comprising the ranked list of space models. The computing platform may send the user interface data comprising the ranked list of space models, which may cause a user computing device to display a user interface including a portion of the ranked list of space models.
US11941326B2
The present invention is a computer-implemented method for constructing the foundation of a building, comprising; receiving nodal data associated with the structure design; propagate, member data of the structural frame; analyzing, the member data of the structural frame and the nodal data; applying, a series of loads to the structural frame; generating, a deflection model of the structural frame; and determining, by one of more processors, if any of the members failed and determining the strengthening requirements for the failed members.
US11941320B2
An electronic monitoring system has one or more imaging devices that can detect at least one triggering event comprising sound and motion and a controller that executes a program to categorize the triggering event as being located in a user-defined activity zone within the field of view and/or as being a taxonomic-based triggering event. Upon categorizing the triggering event, the system generates an output comprising a video component and an audio component. At least a portion of the audio component is modified if the triggering event is a categorized triggering event. Modification of the audio may include muting all or a portion of the audio component of the output.
US11941318B2
The present application provides an audio and video playing system, a playing method and a playing device. The system comprises: a display device; a directional sound output module configured to output a directional sound signal; a tracking element configured to monitor a target visual area and to monitor the target display area on the display screen; and a processor, connected with the directional sound output module and the tracking element respectively, and configured to acquire a first audio and video data to be output in the target display area, display image information of the first audio and video data in the target display area, and output sound information of the first audio and video data to the directional sound output module such that the directional sound output module output a directional sound signal towards the target visual area.
US11941316B2
A vehicle information display apparatus may include: an input unit configured to receive pre-setting information from a user terminal; a memory configured to store a program for controlling an interior display in consideration of the pre-setting information, as a vehicle starts driving; and a processor configured to execute the program, wherein the processor controls the interior display divided into pre-set areas in consideration of the pre-setting information, such that a screen is displayed on each of the areas.
US11941309B2
An information processing system is provided for supporting trust printing that prints a document to be printed by registering the document in a document assurance system that assures authenticity of the document. The system obtains information of usable image formation apparatuses, and provides a setting screen of an image formation apparatus selected from the usable image formation apparatuses based on the information, and causes the selected image formation apparatus to print the document to be printed in accordance with setting on the setting screen. The information contains information indicating whether the selected image formation apparatus is capable of the trust printing, and, in the providing, if the selected image formation apparatus is incapable of the trust printing, the setting screen is displayed such that a setting item for the trust printing cannot be selected.
US11941302B2
Techniques for managing disks involve determining performance information of an access pattern of a disk slice based on differences in performance parameters of the access pattern of the disk slice on a plurality of disks. Such techniques further involve determining a score for the disk slice based on the performance information and access frequency information of the disk slice. Such techniques further involve determining a position of the disk slice in the plurality of disks based on the score.
US11941297B2
Techniques are provided for implementing garbage collection and bin synchronization for a distributed storage architecture of worker nodes managing distributed storage composed of bins of blocks. As the distributed storage architecture scales out to accommodate more storage and worker nodes, garbage collection used to free unused blocks becomes unmanageable and slow. Accordingly garbage collection is improved by utilizing heuristics to dynamically speed up or down garbage collection and set sizes for subsets of a bin to process instead of the entire bin. This ensures that garbage collection does not use stale information about what blocks are in-use, and ensures garbage collection does not unduly impact client I/O processing or conversely falls behind on garbage collection. Garbage collection can be incorporated into a bin sync process to improve the efficiency of the bin sync process so that unused blocks are not needlessly copied by the bin sync process.
US11941290B2
A memory access command to be performed on a die of a memory device is received, wherein the memory access command comprises a base partition number and a base page address. The memory access command is converted into a plurality of commands based on a number of partitions associated with the die. A respective partition number derived from the base partition number is determined for each command of the plurality of commands. A respective page address associated with each command of the plurality of commands is determined using the base page address. The plurality of commands is executed using, for each command of the plurality of commands, the respective partition number and the respective page address.
US11941279B2
In a particular embodiment, a virtual namespace identifier is mapped to one or more volumes stored among a pool of storage resources, wherein at least a first storage system and a second storage system are utilized to provide the storage resources. The virtual namespace identifier is migrated among the pool of storage resources to virtualize a data path for the one or more volumes.
US11941277B2
An example memory sub-system includes a memory device and a processing device, operatively coupled to the memory device. The processing device is configured to initiate a scan process on a plurality of block families of the memory device; responsive to determining, based on the scan process, that a first block family of the plurality of block families and a second block family of the plurality of block families meet a combining criterion, merge the first block family and the second block family; and responsive to determining that a terminating condition has been satisfied, terminate the scan process.
US11941276B2
Aspects of the present disclosure configure a system component, such as a memory sub-system controller, to provide superbkock management based on memory component reliabilities.
US11941260B2
Techniques of implementing software filtered non-volatile memory in a computing device are disclosed herein. In one embodiment, a method includes detecting an entry being written to a guest admin submission queue (gASQ) by a memory driver of a virtual machine hosted on the computing device. Upon detecting the entry written to the gASQ by the memory driver, the command in the entry is analyzed to determine whether the command is allowed based on a list of allowed or disallowed commands. In response to determining that the command in the entry is not allowed, without sending the command to the non-volatile memory, generating an execution result of the command in response to the entry being written to the gASQ by the memory driver. As such, potentially harmful commands from the memory driver are prevented from being executed by the non-volatile memory.
US11941259B2
A communication method applied to a computer system that includes a first subsystem and a second subsystem. A safety level of the first subsystem is higher than a safety level of the second subsystem. The first subsystem includes a memory access checker. The method includes the memory access checker receives a memory access request from a memory access initiator, determines, based on preconfigured memory safety level division information, whether a safety level of a memory to be accessed by the memory access initiator matches a safety level of the memory access initiator, and allows the memory access initiator to access the memory address when the safety level of the memory matches the safety level of the memory access initiator.
US11941258B2
A system includes a memory device, and a processing device, operatively coupled with the memory device, to perform operations including detecting a failure of a key-value store, identifying a non-filled zone of the memory device resulting from the failure, wherein the non-filled zone stores, in the key-value store, at least one of: an uncommitted key block or an uncommitted value block, and recovering the non-filled zone to obtain a recovered zone.
US11941247B2
According to one embodiment, a storage device includes a non-volatile memory and a control unit that is electrically connected to the non-volatile memory and that is configured to control the non-volatile memory. The control unit is configured to manage a plurality of management areas obtained by logically partitioning storage area of the non-volatile memory, when a write request is received that includes data for which a valid term has been set, determine, based on the valid term, a first management area from among the management areas, write the data included in the write request to the determined first management area, and when the data written to the first management area is erased, collectively erase all data written in the first management area which includes the data.
US11941242B2
Provided in the present invention are an entry information processing method, a terminal device, and a computer-readable storage medium. The method comprises: in response to a slide operation with respect to entry information, determining a target event corresponding to the slide operation, then, when the slide distance of the slide operation reaches a first threshold, activating the target event, and then, when the slide distance reaches a second threshold, processing the entry information according to the target event, where the second threshold is greater than the first threshold.
US11941241B2
One or more embodiments of the present disclosure include a content navigation system that allows a user to search, browse, and otherwise experience a collection of digital content items. For example, the content navigation system can provide a graphical user interface including a scroll element. One or more embodiments of the scroll element can include various navigational functions that provide a user-friendly interface for browsing and experiencing a collection of digital content items. Furthermore, the content navigation system can provide methods and systems for a user to easily configure the way in which the digital content items are organized within the user interface, thereby customizing the user's browsing experience.
US11941224B2
Methods, systems, and apparatus, including medium-encoded computer program products, for controlling a virtual camera in a three dimensional environment displayed on a two dimensional touchscreen display include: presenting on the two dimensional touchscreen display a camera view into the three dimensional environment; receiving input indicating a single touch by a user on the two dimensional touchscreen display, the single touch including a slide across the two dimensional touchscreen display; and updating, in response to the input, the camera view into the three dimensional environment presented on the two dimensional touchscreen display, the updating including rotating the camera view in accordance with a first direction of the input across the two dimensional touchscreen display, and changing a distance of the camera view in accordance with a second direction of the input across the two dimensional touchscreen display.
US11941221B2
A touch sensor includes a sensing part in which a plurality of sensing cells is arranged and connected and a wiring part connected to the sensing part and formed outside the sensing part. The wiring part includes a first divisional wiring part having a plurality of first divisional wires having a connecting protrusion with a width larger than that of the wiring at one end thereof and a second divisional wiring part having a plurality of second divisional wires having one end thereof with a width smaller than that of the connecting protrusion and coupled to and overlapped with the connecting protrusion. The first divisional wiring part and the second divisional wiring part are formed by divisional exposure.
US11941219B2
A touch sensor includes a base layer including a sensing area and a non-sensing area; and a sensor electrode disposed in the sensing area and including sensor patterns. The sensing area may include a first area including at least one non-square boundary with a predetermined curvature and a second area not including the non-square boundary. In an exemplary embodiment of the present inventive concept, sensor patterns disposed in the first area and sensor patterns disposed in the second area among the sensor patterns may have different sizes from each other.
US11941218B2
The invention relates to an input device comprising: a touch-sensitive input surface facing towards an operator (B); a detection device for the spatially resolved detection of an approach towards and touch on the touch-sensitive input surface having a sensor array for capacitive and/or inductive detection, which extends parallel to the input surface; an input part, which is disposed on the input surface and mounted so as to be movable from a rest position (X0) into an actuation position (XE) along an actuating direction (B1) extending perpendicularly to the input surface, for enabling a performance of an operating input by the operator (B) through a manual displacement of the input part along the actuating direction (B1); a position indicator for contactless position detection, which is attached to the input part and cooperates with the detection device; restoring means for generating a restoring force (F) with snap haptics counteracting the manual shifting from the rest position (X0); wherein the detection device is designed for acquiring a course over time of an approach towards the touch-sensitive input surface by means of a course over time of a sensor signal (Z(t)) of the detection device and to analyze the course over time of the sensor signal (Z(t)) and/or an associated frequency spectrum, and is further designed to assign a switching or controlling function exclusively if it was found in the preceding analysis that the course over time of the sensor signal (Z(t)) and/or the associated frequency spectrum has characteristics that are predefined by the snap haptics.
US11941215B2
According to various embodiments of the present invention, an electronic device may comprise a touch layer in which a sensor may be disposed below a designated area, wherein the touch layer comprises: a first touch line including a first touch electrode and a second touch electrode arranged in a first direction in the designated area; a second touch line including a third touch electrode and a fourth touch electrode arranged in a second direction while crossing the first touch line in the designated area; a first opening formed in the area where the first touch line and the second touch line cross each other; and a first connection wiring disposed in the peripheral portion of the first opening and connecting the first touch electrode and the second touch electrode to each other. Various other embodiments are also possible.
US11941211B2
In some examples, a touch screen can include touch electrodes that can function as drive (Tx) electrodes and sense (Rx) electrodes during a touch sensing operation of the electronic device. The drive electrodes can include +Tx electrodes and −Tx electrodes that can receive drive signals that can have the same amplitude and frequency and opposite phases, for example. In some examples, the surface areas of the +Tx electrodes and the −Tx electrodes can be the same and the distances of the +Tx electrodes and −Tx electrodes from the Rx electrodes can be different. In some examples, the total charge coupled to a proximate or touching object can be zero, which can mitigate problems associated with ungrounded or poorly grounded objects in contact with the touch screen.
US11941209B2
Provides in the present disclosure are a touch module, a preparation method therefor, and a display device. The touch module is formed by means of attaching a polarizing function layer to a side of a touch function layer by a first bonding layer; attaching a cyclo olefin polymer (COP) film layer to another side of the touch function layer by a second bonding layer; and attaching a third bonding layer to a side, facing away from the second bonding layer, of the COP film layer.
US11941206B2
A touch control component and a touch control display device are provided. The present disclosure can improve touch control sensitivity of the touch control component by at least one second branch electrode surrounding at least one first branch electrode corresponding thereto, by at least one third branch electrode adjacent to the at least one first branch electrode surrounding the at least one second branch electrode positioned between the at least one first branch electrode and the at least one third branch electrode, and by two adjacent third branch electrodes respectively positioned in two of touch control units adjacent to each other in a first direction being connected to each other on one end away from the third branch electrodes connected to a first main stem electrode.
US11941204B2
The present disclosure relates to a display device that can reduce a difference between the load connected to scan lines around a notch area and the load connected to scan lines in the entire display area. According to an embodiment of the disclosure, a display device comprising a display panel comprising a display area that includes a first display area, and a second display area and a third display area disposed adjacent to the first area, a touch detector, a scan driver circuit, and a touch driver circuit supplying a touch driving signal to touch electrodes of the touch detector, wherein the touch driver circuit changes a pulse width or an output timing of the touch driving signal while images are displayed on at least one of the first to third display areas and supplies the touch driving signal to the touch electrodes.
US11941200B2
An NFC-enabled apparatus is disclosed. The apparatus includes a touch screen display and a near field communication (NFC) module comprising an NFC antenna and an NFC controller. In response to tagging between the NFC-enabled apparatus and the external NFC terminal, an NFC communication channel is established between the NFC-enabled apparatus and the external NFC terminal for data communication therebetween.
US11941199B2
An electronic apparatus includes a touch panel with a detection function, an antenna for near field communication, a proximity sensor configured to detect proximity of a communication medium and located near the touch panel, and a processor. In a case that the proximity sensor detects the proximity of the communication medium for communicating with the antenna, the processor sets an operating mode of the electronics apparatus to a near field communication mode for a wireless transmission by the antenna and stops the detection function of the touch panel.
US11941197B2
A novel functional panel that is highly convenient, useful, or reliable is provided. The functional panel includes a first driver circuit, a second driver circuit, and a pixel set, the first driver circuit has a function of supplying a first selection signal and a second selection signal, a second driver circuit has a function of supplying an image signal and a control signal, and the control signal includes a first level and a second level. The pixel set includes a first pixel, and the first pixel includes a first element and a first pixel circuit. The first pixel circuit has functions of obtaining the image signal on the basis of the first selection signal, obtaining the control signal on the basis of the second selection signal, and holding a first state to a third state. The first element is electrically connected to the first pixel circuit, performs display with first brightness on the basis of the first state, performs display with second brightness on the basis of the second state, and performs display using the image signal on the basis of the third state. The first brightness is darker than the second brightness.
US11941194B2
Provided is an electronic pen cartridge that is replaceable and constitutes an electronic pen by being attached to a cylindrical outer housing having a hollow portion inside, the electronic pen cartridge including an inner housing that is cylindrical, a circuit board housed in the inner housing, a pen pressure detector provided in the inner housing on a side of the inner housing adjacent to a pen tip, a core body that is rod-shaped and presses the pen pressure detector, and a coil provided at a position closer to the pen tip than the inner housing and having a first end and a second end connected to the circuit board, in which at least the coil is covered with a sealing portion made of resin.
US11941184B2
A method for dynamically initializing a 3 degrees of freedom (3DOF) tracking device is described. In one aspect, the method includes accessing a gyroscope signal from a gyroscope of the 3DOF tracking device, accessing an accelerometer signal from an accelerometer of the 3DOF tracking device, determining an initial state includes a combination of an initial orientation, an initial position, and an initial velocity of the 3DOF tracking device, the initial state indicating a starting condition of the 3DOF tracking device, integrating the gyroscope signal and the accelerometer signal to obtain orientation and position signals using the initial state, and refining an inclination signal of the orientation signal using the position signal.
US11941181B2
A mechanism to provide visual feedback regarding computing system command gestures. An embodiment of an apparatus includes a sensing element to sense a presence or movement of a user of the apparatus, a processor, wherein operation of the processor includes interpretation of command gestures of a user to provide input to the apparatus; and a display screen, the apparatus to display one or more icons on the display screen, the one or more icons being related to the operation of the apparatus. The apparatus is to display visual feedback for a user of the apparatus, visual feedback including a representation of one or both hands of the user while the one or both hands are within a sensing area for the sensing element.
US11941180B2
Electronic device for obtaining user input through virtual keyboard and method of operating the same
An electronic device is provided and includes a camera, a display, and a processor. The processor may be configured to control the display to display a second image determined based on a posture of the electronic device from a first image obtained using the camera, detect a finger object from the second image, identify a first virtual key corresponding to the finger object from a virtual keyboard based on a position and a degree of bending of the finger object, and identify an input of the first virtual key based on detecting a typing movement of the finger object. Other embodiments may also be possible.
US11941165B2
A temperature stimulus presentation device includes a presentation unit that generates heat at a predetermined temperature, and a control unit that changes an area of the presentation unit depending on whether or not a temperature stimulus is presented.
US11941160B2
A method includes transmitting an instruction to a motive power supply of an elastically deformable device to drive the elastically deformable device in accordance with a drive setting; measuring a force exerted on the elastically deformable device with a sensor; outputting an observed value representative of the force; comparing the observed value with a reference value corresponding with a predetermined force to be exerted on the elastically deformable device; and adjusting the drive setting based on a determination that the observed value is outside of a predetermined range of the reference value. The method prevents slack in the elastically deformable device over time. Related apparatuses, systems, techniques and articles are also described.
US11941157B2
A computer implemented method for managing the scope of permissions granted by users to application that includes collecting a set of permissions for an application from an application provider publication; and collecting a process flow for functional steps of the application from a review of the application that is published on a product review type publication. The computer implemented method further includes dividing the functional steps of the application into a plurality of journeys, each of said plurality of journeys having a function associated with a stage of a functional step from a perspective of a user; and matching permissions from the set of permissions for each journey of said plurality of journeys to provide matched permissible permissions to journeys stored in a customer journey store.
US11941156B1
The disclosed computer-implemented method for managing privacy policy violations may include obtaining, by the computing device, an intermediate representation of a privacy policy, wherein the intermediate representation denotes a formal policy and is generated by extracting the privacy policy in natural language from a website and parsing the privacy policy. The method may also include comparing, by the computing device, behavior of the website against the intermediate representation, thereby detecting at least one violation of the formal policy. The method may further include enforcing, by the computing device, the formal policy at least in part by taking a security action in response to the violation. Various other methods, systems, and computer-readable media are also disclosed.
US11941154B2
Method and system of securing personally identifiable and sensitive information in conversational AI based communication. The method comprises enabling a first service provider device as a communication channel provider of an incoming communication mode and enabling a second service provider device s a communication channel provider of an outgoing communication mode, at least one of the incoming communication and outgoing communication modes comprising an audio communication, storing content of a conversation in the incoming communication mode in a first storage medium accessible to the first service provider device but not the second service provider device, and storing content of the conversation in the outgoing communication mode at a second storage medium accessible to the second service provider device but not the first service provider device, and anonymizing the audio communication wherein personally identifiable audio characteristics of the user are obfuscated from the service provider devices.
US11941147B2
Methods, systems, and computer program products for detection of personally identifiable information (PII). A first detector and a second detector are configured to interoperate. The first detector is different from the second detector and the second detector incurs a greater computational cost than the first detector when processing identical content. Content is presented to the first detector so as to implement a first type of PII detection that is based at least in part on regular expression analysis using regular expressions. The content is presented to the second detector. The second detector performs PII detection based on content analysis that is different from the first detector's regular expression analysis. The second detector causes generation of new regular expressions based on the content analysis and the first detector is updated with such new regular expressions. Performance of the first detector is continually improved as new regular expressions are generated.
US11941133B2
One aspect provides an FPGA chip mounted on a printed circuit board (PCB). The FPGA chip can include a joint test action group (JTAG) interface comprising a number of input/output pins and an enablement pin, and a control logic block coupled to the enablement pin of the JTAG interface. The control logic block can receive a control signal from an off-chip control unit and control a logical value of the enablement pin based on the received control signal, thereby facilitating the off-chip control unit to lock or unlock the JTAG interface. The FPGA chip can further include a detection logic block to detect an unauthorized access to the FPGA chip. An input to the detection logic is coupled to the enablement pin, and a conductive trace coupling the input of the detection logic block and the enablement pin is situated on an inner layer of the PCB.
US11941118B2
A method for building a robust classifier against evasion attacks includes receiving an application, identifying one or more features of the application, and determining a first confidence score for a first version of the application including a first set of features and determining a second confidence score for a second version of the application including a second set of features, the first set of features is different than the second set of features. The method also includes determining a difference between the first confidence score and the second confidence score, and comparing the difference with a convergence threshold. The method includes, based on the comparison, determining whether the first confidence score exceeds a confidence score threshold, and generating a report based on determining the first confidence score exceeds the confidence score threshold.
US11941108B2
An apparatus, a method, and a system are presented in which the apparatus includes an interface control circuit that may be configured to receive a message including a cryptographic keyword and a policy value. The policy value may include one or more data bits indicative of one or more policies that define allowable usage of the cryptographic keyword. The apparatus also includes a security circuit that may be configured to extract the cryptographic keyword and the policy value from the message, and to apply at least one policy of the one or more policies to usage of the cryptographic keyword in response to a determination that an authentication of the message succeeded.
US11941105B2
Authentication information is acquired from a storage medium through near field communication in one authentication device. Whether the authentication information corresponds to one substrate processing apparatus at which the authentication device is provided is determined. In a case where the authentication information corresponds to the one substrate processing apparatus, access information is transmitted from the authentication device through near field communication. An instruction terminal receives the access information through near field communication. The instruction terminal accesses a maintenance instruction device based on the access information, whereby a maintenance screen is displayed on a display of the instruction terminal. The instruction terminal has an operation unit to be operated by a user in order to provide an instruction for performing a maintenance operation.
US11941104B2
In one embodiment, a system receives an exec function invocation request from a second application to run a first application from an executable file. In response to receiving the exec function invocation request, the system determines a working directory associated with the second application. The system determines one or more extended attribute values associated with the working directory. The system determines, in view of the one or more extended attribute values, whether to allow or deny the first application to use the working directory to run the executable file of the first application.
US11941102B2
In illustrative implementations, shape is used to encode computer passwords or other information. The passwords may be easy for a human to remember—and yet have an extremely high number of permutations (e.g., in some cases, greater than 1030 permutations, or greater than 10261 permutations, or greater than 106264 permutations). This combination of a password being easy for a human to remember—yet having a large number of permutations—offers many practical benefits. Among other things, the huge number of permutations makes the password extremely resistant to guessing attacks. In addition, in some cases, the passwords that are created with the shapes are highly resistant to attacks by keystroke logging, mouse logging, touch-gesture logging, screen logging, shoulder surfing, phishing, and social engineering. Alternatively, the shapes may be used to encode other information, such as information that uniquely identifies a product or a machine part.
US11941095B2
System and method of retrieving and conveying sensitive information when using voice command devices
A method and system of providing private data privately when such data is requested from a VCD utilizes a communications network to communicate with a service containing the private data to determine if the data is private. Once the data is determined as being private, instead of being sent to the VCD to be broadcasted audibly, the data may be transmitted to a user's preferred device to be presented privately to the user.
US11941093B2
Disclosed herein is an identity network that provides a universal, digital identity for users to be authenticated by an identity provider for relying parties upon sign-in to the relying party. The identity network receives the sign-in request from a relying party for a user using a user device. The identity network can provide a session identifier to the relying party for the request and launch an identity provider application associated with the user via a software development kit in the relying party application. The user may sign-in to the identity provider via the software development kit, thereby authenticating the user for the relying party. Additionally, the identity provider may generate a risk validation score and provide it to the relying party that provides a confidence value that the user is validly using the user device and a risk score based on device activity on the identity network.
US11941091B2
An information processing system for receiving a service using an electronic device, the information processing system includes an acquisition section configured to acquire a license key for using the service issued by a server system and a processing section. The license key includes setting information to be used when the electronic device uses the service. The processing section acquires the setting information included in the acquired license key and performs setting processing of the electronic device based on the acquired setting information.
US11941086B2
Embodiments described herein embodiments described herein provide Contrastive Attention-Supervised Tuning (CAST), a training method to fix the visual grounding ability of contrastive SSL methods based on a data augmentation strategy using unsupervised saliency maps. In addition to the contrastive loss that encourages the model to pick the crop that comes from the corresponding image, CAST provides an explicit grounding supervision through a Grad-CAM based attention loss that enforces models to look at the specified object of interest that is common across different crops when making this decision. A new geometric transform is introduced for randomly cropping different views from an input image based on certain constraints derived from a saliency map.
US11941084B2
A method for training a machine learning model includes obtaining a set of training samples. For each training sample in the set of training samples, during each of one or more training iterations, the method includes cropping the training sample to generate a first cropped image, cropping the training sample to generate a second cropped image that is different than the first cropped image, and duplicating a first portion of the second cropped image. The method also includes overlaying the duplicated first portion of the second cropped image on a second portion of the second cropped image to form an augmented second cropped image. The first portion is different than the second portion. The method also includes training the machine learning model with the first cropped image and the augmented second cropped image.
US11941078B2
Performing set operations using sparse matrix operations offered by a multi-core processing unit (such as a graphics processing unit). The set operation is converted into operand matrices, and sparse matrix operations, foregoing the use of hash tables. The input set is converted into a matrix, a matrix operation corresponding to the set operation is identified, and one or more operands of the set operation are also represented within a matrix. The matrix operation is then performed on these matrices to obtain an output matrix, which is then converted to an output set.
US11941065B1
Systems and methods are described for generating record clusters. The methods comprise receiving a plurality of records from data sources and providing at least a subset of the records to a scoring model that determines scores for various pairings of the records, a score for a given pair of the records representing a probability that the given pair of records contain data elements about the same entity. The method further comprises generating a graph data structure that includes a plurality of nodes, individual nodes representing a different record from the records. The method also comprises assigning a different unique identifier to individual clusters of the final clusters and responding to a request for data regarding a given entity by providing aggregated data elements from those records of the records associated with a cluster of the final clusters having an identifier that represents the given entity.
US11941060B2
Described are methods, systems and computer readable media for computer data distribution architecture for efficient distribution and synchronization of plotting processing and data.
US11941059B2
Systems and methods are described herein for generating a search query using flexible autocomplete suggestions. A text input is received, and a plurality of portions of the text input, each corresponding to a different search parameter, are identified. For each of the identified portions, at least one suggested alternate text is retrieved based on the corresponding attribute, and a user interface element is generated for display in which the original text of the respective portion is displayed, along with the suggested alternate texts for that portion, which are selectable by the user. Upon receiving selection of a suggested alternate text in at least one user interface element, a search query is generated based on each portion for which no alternate has been selected, and each selected alternate text. Search request are retrieved in response to the search query, and the results are generated for display to the user.
US11941056B2
The present disclosure relates to a method for a weighting graph comprising nodes representing entities and edges representing relationships between entities in accordance with one or more domains. The method comprises: pre-processing the graph comprising assigning weights to the nodes and/or the edges of the graph in accordance with a specific domain of the domains, wherein the weight indicates a domain specific data quality problem of attribute values representing an edge of the edges and/or an entity involved in that edge. The weighted graph may be provided for enabling a processing of the graph in accordance with the specific domain.
US11941053B1
In response to receiving a tagging request to map a first non-fungible token (NFT) to a first user device, a processor transmits an authorization request to a second user device to map the first NFT to the first user device. In response to receiving an approval of the request, the processor transmits a request to a minting server of an NFT blockchain network to generate the first NFT for the first user device. The processor stores a token ID of the generated first NFT in a memory. In response to receiving a second authorization from the first user device to perform a data interaction, the processor requests the NFT blockchain network based on the token ID, verification of the first user device. In response to receiving an indication that the first user device is verified, the processor processes the data interaction.
US11941051B1
A computing device generates a call in a programming language of a computing application requesting a feature of videos stored in a media repository. A query system receive the call and determines a command associated with obtaining the feature requested by the call. The determined command corresponds to an image analysis to perform on at least a portion of the stored videos. The query system determines, based at least in part on the determined command, an artificial intelligence model to execute on at least the portion of the stored videos. The query system determine, by executing the determined artificial intelligence model, a model output that includes the requested feature. The query system provides, in the programming language of the computing application, an indication of the requested feature.
US11941045B2
There is provided with an image searching apparatus. A searching unit searches a plurality of search target images for an image relating to a query image based on a first similarity to the query image by a first evaluation scheme. A first obtaining unit obtains a feedback indicating correct or incorrect regarding the searched image. A second obtaining unit obtains an evaluation of an effect of changing a similarity evaluation scheme to a second evaluation scheme from the first evaluation scheme in accordance with the feedback. A control unit controls, in accordance with the evaluation of the effect, a search of the plurality of search target images for the image relating to the query image based on a second similarity to the query image by the second evaluation scheme.
US11941038B2
Systems, methods and/or computer program products for controlling and visualizing topic modeling results using a topic modeling interface. The interface allows user directed exploration, understanding and control of topic modeling algorithms, while offering both semantic summaries and/or structure attribute explanations about results. Explanations and differentiations between results are presented using metrics such as cohesiveness and visual displays depicting hierarchical organization. Through user-manipulation of features of the interface, iterative changes are implemented through user-feedback, adjusting parameters, broadening or narrowing topic results, and/or reorganizing topics by splitting or merging topics. As users trigger visual changes to results being displayed, users can compare and contrast output from the topic modeling algorithm. With each change to parameters, users view different explanations informing the user why the changes being displayed occurred, providing users deeper understanding of the topic modeling process, how to manipulate parameters to achieve accurate topic results and adjust granularity of information presented.
US11941035B2
The present application provides a summary generation model training method, apparatus, electronic device, and non-transitory computer readable storage medium. The summary generation model training method includes: obtaining a first vector set, where vectors in the first vector set are original encoding vectors which have been trained; generating a second vector set based on the first vector set, where the number of vectors in the second vector set is greater than the number of the vectors in the first vector set, and each vector in the second vector set is determined according to one or more vectors in the first vector set; and taking the vectors included in the first vector set and the vectors included in the second vector set as input encoding vectors to perform model training to obtain a summary generation model.
US11941033B2
The disclosure is directed at a method and system for improved search functionality. By using natural language processing (NLP), individual words in a search term may be parsed and then individually stored. The relationships between the individual words of the search term may also be stored such that when the search is repeated, the previous results may be retrieved and, if not, a more accurate search may be performed.
US11941030B2
Methods, non-transitory machine readable media, and computing devices that provide more efficient hierarchical propagation in tree structures are disclosed. With this technology, a first delta record for a first interior node is created optionally in an atomic transaction along with updating a first tally record for a leaf node based on a first value. The transaction is in response to an action associated with the leaf node and the first interior node is a parent of the leaf node in a hierarchical tree. A timer associated with the first delta record is then set. A second value is updated in a second tally record for the first interior node based on the first value, when the timer has expired. Accordingly, this technology advantageously maintains recursive properties or values throughout a hierarchical tree continually, with reduced cost, even in a distributed network and in hierarchical trees with large numbers of nodes.
US11941028B2
Embodiments are directed to distributing records among storage partitions by maintaining a table of records. The table of records can be indexed based on an original partitioning key in the table of records. A plurality of counters can be initialized with each counter associated with a sub-range in a total range of key values for a secondary index partitioning key. Each record of the table of records can be read and a count of records in the associated sub-range can be accumulated in each counter. The number of records per partition can be determined based on the total number of records in the total range of key values and the number of available partitions and the records can be distributed to the available partitions in the storage system based on the number of records in each sub-range.
US11941024B1
Techniques for implementing an orchestration service for data replication are provided. In one technique, a recipe is stored that comprises (1) a set of configuration parameters and (2) executable logic, for a data replication operation, that comprises multiple sub-steps. Each sub-step corresponds to one or more configuration parameters in the set of configuration parameters, which includes a first parameter that is associated with a default value and a second parameter that is not so associated. User input that specifies a value for the second parameter is received. The set of configuration parameters is updated to associate the value with the second parameter. The data replication operation is then initiated by processing the executable logic, which processing comprises, for each sub-step of one or more sub-steps, making an API call to a data replication service. In response to each API call, a response is received from the data replication service.
US11941008B2
The CONVERGED MERCHANT PROCESSING APPARATUSES, METHODS AND SYSTEMS (“CMP”) facilitates the generation of user accounts with merchants. The user may be logged into an electronic wallet or issuer account, and may initiate an account generation process with a one-click mechanism. The CMP may provide information to the merchant in order to facilitate the generation of the account after receiving data from the electronic wallet or issuer.
US11941006B2
Dynamic partitioning of a search space of queries is implemented for flexible, heuristic database querying. Search space partitioning refers to dividing the search space for a submitted query into smaller parts by augmenting the queries to append thereto an additional predicate comprising a dynamic partition key and a value(s) selected based on heuristics (e.g., recency and/or relevancy of the value(s)). A plurality of candidate augmentations of the query and corresponding query plans are generated and evaluated based on additional heuristics to determine which can be executed to yield the best results in terms of result quality and latency. This query plan is selected and executed for retrieval of results that satisfy the query, with pagination utilized for presentation of the results. The procedure of generating candidate query plans, selecting one of the candidates for execution, and paginating results is repeated until a search termination criterion is satisfied.
US11941002B1
Techniques and systems can analyze information associated with instructions to sort data to determine an identifier common to at least a plurality of individual instructions to sort the data. A correspondence of the identifier to a sort identifier used to sort the data can be determined. Based on the determined correspondence, the techniques and systems can sort the data based on the identifier.
US11940980B2
One example method for predictive clinical planning and design includes instantiating a plurality of data objects, each data object of the plurality of data objects comprising clinical trial information; displaying a graphical user interface on one or more display screens, the graphical user interface providing a graphical representation of at least a portion of a clinical trial and comprising a plurality of graphical nodes; receiving a selection of the second graphical node; receiving, via an editor associated with the second graphical node, a modification of the second data object; propagating an indication of the modification to the first data object, the propagation modifying a clinical trial data item of the first data object; and displaying, within the first graphical node, the modified clinical trial data item of the first data object.
US11940979B2
A method for creating a standby database with read/write access capability while also maintaining a data consistency with a primary database, is provided. The method includes syncing the primary database with a physical standby mirror existing on the standby database, creating a first data compartment and a second data compartment on the standby database, separate from the physical standby mirror, applying a change made to the first data object on the primary database to the corresponding first data object on the physical standby mirror; and determining whether the change should be applied to the corresponding first data object stored on the first data compartment in accordance with data merge rules associated with the first data compartment and the second data compartment.
US11940978B2
An example operation may include one or more of generating a plurality of successive data points of an iterative simulation based on predefined checkpoints, each data point identifying an evolving state of the iterative simulation with respect to a previous data point among the successive data points, transmitting a blockchain request for validating state data within a first data point among the plurality of successive data points to a first subset of endorsing nodes of a blockchain network, and transmitting a blockchain request for validating state data within a second data point among the plurality of successive data points to a second subset of endorsing nodes which are mutually exclusive from the first subset of endorsing nodes of the blockchain network for parallel endorsement of the first and second data points.
US11940971B2
An example operation may include one or more of receiving a request for trust information of an off-chain data source from a client, detecting that the trust information of the off-chain data source is not stored in a distributed ledger shared among a plurality of peer nodes, retrieving reliability data recursively identified and retrieved from a plurality of external sources having different reliability information of the off-chain data source, determining a reliability value based on a combination of the retrieved reliability data from the plurality of external sources, and transmitting the determined reliability value to the client.
US11940966B2
Disclosed is a method for estimating database management system performance, in which a performance change ratio of a DBMS can be determined once a first knob group, a second knob group, and a data volume of active data in data managed by the DBMS are obtained, without actually configuring the second knob group in the DBMS, executing a job by the DBMS, and then observing the execution. In other words, the performance change ratio of the DBMS can be estimated without interacting with the DBMS. DBMS security can be ensured, performance measurement approaches are provided for self-tuning and self-management of the DBMS, and reliable and stable running of the DBMS is ensured.
US11940964B2
Annotating input data using graphs via a user interface is disclosed, including: receiving a selection of an imported ontological subgraph to import into an annotation of input data presenting at least a portion of the imported ontological subgraph in a user interface associated with editing the annotation of the input data; receiving, via the user interface, a user input to associate a selected portion associated with the input data with a previously defined node associated with the presented at least portion of the imported ontological subgraph; and updating the annotation of the input data based at least in part on the user input and the imported ontological subgraph.
US11940948B2
An electronic device includes a first processing unit and a second processing unit, a first memory unit correspondingly set for the first processing unit and configured for data access by the first processing unit, and a second memory unit correspondingly set for the second processing unit and configured for data access by the second processing unit. The first processing unit occupies at least part of storage space of the second memory unit when a first criteria is met, and/or the second processing unit occupies at least part of storage space of the first memory unit when a second criteria is met.
US11940943B2
A network interface module for coupling a host device to a switched network as a network node is described. The network interface module comprises a single half-duplex port for communicatively coupling to a shared bus of the switched network, at least one frame queue sized to store one multicast read frame received via the shared bus, and logic circuitry. The logic circuitry is configured to decode a read command for the interface module included in a payload of the multicast read frame that includes multiple read commands for other network nodes of the switched network, and transmit a response frame including read data on the shared bus when detecting the shared bus is available for transmitting.
US11940942B2
A Peripheral Component Interconnect Express (PCIe) interface device includes a transaction layer generating a transaction packet for transmission of a transaction, a data link layer generating a link packet including a protection code and a sequence number for the transaction packet and a link packet including a sequence number on the basis of the transaction packet, a physical layer generating a physical packet on the basis of the link packet and sequentially outputting the physical packet, a link training module performing negotiation for a link coupled through the physical layer and maintaining data information based on whether a link down occurring when the negotiation for the link is not performed is requested by a host or not, and a PCIe register storing information about the transaction layer, the data link layer, the physical layer, and the link training module.
US11940940B2
A processing device has a plurality of interfaces and a plurality of processors. During different phases of execution of a computer program, different processors are associated with different interfaces, such that the connectivity between processors and interfaces for the sending of egress data and the receiving of ingress data may change during execution of that computer program. The change in this connectivity is directed by the compiled code running on the processors. The compiled code selects which buses associated with which interfaces, given processors are to connect to for receipt of ingress data. Furthermore, the compiled code causes control messages to be sent to circuitry associated with the interfaces, so as to control which buses associated with which processors, given interfaces are to connect to.
US11940935B2
A computerized system operating in conjunction with computerized apparatus and with a fabric target service in data communication with the computerized apparatus, the system comprising functionality residing on the computerized apparatus, and functionality residing on the fabric target service, which, when operating in combination, enable the computerized apparatus to coordinate access to data.
US11940928B2
Devices and techniques for parking threads in a barrel processor for managing cache eviction requests are described herein. A barrel processor includes eviction circuitry and is configured to perform operations to: (a) detect a thread that includes a memory access operation, the thread entering a memory request pipeline of the barrel processor; (b) determine that a data cache line has to be evicted from a data cache for the thread to perform the memory access operation; (c) copy the thread into a park queue; (d) evict a data cache line from the data cache; (e) identify an empty cycle in the memory request pipeline; (f) schedule the thread to execute during the empty cycle; and (g) remove the thread from the park queue.
US11940927B2
Techniques for memory tagging are disclosed. In the illustrative embodiment, 16 bits of a virtual memory address are used as memory tag bits. In a page table entry corresponding to the virtual memory address, page tag bits indicate which of the 16 bits of the virtual memory address are to be sent to the memory as memory tag bits when a memory operation is requested on the virtual memory address. The memory can then compare the memory tag bits sent with the physical memory address to memory tag bits stored on the memory that correspond to the physical memory address. If the memory tag bits match, then the operation is allowed to proceed.
US11940921B2
In one embodiment, a prefetching method implemented in a microprocessor, the prefetching method comprising: issuing all prefetches remaining for a memory block as L3 prefetches based on a set of conditions; and issuing L2 prefetches for cache lines corresponding to the L3 prefetches upon reaching the end of the memory block.
US11940917B2
Methods and systems for managing storage of data in a distributed system are disclosed. To manage storage of data in a distributed system, a data processing system may include a network interface controller (NIC). The network interface controller may present emulated storages that may be used for data storage. The emulated storage devices may utilize storage resources of storage devices. The storage devices may be remote to the NIC. To reduce communication bandwidth and/or use of resources of the storage devices, the NIC and/or NICs of other data processing systems may implemented a distributed cache for data stored in the storage devices. The NICs may implement a method of managing the distributed cache to maintain synchronization between the distributed cache and the data stored in the storage devices.
US11940908B2
A data storage device whose controller is configured to apply a hash function to a logical address specified in a received host request to obtain a first portion of the corresponding physical address (e.g., the channel number or channel and die numbers). This feature of the controller enables the L2P table stored in the DRAM associated with the controller to have physical-address entries that contain therein only complementary second portions of the physical addresses, but not the first portions. Such shorter physical-address entries in the L2P table enable a corresponding beneficial reduction in the size of the DRAM and can further be leveraged to have optimized and aligned access to the L2P table in the DRAM.
US11940906B2
A method to be implemented by the server includes steps of: during a power-on self-test, determining whether a storage device is communicatively connected to the server; when it is determined that a storage device is communicatively connected to the server, determining whether the storage device stores a script file having a preset filename; and when it is determined that the storage device stores a script file having the preset filename, performing a process of modifying the BIOS based on the script file.
US11940904B2
Systems, computer-implemented methods, and computer program products to facilitate generation of microservices from a monolithic application based on runtime traces are provided. According to an embodiment, a system can comprise a memory that stores computer executable components and a processor that executes the computer executable components stored in the memory. The computer executable components can comprise a model component that learns cluster assignments of classes in a monolithic application based on runtime traces of executed test cases. The computer executable components can further comprise a cluster component that employs the model component to generate clusters of the classes based on the cluster assignments to identify one or more microservices of the monolithic application.
US11940893B2
Techniques for providing application contextual information. One or more sets of database context identifiers corresponding to events that occur within the database are generated by the database. The one or more sets of database context identifiers have at least one application context field. A session identifier corresponding to a session to be monitored is sent from the application to the database. Information to be stored in the database with the session identifier is sent to the database. Database logs and application logs are correlated using at least the session identifier.
US11940890B2
The present disclosure discloses a timing index anomaly detection method, device and apparatus. The method includes the following operations. A plurality of pieces of timing index information about a service to be detected is acquired. The plurality of pieces of timing index information is filtered according to a filtering condition, and timing index information satisfying a preset filtering condition is retained. The filtering condition corresponds to an anomaly detection condition. A tag is added to the timing index information satisfying the preset filtering condition to form first timing index information. The tag is used for identifying the anomaly detection condition. The first timing index information is forwarded to a preset working node corresponding to the tag. anomaly detection is performed on the first timing index information on the same preset working node. It is determined whether an anomaly prompt is output.
US11940881B1
Systems and methods are provided for efficient post-processing of object-based snapshots of block-storage volumes, which post-processing may include garbage collection, validation, or resource usage auditing for the snapshots. An object-based snapshot can be logically represented by a set of objects stored on an object storage service, which objects collectively represent a copy of the data of a corresponding block-storage volume at a given point in time. Each snapshot can further be represented by a full manifest that includes a full listing the set of objects representing the block-storage volume, and a differential manifest that includes a listing of objects unique to the snapshot relative to a prior snapshot of the same volume. Full manifests enable each snapshot to remain independently represented, while differential manifests enable efficient post-processing by reducing the amount of data retrieved and processed to identify an aggregate of all objects referenced across a group of snapshots.
US11940871B2
A memory system includes a nonvolatile memory including memory cells, and a memory controller. The memory controller is configured to read first data through application of a first read voltage to each of the memory cells, perform a first decoding process with respect to the first data, when the first decoding process fails, perform a tracking process. The tracking process includes reading second data indicating a threshold voltage level of each of the memory cells through application of a plurality of second read voltages to each of the memory cells, and obtaining, with respect to each of the memory cells, likelihood information using the second data. The second read voltages are shifted by a predetermined amount. The memory controller is further configured to perform a second decoding process with respect to the second data using the likelihood information.
US11940864B2
A multiphase power supply including a controller and phases can respond to a drop in load level by reducing all but one active phase to reduce power consumption. If the load level drops further, further reduction of the power consumption could be achieved by reducing, changing, or disabling the functions of some circuits within the active phase during these conditions. Estimating these conditions, however, may be difficult for a controller when the communication between the controller and the phase is limited. The disclosure describes an active phase that estimates a state of the load based on a sensed output current and a pulse width modulation control signal. The active phase may change its operating mode to match the estimated state of the load so that lighter load conditions consume less power. Furthermore, the idle phase(s) may nearly turn off all function except PWM detection to save power. Because this mode change is local to the phase, no additional communication with the controller is required.
US11940857B2
A multi-element device includes a plurality of memory elements, each of which includes a memory array, access circuitry to control access to the memory array, and power control circuitry. The power control circuitry, which includes one or more control registers for storing first and second control values, controls distribution of power to the access circuitry in accordance with the first control value, and controls distribution of power to the memory array in accordance with the second control value. Each memory element also includes sideband circuitry for enabling a host system to set at least the first control value and the second control value in the one or more control registers.
US11940854B2
A replacement device includes a replacement module and a slider. The replacement module includes a sliding portion. The sliding portion is provided with a limiting column, which is formed with a fixing hole. The slider includes a slider body. The slider body is provided with a first latch, a limiting hole and a fixing element, wherein the first latch is arranged on a first side edge of the slider body. The slider is correspondingly arranged on the sliding portion of the replacement module, and the limiting column of the sliding portion passes through the limiting hole. The fixing element has a top portion, and is fixed in the fixing hole. The size of the top portion is greater than the size of the limiting hole, so that the slider moves relative to the replacement module within a limit range of the limiting hole.
US11940853B2
A screw-free device for a computer motherboard that relates to the technical field of computer-aided hardware is disclosed. The device also includes a first fixing plate, where the first fixing plate is fixedly connected with a second fixing plate through a damping spring, the side walls of a first supporting door frame and a second supporting door frame are embedded with dustproof filter screens, a clamping outer frame is bonded with a first soft cushion block, a sliding supporting block is rotatably connected with a fastening screw, a fixed supporting block and the sliding supporting block are both fixedly connected with a fastening pressure plate through a fastening spring, the fastening pressure plate is bonded with a second soft cushion block, and the supporting frame is embedded with a heat-dissipating fan and a heat-dissipating filter screen, respectively.
US11940839B2
Disclosed is a hinge structure that includes a first shaft, a second shaft, a first arm part, a second arm part, a first rotation part, a second rotation part, a first main gear, a second main gear, and first and second compound gears disposed between the main gears. The first compound gear may include a first gear portion geared with the first main gear, and of which a distance from a center point to a gear tooth end is a first radius, and a second gear portion geared with the second compound gear, and of which a distance from a center point to a gear tooth end is a second radius that is smaller than the first radius. The second compound gear may have a structure corresponding to that of the first compound gear. An electronic device including the hinge structure is also disclosed.
US11940838B2
A method of docking an accessory device includes, at the accessory device, receiving (324) a first transmission energy for wireless charging from an electronic device; in accordance with receiving the first transmission energy: setting (326) a timer, and entering (328) a docked mode; and exiting (330) the docked mode upon expiration of the timer.
US11940837B2
A display that includes a display panel and a window laminated with the display panel is presented. The display panel may include: a main panel region including a first side extending in a first direction and a second side extending in a second direction crossing the first direction; a first sub-panel region that is in contact with the first side and is bent; and a second sub-panel region that is in contact with the second side and is bent. A panel corner part of the main panel region adjacent to the first sub-panel region and the second sub-panel region is rounded.
US11940833B2
An input apparatus, in particular a joystick, has an operating device, a magnetorheological braking device, and a control device for actuating the braking device. The operating device has a support and an operating lever that is pivotable about at least one pivot axis. A sensor senses a pivot angle of the operating lever. The braking device is coupled to the pivot axis in order to damp, in a controlled manner by way of the control device, a pivot movement of the operating lever. The control device actuates the braking device depending on a control command and converts the control command into a haptic signal, preferably a defined sequence of deceleration torques, which can be perceived on the operating lever. A user, as a result of an input made, can receive haptic feedback (so-called force feedback).
US11940831B2
In accordance with an embodiment, a circuit includes: a trimmable reference current generator having a temperature dependent current output node, the trimmable reference current generator including: a proportional to absolute temperature (PTAT) current generation circuit; a first programmable current scaling circuit coupled to the PTAT current generation circuit and including a first output coupled to the temperature dependent current output node; a constant current generation circuit; a second programmable current scaling circuit coupled to the constant current generation circuit and including a first output coupled to the temperature dependent current output node; and a reference interface circuit having an input coupled to the temperature dependent current output node and an output configured to be coupled to a reference current input of a memory sense amplifier.
US11940826B2
A power control integrated circuit (IC) chip can include a direct current (DC)-DC converter that outputs a switching voltage in response to a switching output enable signal. The power control IC chip can also include an inductor detect circuit that detects whether an inductor is conductively coupled to the DC-DC converter and a powered circuit component in response to an inductor detect signal. The power control IC chip can further include control logic that (i) controls the inductor detect signal based on an enable DC-DC signal and (ii) controls the switching output enable signal provided to the DC-DC converter and a linear output disable signal provided to a linear regulator based on a signal from the inductor detect circuit indicating whether the inductor is conductively coupled to the DC-DC converter and the powered circuit component.
US11940824B2
Embodiments of the present disclosure describe methods, apparatuses, and systems for hybrid low dropout regulator (LDO) architecture and realization to provide high power supply rejection ratio (PSRR) and high conversion efficiency (CE), and other benefits. The hybrid LDO may be coupled with dual rails for its analog LDO branch and digital LDO respectively to achieve high PSRR and high CE by utilizing the hybrid architecture with several feedback loops. Other embodiments may be described and claimed.
US11940823B2
A reference voltage generation circuit includes a band gap reference circuit configured to generate a first reference voltage that depends on a band gap reference voltage and a supply voltage, and a conversion circuit configured to convert the first reference voltage into a second reference voltage. The second reference voltage depends on the band gap reference voltage and a ground voltage. The ground voltage is lower than the supply voltage.
US11940822B2
A semiconductor device includes an analog voltage regulator and an integrated circuit module. The analog voltage regulator generates a regulated output voltage. The integrated circuit module generates an analog sense voltage based on the regulated output voltage and includes integrated circuit dies, a first sensor, second sensors, and a digital voltage offset controller (DVOC). The first sensor generates a digital reference voltage based on an analog reference voltage. The second voltage sensors detect voltages at predetermined locations on the integrated circuit dies. The DVOC generates a digital offset voltage substantially equal to the difference between the digital reference voltage and the voltage detected by a selected one of the second voltage sensors. The regulated output voltage is based on an unregulated input voltage, the analog sense voltage, and the digital offset voltage.
US11940811B2
A cleaning system and a cleaning method configured for cleaning task of solar panels are provided. The cleaning system includes an operation region, cleaning robots, shuttle robots, and a data processing system. The cleaning method includes a first carrying step, a cleaning step, and a second carrying step.
US11940802B2
A system for managing a work site includes: an identification unit that identifies a discharging position of a manned vehicle in the work site where an unmanned vehicle and the manned vehicle operate in a mixed manner; and an operation control unit that controls operation of the unmanned vehicle based on the discharging position.
US11940801B2
An automatically moving floor treatment appliance has an appliance housing, a drive, a detector for detecting surrounding area features, and a computer that transmits control commands to the drive, based on the surrounding area features detected by the detector. The detector has a plurality of inner and outer fall sensors arranged on an underside of the appliance housing, which detect a distance of the floor treatment appliance from the surface. The computer controls the drive to change a movement of the floor treatment appliance when the distance detected by the fall sensor is greater than a threshold value defining a slope. The fall sensors are interconnected in an evaluation circuit of the detection means so that the detection signals of the totality of inner fall sensors can be evaluated independently of the detection signals of the totality of outer fall sensors.
US11940799B2
Improved mobile robots and systems and methods thereof, described herein, can enhance security and monitoring services of grounds and property. And, such mobile robots and systems and methods thereof can enhance policing as well as customer service and help desk functionality. In some embodiments, the mobile robots and systems and methods thereof can enhance exploration, such as space exploration.
US11940798B2
An autonomous vehicle configured to autonomously pass a cyclist includes an imaging device and processing circuitry configured to receive information from the imaging device. Additionally, the processing circuitry of the autonomous vehicle is configured to identify a cyclist passing situation based on the information received from the imaging device, and plan a path of an autonomous vehicle based on the cyclist passing situation. The autonomous vehicle also includes a positioning system and the processing circuitry is further configured to receive information from the positioning system, determine if the cyclist passing situation is sufficiently identified, and identify the cyclist passing situation based on the information from the imaging device and the positioning system when the cyclist passing situation is not sufficiently identified based on the information received from the imaging device.
US11940793B1
Validating a component of an autonomous vehicle may comprise determining, via simulation, a likelihood that operation of the component will result in an adverse event. Such simulations may be based on log data developed from real world driving events to, for example, accurately model a likelihood that a scenario will occur during real-world driving. Because adverse events may be exceedingly rare, the techniques may include modifying a probability distribution associated the likelihood that a scenario is simulated, determining a metric associated with an adverse event (e.g., a likelihood that operating the vehicle or updating a component thereof will result in an adverse event), and applying a correction to the metric based on the modification to the probability distribution.
US11940787B2
A control device includes a first controller configured to generate a first operation amount for the device on the basis of an output fed back from the device and a target value, a predicted output generator including a learned model which is machine learned so as to generate a predicted output from the device on the basis of the output fed back from the device and the first operation amount, a second controller configured to generate a second operation amount for the device on the basis of the predicted output and the target value, an integrated operation amount generator configured to generate an integrated operation amount which is an operation amount for the device on the basis of the first operation amount and the second operation amount.
US11940786B2
A virtual controller is configured to send control commands to an edge controller such as in I/O module that is connected to a building management system component. The IO module is configured to communicate with the virtual controller and to provide local control commands to the building management system component that are based upon the control commands from the virtual controller when communication with the virtual controller is determined by the IO module to be functioning normally and are based upon one or more fail-safe commands generated by the IO module when communication with the virtual controller is determined by the IO module to not be functioning normally.
US11940782B2
Provided are a product performance prediction modeling method and apparatus, a product performance prediction method, a product performance prediction system, a computer device, and a storage medium. The product performance prediction modeling method includes: acquiring first sample data, the first sample data including device outlier data generated in a process of manufacturing a product by a device; acquiring a production line configuration simulation parameter of a production line relating to a location of the device, and product information of the product manufactured by the production line; selecting a simulation model to perform simulation test on the performance of the product, to obtain product performance simulation data; and inputting the device outlier data, the production line configuration simulation parameter, the product information and the product performance simulation data into a machine learning model to perform machine learning training, to obtain a product performance prediction model.
US11940781B2
The sewing management system includes a sewing machine that performs sewing on a sewing line, a management server that manages various information on the sewing line, and a wearable terminal that detects physical condition management information of an operator on the sewing line. The sewing machine transmits production management information, including identification information of the operator who perform sewing operations on the sewing line and operation information of the main unit of the device, to the management server. The management server estimates a sewing skill of the operator based on the production management information and estimates the production capacity of the operator based on the physical condition management information.
US11940777B2
A sensor control assembly and method providing a secured sensor data and an optimized handling of the sensor including a sensor, a first processing unit adapted to provide a cryptographic checksum of sensor data, a distributed database, a second processing unit adapted to verify the sensor data, and a third processing unit adapted to determine the demand for calibration. A manufacturing device contains at least a part of the sensor control assembly.
US11940765B2
Disclosed within is a closed loop controller having: (a) a signal processing and statistics subsystem sampling an input data stream from at least one sensor, calculating real-time continuous statistics in the input data stream based on a sliding window technique, and outputting one or more classifications based on the real-time statistics; and (b) an intelligent fuzzy logic controller receiving the one or more classifications from the signal processing and statistics subsystem, accessing a heuristic rule set based on expert knowledge, and outputting a noninvasive stimulation pattern based on the one or more classifications and the heuristic rule set.
US11940757B2
Disclosed are optical interrogation apparatus that can produce lens-free images using an optoelectronic sensor array to generate a holographic image of sample objects, such as microorganisms in a sample. Also disclosed are methods of detecting and/or identifying microorganisms in a biological sample, such as microorganisms present in low levels. Also disclosed are methods of using systems to detect microorganisms in a biological sample, such as microorganisms present in low levels. In addition or as an alternative, the methods of using systems may identify microorganisms present in a sample and/or determine antimicrobial susceptibility of such microorganisms.
US11940755B2
Disclosed is a process cartridge detachably mounted to an image forming device having a tray and force applying components. The process cartridge has a process cartridge frame, a photosensitive unit, a developing unit rotatable relative to the photosensitive unit. The process cartridge frame has a driving side and a conductive side disposed oppositely along a length direction. The driving side has a first driving force receiving portion for rotating a photosensitive drum and a second driving force receiving portion for rotating a developing roller. The developing unit has a force receiving portion for receiving force of force applying components to rotate the developing unit relative to the photosensitive unit. When the process cartridge is pushed into to the image forming device, the force receiving portion move at least in a left-and-right direction and/or an up-and-down direction relative to the frame of the process cartridge.
US11940752B2
An image forming apparatus includes a housing; a powered body for image formation provided inside the housing; an attachable/detachable body that is attached to and detached from the housing; a power supply path body that is attached to and detached from the attachable/detachable body to form a power supply path; and a substrate that supplies power to the powered body, is directly mounted on the attachable/detachable body or the power supply path body, and is separated from the attachable/detachable body or the power supply path body.
US11940747B2
In a longitudinal direction of a heater, a distance from a center portion of the heater to a first temperature detection element is a first distance, and a distance from the center portion of the heater to a second temperature detection element is a second distance greater than the first distance. In a first area which is farther from the center portion of the heater than the second temperature detection element is from the center portion of the heater in the longitudinal direction of the heater, a distance between a first conductor and a second conductor in a transverse direction of the heater is a first inter-conductor distance and a distance between a third conductor and a fourth conductor in the transverse direction is a second inter-conductor distance longer than the first inter-conductor distance.
US11940745B2
A fixing device includes: a heating section that heats in a non-contact manner a front surface of a recording medium; a feeding section that feeds the recording medium while causing the front surface to be opposed to the heating section; and a maintaining section that, in order to enable the recording medium to be fed by the feeding section while a rear surface that is opposite to the front surface, and that is in an image region where an unfixed-image is formed on the front surface is in a non-contact state, maintains the non-contact state.
US11940744B2
A transfer device includes a transfer drum that rotates in conjunction with a fixing roller, a transfer belt that transfers an image onto a medium while rotating along with the transfer drum in a state where the medium is nipped between the transfer belt and the transfer drum, a pressing member that is disposed in a space enclosed by the transfer belt, and a switching unit that moves the pressing member and switches between a pressed state in which the transfer belt is pressed against the transfer drum and a separated state in which the transfer belt is separated from the transfer drum.
US11940741B2
An image forming apparatus includes: an image carrier that extends in a first direction; a light emitter that includes a substrate that extends in the first direction, and multiple light-emitting devices that are disposed on the substrate and emit light to the image carrier; a positioning portion that is disposed between the substrate and the image carrier, and that fixes a position of the light emitter with respect to the image carrier in at least one direction perpendicular to a light emission direction; and an adjuster that is located to overlap the positioning portion when viewed in the first direction, and that adjusts a position of the light emitter in the light emission direction.
US11940736B2
A tin trap device for collecting tin in a chamber device which causes tin to be turned into plasma with laser light in an internal space thereof may include a housing provided with a gas inlet port through which exhaust gas in the chamber device flows and a gas exhaust port through which the exhaust gas is exhausted; and a main heater arranged in the housing, configured to have a temperature equal to or higher than the melting point of tin and lower than the boiling point thereof, and having a projection surface projected toward a direction in which the exhaust gas flows in the gas inlet port cover the gas inlet port.
US11940734B2
The inventive concept provides a substrate treating apparatus. The substrate treating apparatus includes a chamber having a treating space therein; a supply line having a first open/close valve installed thereon and configured to supply a treating fluid to the treating space; a heater installed on the supply line and configured to heat the treating fluid; an exhaust line having a second open/close valve installed thereon and configured to exhaust the treating space; and, a controller configured to control the first open/close value and the second open/close valve such that the treating fluid heated is supplied to and exhausted from the treating space before a treating process is performed on a substrate in the treating space.
US11940730B2
Disclosed herein is a pattern formation method, comprising (a) applying a layer of a photoresist composition over a semiconductor substrate, (b) pattern-wise exposing the photoresist composition layer to i-line radiation; and (c) developing the exposed photoresist composition layer to provide a resist relief image; wherein the photoresist composition comprises a non-ionic photoacid generator; a solvent; a first polymer and a second polymer; and wherein the first polymer comprises a polymeric dye.
US11940728B2
A molecular resist composition and a pattern forming process. A molecular resist composition comprising a sulfonium salt having a cation of specific structure and an organic solvent has a high sensitivity and forms a resist film with improved resolution and LWR, when processed by EB or EUV lithography. The molecular resist composition does not contain a base polymer. The molecular resist composition comprising a sulfonium salt having a cation of specific partial structure has a high sensitivity and forms a resist film with improved resolution and LWR, so that the resist composition is quite useful for precise micropatterning.
US11940727B2
A reticle enclosure includes a base including a first surface, a cover including a second surface and coupled to the base with the first surface facing the second surface. The base and the cover form an internal space that includes a reticle. The reticle enclosure includes restraining mechanisms arranged in the internal space and for securing the reticle, and structures disposed adjacent the reticle in the internal space. The structures enclose the reticle at least partially, and limit passage of contaminants between the internal space and an external environment of the reticle enclosure. The structures include barriers disposed on the first and second surfaces. In other examples, a padding is installed in gaps between the barriers and the first and second surfaces. In other examples, the structures include wall structures disposed on the first and second surfaces and between the restraining mechanisms.
US11940723B2
A computing device includes: a housing supporting a transparent panel to define an enclosure; a camera supported within the enclosure, the camera having a field of view extending through the transparent panel; and a privacy shutter supported within the enclosure, between the transparent panel and the camera, the privacy shutter having a shutter magnet, and being movable via magnetic activation between (i) an enabled position obstructing the field of view, and (ii) a disabled position clearing the field of view.
US11940711B2
A beam steering device includes a substrate with a first refractive index that defines a cavity, an electroactive material in the cavity that has a variable refractive index, and two sets of opposing overlays. The overlays in one set of opposing overlays are parallel to each other, while the overlays in the other set are tilted with respect to each other. This allows one or more electric fields between the overlays to be used to align the electroactive material in two different directions to change its refractive index, allowing for a faster speed of beam steering through refraction than conventional approaches.
US11940709B2
An optical modulator includes a Mach-Zehnder interferometer including (i) a first optical waveguide including a first semiconductor junction diode, and (ii) a second optical waveguide including a second semiconductor junction diode. A semiconductor region connects the first and second semiconductor junction diodes such that a distance between the first and second optical waveguides is less than 2.0 μm for at least a portion of a longitudinal direction of the optical modulator. In another aspect, a method of modulating an optical signal includes splitting input light into first and second optical transmission paths; modulating a phase difference between light in the first optical transmission path and light in the second optical transmission path without applying a bias voltage through an impedance less than 100 ohm between the first and second optical transmission paths; and combining light that is output from the first and second optical transmission paths.
US11940708B2
Provided is an optical modulator that can be driven at lower voltage through the use of differential signal output. An optical modulator includes a substrate 1 and optical waveguides (21, 22) and a control electrode that are formed on the substrate, in which the optical waveguide includes Mach-Zehnder type optical waveguide, the control electrode is provided with two ground electrodes sandwiching three signal electrodes; the three signal electrodes are constituted by second and third signal electrodes that sandwich a first signal electrode, and have a wiring structure in which one modulation signal of the differential signal is applied to the first signal electrode, and the other modulation signal of the differential signal is applied to the second and third signal electrodes; and one branched waveguide (21) out of two Mach-Zehnder type optical waveguides is disposed between the first and second signal electrodes, and the other branched waveguide (22) is disposed between the first and third signal electrodes.
US11940694B2
A method for manufacturing a light modulation device is provided. The light modulation device is capable of removing defects such as orientation irregularities. The light modulation device further improves the orientation state in the light modulation device that adjusts orientation of a liquid crystal compound or the like with a liquid crystal alignment film and a pressure-sensitive adhesive layer or adhesive layer.
US11940679B2
An apparatus is disclosed that includes a switchable optical filter having a layer of switchable material; a light source providing light of a wavelength that causes the switchable material to transition from a faded state to a dark state, or a dark state to a faded state; and a switch for controlling activation of the light source.
US11940677B1
An optical device including a waveguide, electrodes, and a connecting dielectric is described. The waveguide includes an electro-optic material having a waveguide optical refractive index and a waveguide microwave dielectric constant. The electrodes include a first electrode and a second electrode. The waveguide is between the first electrode and the second electrode. At least a portion of the connecting dielectric is between the waveguide and electrodes. The connecting dielectric has a microwave dielectric constant greater than the waveguide microwave dielectric constant.
US11940664B2
A lens unit includes a jointed lens having a first optical member, a second optical member disposed on an optical axis of the first optical member, and a jointing member having a light transmissive property and disposed between the first optical member and the second optical member, and a holding mechanism configured to hold the first and second optical members. The holding mechanism holds the first and second optical members so that a distance along an optical axis direction between a first lateral surface at an opposite side to a second optical member side in the first optical member and a second lateral surface at an opposite side to a first optical member side in the second optical member becomes a preset distance. The jointing member adheres to the first optical member and the second optical member so that the distance becomes the preset distance.
US11940663B2
An optical device includes a core formed on a substrate, a first source electrode and a second source electrode formed in contact with both side surfaces of the core interposed between the first source electrode and the second source electrode, and a drain electrode formed in contact with an upper surface of the core. The core, the first source electrode, and the second source electrode together form a plasmonic waveguide. The first source electrode and the second source electrode are Schottky coupled to the core.
US11940649B2
An optical fiber bundle structure includes: plural optical fiber core wires; a crossing preventing member; and a grasping member. Further, the crossing preventing member has slits and the widths of the slits positioned at the respective sides are each equal to or larger than a difference between: a length of one side of a polygon circumscribing the plural optical fiber core wires at a hindmost end portion of the slits at the trailing end; and a length of one side of a polygon circumscribing the plural optical fiber core wires at the leading end.
US11940648B2
Methods are known for producing an anti-resonant hollow-core fiber which has a hollow core extending along a fiber longitudinal axis and an inner jacket region that surrounds the hollow core, said jacket region comprising multiple anti-resonant elements. The known methods have the steps of: providing a cladding tube that has a cladding tube inner bore and a cladding tube longitudinal axis along which a cladding tube wall extends that is delimited by an interior and an exterior; providing a number of tubular anti-resonant element preforms; arranging the anti-resonant element preforms at target positions of the interior of the cladding tube wall, thereby forming a primary preform which has a hollow core region and an inner jacket region; further processing the primary preform in order to form a secondary preform, including an elongation process; and drawing the secondary preform in order to form the hollow-core fiber. The aim of the invention is to achieve a high degree of precision and an exact positioning of the anti-resonant elements in a sufficiently stable and reproducible manner on the basis of the aforementioned methods. This is achieved in that after the primary preform is elongated, at least some of the formerly tubular anti-resonant element preforms of the primary preform have an oval outer cross-sectional shape with a longest cross-sectional axis AL and a shortest cross-sectional axis AK, wherein the ratio AL/AK of the length of the axes ranges from 1.01 to 1.27, and the shortest cross-sectional axis AK runs in a radial direction when viewed from the cladding tube longitudinal axis.
US11940642B2
An illumination device for fluorescence image guided surgery and a surgical instrument. The illumination device includes a glass rod, a mixing rod and a plurality of optical fibers surrounding a circumferential surface of the glass rod. A first mixing rod end face of the mixing rod abuts a second rod end face of the glass rod and end faces of the optical fibers, so that white light and excitation light are guided and homogenized in the mixing rod.
US11940641B2
A light pipe includes at least two optical structures having different refractive indices. An interface between the two optical structures is oblique to a longitudinal axis of the light pipe such that an output ray from an output surface at a distal end of the light pipe is non-parallel to an input ray that is parallel to the longitudinal axis at an input surface at a proximal end of the light pipe. Light refracts inside the light pipe between the (at least) two optical structures altering the direction of an optical path of the light through the light pipe, thereby allowing higher degrees of freedom for the selection of the angle of deviation (folding angle) of the light pipe. By optimizing various parameters of the light pipe, a desired output optical axis angle (i.e., folding angle) can be achieved that suits the desired optical engine envelope.
US11940628B2
Examples are disclosed that relate to display devices having a common light path region. One example provides a display device comprising a light source configured to emit illumination light along an illumination path, and a spatial light modulator configured to modulate the illumination light and emit the modulated illumination light as image light along an imaging path, wherein at least a portion of the illumination path and at least a portion of the imaging path extend through a common light path region. The display device further comprises one or more optical elements positioned within the common light path region, at least one optical element being configured to guide the illumination light as the illumination light travels through the common light path region toward the spatial light modulator, and shape the image light as the image light travels through the common light path region.
US11940626B1
Devices/techniques coupleable to patient sensors, ambient environment, and external sensory input. Devices/techniques receive/maintain information; correlate received/maintained information with measures associated with detecting/monitoring, predict, prevent/treat, and train/reward patient self-care, for dry eyes. Devices/techniques detect/monitor, predict, and prevent/treat dry eyes in real time; and train/reward patients to conduct self-care for dry eyes. The devices/techniques provide adjusted sensory inputs to prevent/treat dry eyes, or to train/reward patients to conduct self-care for dry eyes. The devices/techniques cooperate with other devices, including devices worn by nearby patients, to receive/maintain information about the ambient environment, or communicate with medical personnel. The devices/techniques adjust parameters they use, in response to received information that differs from predictions, to provide superior behavior, and communicate with other devices and medical personnel. Devices/techniques are combined with devices/techniques that perform similar functions for other conditions, migraines/photophobia, neuro-opthalmic disorders, and other ocular conditions, and for combinations of dry eyes with other conditions.
US11940622B2
Data characterizing a relative arrangement of vehicle occupants with respect to one another are continuously transmitted to display devices worn on the heads of the vehicle occupants. Virtual environments are displayed as a function of these data.
US11940613B2
An apparatus and method are provided for a night vision system including a transparent overlay display that transmit direct-view light representing an intensified image and emits display light representing a display image. The overlay display includes photodetectors arranged to detect an intensity of the incoming direct-view light, and an intensity of the display light depends on the detected intensity. In some embodiments, the intensity of the display light is spatially modulated using an amplitude or envelope of the intensity that is based on the detected local intensity of the direct-view light. In some embodiments, the intensity of the display light is adjusted to correct for loss of the direct-view light. The intensity of the display light may be controlled using control circuitry that receives signals from the photodetectors, and the control circuitry may be located on the same semiconductor chip as the overlay display.
US11940611B2
Disclosed herein are methods of tomographic imaging, the methods comprising emitting a beam of light from a light source to a sample and modulating the beam of light through a spatial light modulator configured to convert the beam of light to an Airy beam. The spatial light modulator can be rotatable and positioned at a first angle relative to the sample. The method can further obtain a first perspective view of the sample, rotate the spatial light modulator to a second angle relative to the sample, and obtain a second perspective view of the sample. Each of the perspective views can be generated by the Airy beam interacting with the sample on a focal plane. The method can then reconstruct a volumetric three-dimensional view of the sample using the first perspective view and the second perspective view.
US11940610B2
An autofocus system includes a focus light source, an objective lens, a defocus lens, a first image sensor, and a controller. The defocus lens is disposed on the transmission path of the focus light beam, so that a minimum light point of the focus light beam passing through the objective lens deviates from a focus of the objective lens. The first image sensor is configured to receive a focus reflected light beam generated after the focus light beam is reflected by the sample. The controller is electrically connected to the first image sensor. According to a center change of gravity, a position change, or an energy change of a light spot formed by the focus reflected light beam on an image plane of the first image sensor, the controller drives the objective lens or the sample to move, so that the focus of the objective lens falls on the sample.
US11940599B2
An optical imaging system includes a first lens having a convex image-side surface, a second lens having a concave object-side surface, a third lens, a fourth lens, and a fifth lens disposed sequentially from an object side. The optical imaging system satisfies 4.8
US11940596B2
A spectacle lens has on at least one surface thereof at least two coatings modified to exhibit an antibacterial effect and/or an antiviral effect. A method of making such a spectacle lens includes dispersing at least one biocidal component in a solvent and/or dissolving at least one biocidal component in a solvent, the dispersed at least one biocidal component and the dissolved at least one biocidal component being different from each other.
US11940588B2
Methods and systems are provided for clay detection, clay typing, and clay volume quantification using downhole electromagnetic measurements conducted by a downhole logging tool on a formation at a low frequency less than 5000 Hz. The downhole electromagnetic measurements are used to determine permittivity data that characterizes permittivity of the formation at the low frequency less than 5000 Hz. The downhole low frequency electromagnetic measurements are nondestructive, and the results indicate it is with high sensitivity to the existence of clays.
US11940587B2
Systems and methods of the present disclosure relate to calibration of resistivity logging tool. A method to calibrate a resistivity logging tool comprises disposing the resistivity logging tool into a formation; acquiring a signal at each logging point with the resistivity logging tool; assuming a formation model for a first set of continuous logging points in the formation; inverting all of the signals for unknown model parameters of the formation model, wherein the formation model is the same for all of the continuous logging points in the first set; assigning at least one calibration coefficient to each type of signal, wherein the calibration coefficients are the same for the first set; and building an unknown vector that includes the unknown model parameters and the calibration coefficients, to calibrate the resistivity logging tool.
US11940580B2
A system for near-surface geophysical subsurface imaging for detecting and characterizing subsurface heterogeneities comprises an instrument that outputs probing electromagnetic signals through a ground surface that interact and are affected by scattered signals of acoustic waves that travel through the ground surface and further senses vibrational modes of a subsurface below the ground surface; an imaging device that dynamically generates a time sequence of images of properties of the acoustic waves and maps elastic wave fields of the acoustic waves; and a processor that analyzes dynamic multi-wave data of the images to quantify spatial variations in the mechanical and viscoelastic properties of the subsurface.
US11940556B2
A testing device for testing a distance sensor includes: a receiver for receiving an electromagnetic free-space wave as a receive signal; an analog-to-digital converter configured to, in a simulation mode, convert the receive signal into a sampled signal; a signal-processing unit configured to: delay the sampled signal or a modulated sampled signal to form a delayed sampled signal or a modulated delayed sampled signal; and modulate, upon the sampled signal or upon the delayed sampled signal, a predeterminable Doppler signature as a characteristic motion profile of a reflecting object to be simulated to form the modulated sampled signal or the modulated delayed sample signal; a digital-to-analog converter configured to convert the modulated or the modulated delayed sampled signal into a simulated reflected signal; and a transmitter configured to radiate the simulated reflected signal or a simulated reflected signal derived from the simulated reflected signal as an output signal.
US11940539B2
An automatic calibration and validation pipeline is disclosed to estimate and evaluate the accuracy of extrinsic parameters of a camera-to-LiDAR coordinate transformation. In an embodiment, an automated and unsupervised calibration procedure is employed where the computed rotational and translational parameters (“extrinsic parameters”) of the camera-to-LiDAR coordinate transformation are automatically estimated and validated, and upper bounds on the accuracy of the extrinsic parameters are set. The calibration procedure combines three-dimensional (3D) plane, vector and point correspondences to determine the extrinsic parameters, and the resulting coordinate transformation is validated by analyzing the projection of a filtered point cloud including a validation target in the image space. A single camera image and LiDAR scan (a “single shot”) are used to calibrate and validate the extrinsic parameters. In addition to only requiring a single shot, the complete procedure solely relies on one or more planar calibration targets and simple geometrical validation targets.
US11940535B2
A multipulse LIDAR system, including: a transmitting device for generating a transmission laser beam from a temporal sequence of single laser pulses; a receiving device with a detection surface, including a subdetector system made up of multiple subdetectors, for receiving the transmission laser beam that is reflected/scattered on objects in an observation area, the receiving device imaging a sampling point on the detection surface in the form of a pixel; a scanning device generating a scanning movement for successive sampling of the observation area along multiple sampling points situated in succession, the scanning movement to image a pixel on the detection surface, in each case shifted along the subdetector system; and a control device for determining distance information of the sampling points based on propagation times of the particular single laser pulses, the control device grouping subdetectors to form a macropixel individually associated with the particular pixel, for shared evaluation.
US11940527B2
A synthetic visual system for an aircraft may comprise: a camera in electronic communication with a controller; a radar system in electronic communication with the controller; a three-dimensional cockpit display in electronic communication with the controller via a synthetic weather system; and a tangible, non-transitory memory configured to communicate with the controller. The three-dimensional cockpit display may be configured to display a three-dimensional weather image based on correlated data between the radar system and the camera.
US11940525B2
An example method to determine an object spin rate may include receiving a radar signal of a particular object in motion. The method may further include converting the radar signal into an input vector. The method may also include providing the input vector as input to a neural network. The neural network may include access to a set of initial data that has been generated based on multiple initial radar signals of multiple initial objects in motion. The method may further include determining a spin rate of the particular object in motion based on an analysis performed by the neural network of the input vector including time and frequency information of the particular object in motion in view of the set of initial data. The analysis may include comparing one or more elements of the input vector to one or more elements of the set of initial data.
US11940516B2
A method for magnetic resonance imaging (MRI) may include obtaining imaging signals related to a region of interest (ROI) of a subject. The method may also include selecting a portion of the imaging signals as auxiliary signals associated with at least one temporal dimension of the ROI. The method may also include generating at least one target image associated with the at least one temporal dimension of the ROI based on the imaging signals and the auxiliary signals.
US11940515B2
A system, method, and computer-readable medium for evaluating structural integrity of a gradient coil disposed in a magnetic resonance imaging system is provided. A sensor obtains a parameter reading of the gradient coil, wherein the parameter reading includes a back electromotive force (back EMF) measurement. The structural integrity of the gradient coil is determined as function of the back EMF measurement.
US11940513B2
A magnetic resonance tomography unit and a method for operating the magnetic resonance tomography unit are provided. The magnetic resonance tomography unit has a transmission interference suppression device with a transmission interference suppression control system, a sensor, and a transmission interference suppression antenna. The transmission interference suppression device is configured to acquire, with the sensor, an excitation signal of the transmitter, and determine, with the transmission interference suppression control system, a transmission interference suppression signal dependent upon the acquired excitation signal of the transmitter. The transmission interference suppression device is configured to transmit, via the transmission interference suppression antenna, the transmission interference suppression signal, so that at a predetermined location outside the magnetic resonance tomography unit, the excitation signal emitted by the transmitter via the transmitter antenna is attenuated.
US11940510B2
A method for preparing an NMR material, comprising generating parahydrogen in gas or liquid form at a first location; transporting the parahydrogen away from the first location; mixing a precursor compound including a metabolite component with a catalyst for hydrogenation; hydrogenating the precursor compound using the parahydrogen; transferring polarization in the precursor compound to a nuclear spin of the metabolite component; cleaving a side arm of the precursor compound in a chemical reaction, with the metabolite molecule being one of the products of the reaction; separating the metabolite molecule from the catalyst for hydrogenation and other products of the reaction; and generating metabolite molecules for use in an MRI scanner by extracting a sample of the metabolite molecule having at least 5% polarization.
US11940509B2
A magnetometer includes a magnetically isolated chamber having an opening to receive a sample; one or more Optically Pumped Magnetometer (OPM) sensors positioned inside the magnetically isolated chamber; an actuator mounted on a frame, the actuator moving an end portion in and out of the magnetically isolated chamber; and a sample holder coupled to the end portion.
US11940504B2
A Hall effect sensor system includes a Hall effect sensor and a drive-sense circuit (DSC). The Hall effect sensor includes an input port to receive a DC (direct current) current signal and generates a Hall voltage based on exposure to a magnetic field. The DSC generates the DC current signal based on a reference signal and drives it via a single line that operably couples the DSC to the Hall effect sensor and simultaneously to sense the DC current signal via the single line. The DSC detects an effect on the DC current signal corresponding to the Hall voltage that is generated across the Hall effect sensor based on exposure of the Hall effect sensor to the magnetic field and generates a digital signal representative of the Hall voltage.
US11940503B2
A magnetic sensor circuit includes: a first element including series-connected resistor and capacitor, or including only a capacitor; a second element including series-connected resistor and inductor, or including a magnetic sensor sensing a magnetic field by a magnetic impedance effect; a third element including series-connected resistor and capacitor, or including only a capacitor; and a fourth element including a magnetic sensor sensing a magnetic field by a magnetic impedance effect, wherein a first series circuit part including the series-connected first and second elements and a second series circuit part including the series-connected third and fourth elements are connected in parallel, and, when the magnetic field sensed by the magnetic sensor has a predetermined reference value, a product of impedance Z1 of the first element and impedance Z4 of the fourth element and a product of impedance Z2 of the second element and impedance Z3 of the third element are equal.
US11940490B2
The disclosure provides a method and apparatus of interleaved on-chip testing. The method merges a test setup for analog components with a test setup for digital components and then interleaves the execution of the digital components with the analog components. This provides concurrency via a unified mode of operation. The apparatus includes a system-on-chip test access port (SoC TAP) in communication with a memory test access port (MTAP). A built-in self-test (BIST) controller communicates with the MTAP, a physical layer, and a memory. A multiplexer is in communication with the memory and a phase locked loop (PLL) through an AND gate.
US11940481B2
Embodiments relate to a test method for testing an unpopulated printed circuit board. The method can involve the steps of: exposing the unpopulated printed circuit board to temperatures of a reflow soldering process in a first step; and testing the electrical connections of the unpopulated printed circuit board. Embodiments also relate to a test device and a method for producing populated printed circuit boards.
US11940480B2
An apparatus includes a test head frame and a tray slidably coupled to the frame and configured to receive a printed circuit board (PCB) to be tested. The PCB is positioned within the frame when the tray is in a retracted position and outside the frame when the tray is in an ejected position. A bed of nails (BON) opposes a lower side of the PCB and includes a plurality of pins having first portions arranged on an upper side of the BON to connect with corresponding electrical pads on the lower side of the PCB when the tray containing the PCB is in the retracted position. A plurality of interface printed circuit boards is configured for connection to second portions of the plurality of pins exposed on a lower side of the BON and for receiving test signals when the tray containing the PCB is in the retracted position.
US11940477B2
A method of determining electromagnetic exposure values for radiative compliance tests a transmitting device with multiple transmitters or antenna. The device transmits a first set of excitation signals that are chosen in advance. These signals are measured for their electromagnetic exposure values. A second set of excitation signals are then transmitted that are adaptively chosen based on result of a previous measurements of the first excitation signals. The second set of signals are also measured. From the measurements of the predetermined and adaptive signals, the electromagnetic exposure values of all possible transmitted signals are inferred.
US11940476B2
A three-phase power meter can monitor power on both 3-wire and 4-wire power lines. The power meter measures at least two voltages between phase conductors of the power line, and at least one voltage between a phase conductor and a neutral conductor of the power line when the neutral conductor is available. Using at least some of the measured voltages, the power meter can then operate in a first mode when coupled to a 3-wire power line to determine power on the power line based on the measured voltages, or operate in a second mode when coupled to a 4-wire power line to determine power on the power line based on the measured voltages.
US11940465B2
A contact probe includes a first plunger, a second plunger, a coil spring, and a pipe; the first plunger includes a first slide portion that slides along the inner periphery of the pipe; the second plunger includes a second slide portion that slides along the inner periphery of the pipe; and the coil spring includes: a first attachment portion that is attached to the first plunger and tightly wound; a second attachment portion that is attached to the second plunger and tightly wound; a coarsely wound portion; a first contact portion including one end connected to the first attachment portion and another end connected to the coarsely wound portion and contacting the pipe; and a second contact portion including one end connected to the coarsely wound portion and another end connected to the second attachment portion and contacting to the pipe.
US11940455B2
A consumable management system comprising a consumable storage cluster with a plurality of storage compartments is presented. Each storage compartment is configured to receive one or more consumables. The consumable management system further comprises storage compartment indicators to provide guidance to a user and a detection unit for validating user action(s).
US11940454B2
Analyte collection and testing systems and methods, and more particularly to disposable oral fluid collection and testing systems and methods. Described herein are methods and apparatuses to achieve significant improvements in the detection of fluorescence signals in the reader.
US11940449B2
Compositions and methods for immunological detection of coronavirus antibodies are provided.
US11940448B2
Early detection of lysosomal storage diseases (LSDs) including Mucopolysaccharidosis Type I (MPS I) and Pompe Disease can greatly improve patient outcome as each disease can be fatal once symptoms emerge. Screening for MPS I and Pompe Disease using biological samples including dried blood spots (DBS), buccal swab, peripheral blood mononuclear cells (PBMCs), or white blood cells (WBCs) is described. The disclosed methods and assays provide a robust way to screen newborns for LSDs. The disclosed methods and assays can also allow rapid prediction of whether a patient with LSD will develop an immune response to enzyme replacement therapy (ERT), thus improving treatment for patients with LSDs. The disclosed methods and assays can also further reduce the number of false positives caused by pseudo deficiency cases of LSD, such as MPS I and Pompe Disease.
US11940446B2
A method for manufacturing a structure for microbe detection comprises the steps of: reacting nitrilotriacetic acid (NTA) and an acid anhydride to prepare a first compound; chelation of metal ions to the first compound to prepare a second compound; binding the second compound and a microbe detector to prepare a third compound; and mixing an exfoliated transition metal-dichalcogenide (TMD) compound and the third compound to prepare a structure for microbe detection, in which the metal ions of the third compound are bound with the transition metal-dichalcogenide compound.
US11940436B1
The present disclosure discloses an electroanalytical sensor for the detection of meloxicam. The electroanalytical sensor comprises a carbon electrode. The carbon electrode comprises zinc oxide (ZnO) nanoparticles, wherein the ZnO nanoparticles are co-doped with silver (Ag) and cobalt (Co). The present disclosure also discloses a method of detecting meloxicam using an electroanalytical sensor. The electroanalytical sensor comprises a carbon electrode, the carbon electrode comprising zinc oxide (ZnO) nanoparticles co-doped with silver (Ag) and cobalt (Co). The method of detecting meloxicam comprises the step of positioning a liquid droplet, comprising solvent, to be tested on a surface of the electrode. The method further comprises receiving a voltammetric response from the electrode, and analysing the voltammetric response to determine if meloxicam is present in the liquid droplet.
US11940433B1
A method includes receiving data characterizing a time-dependent first sensor data detected by a first sensor, a time-dependent second sensor data detected by a second sensor, a time-dependent third sensor data detected by a third sensor, a first set of threshold values associated with the first sensor, a second set of threshold values associated with the second sensor, and a third set of threshold values associated with the third sensor and a time window. The first, second, and third sensors are located in a first space of a building. The method further includes calculating a first performance index, a second performance index, and a third performance index. The method also includes classifying the first performance index, the second performance index, and the third performance index into one of a plurality of performance indicators. The method further includes assigning a performance rating score for a space based on the classification.
US11940423B2
To suppress the influence of heat from an interface part on temperature control of a separation column and also to suppress the influence of room temperature fluctuation outside a main body. A gas chromatograph (1) includes a main body (2) having internal space, a column cartridge (4) disposed in the internal space of the main body (2) and including a case (20), a heater (18) and a separation column (16) for separating components in sample gas, the separation column being accommodated in the case (20) together with the heater (18), and the case (20) being provided with an intake port (26) through which air for cooling the separation column (16) is taken into the case (20), a sample gas supplier (6) for supplying a sample gas to the separation column (16), the sample gas supplier (6) being attached to the main body (2), and being fluidly connected to an inlet of the separation column (16), a detector (8) for detecting components separated in the separation column (16), the detector (8) being attached to the main body (2) and being fluidly connected to an outlet of the separation column (16), an interface part (10) adjusting a temperature of pipes (22; 24) connected to the inlet and the outlet of the separation column (16) in the internal space of the main body (2), a first fan (12) for supplying outside air of the main body (2) into the case (20) of the column cartridge (4) via the intake port (26), and a second fan (14) which is different from the first fan (12), and is for cooling an outer surface of the case (20) of the column cartridge (4) by blowing outside air if the main body (2) to an outer surface of the case (20) of the column cartridge (4).
US11940421B2
A method and an apparatus for detecting bending stiffness and a method for testing a display panel. The method for detecting bending stiffness includes: arranging an object to be tested on a reference surface to make a stationary portion and a rotating portion of the object to be tested attached to the reference surface, the stationary portion and the rotating portion being connected to each other; driving the rotating portion to bend from the reference surface toward the stationary portion, and acquiring a rotation angle between the rotating portion and the reference surface; acquiring a bending force received by the rotating portion when the rotating portion is bent from the reference surface toward the stationary portion; and determining bending stiffness of the object to be tested on the basis of the bending force and the rotation angle.
US11940412B2
A biosensor system includes an array of biosensors with a plurality of electrodes situated proximate the biosensor. A controller is configured to selectively energize the plurality of electrodes to generate a DEP force to selectively position a test sample relative to the array of biosensors.
US11940408B2
A measuring device includes: a first electrode immersed in sample water stored in a measuring tank; a second electrode immersed in the sample water; and a controller that: causes a power source to flow a current through the sample water between the first electrode and the second electrode; detects, based on a first digital signal, an interruption whereby an analog signal fluctuates by no less than a predetermined value; and calculates, based on a second digital signal, a concentration of a measurement target in the sample water. The first digital signal is acquired by sampling the analog signal with a first sampling period. The analog signal is based on the current flowing through the sample water. The second digital signal is acquired by sampling the analog signal with a second sampling period that is longer than the first sampling period.
US11940400B1
A gas sensor system includes at least one gas sensor configured to receive at least one gas to be sampled; a processor configured to implement computer executable instructions; a first output interface in communication with the processor; and a computer memory in communication with the processor. A method includes measuring a density of the at least one gas; at least one of a) heating and b) cooling the at least one gas with a first thermal input; determining a first rate at which the at least one gas changes temperature when at least one of a) heating and b) cooling the at least one gas; comparing at least one of the density and the first rate to a reference database of gases; and determining at least one of a) a category b) a lower explosive limit and c) a concentration of the at least one gas.
US11940390B2
A system, method and computer readable medium for examining a specimen, the method comprising: obtaining defects of interest (DOIs) and false alarms (FAs) from a review subset selected from a group of potential defects received from an inspection tool, each potential defect is associated with attribute values defining a location of the potential defect in an attribute space; generating a representative subset of the group, comprising potential defects selected in accordance with a distribution of the potential defects within the attribute space, and indicating the potential defects in the representative subset as FA; and training a classifier using data informative of the attribute values of the DOIs, the potential defects of the representative subset, and respective indications thereof as DOIs or FAs, wherein the trained classifier is to be applied to at least some of the potential defects to obtain an estimation of a number of expected DOIs.
US11940367B2
A device for simulating carbon dioxide storage in a deep saline aquifer, including a CO2 gas source, first and second valves, first and second pressure pumps, first, second and third pressure gauges, a water storage tank, a simulation box, a first flow meter, a gas-liquid separator, a recycling tank, a microcomputer-display assembly, a structure plate, core holders, an injection pipeline, a connection pipeline, a baffle, a piezometer, a second flow meter, a heater, a lifter and an acoustic logging tool. The CO2 gas source, the first valve, the first pressure pump and the first pressure gauge for gas injection. The water storage tank, a second pressure pump and a second pressure gauge for water injection. The second valve, the third pressure gauge, the first flow meter, the gas-liquid separator and the recycling tank form an output pipeline.
US11940365B1
The present invention is directed to a passive outdoor air sampler device with various screen types and materials for efficient collection of air particles. Screens are used as a collection surface for aerosolized particles. The air sampler is suitable for long-term use in different outdoor settings with no power requirements.
US11940355B2
A wind turbine rotor blade load emulator arrangement includes a support unit constructed to support a rotor blade during a fatigue test procedure; an exciter configured to deflect the rotor blade during a fatigue test procedure; and a stiffness augmentation assembly for mounting to the rotor blade over a mounting length, which stiffness augmentation assembly is realized to increase the stiffness of the rotor blade in the mounting length. A method of carrying out a fatigue test procedure on a wind turbine rotor blade uses such a load emulator arrangement.
US11940353B2
A test device for an automatic pressure regulating valve of an electronic braking system includes a test device composed of an air supply, a pneumatic circuit, a valve, a sensor, a signal processing unit, and a control unit. By subjecting an automatic pressure regulating valve to a bench test including a functional test, a static performance test, a dynamic performance test, an air tightness test, a leakage test, and a brake chamber braking force test, the present disclosure avoids the high risk of a field test, improves the test efficiency, and ensures the test consistency. An automatic pressure regulating valve is tested before being loaded on a vehicle, and parameters of the automatic pressure regulating valve are continuously modified through tests to improve the performance, such that the automatic pressure regulating valve can meet the real-time, fast, independent, and accurate regulation requirements of EBS of commercial vehicles.
US11940339B2
Structural health monitoring systems for building structures created by additive processes can include at least an orientation sensing subsystem, a strain sensing subsystem, and a local processor. Orientation sensors can collect data from a first set of strategic locations and strain gauges can collect data from a second set of strategic locations on a 3D-printed building component. The sensors can be embedded during or after the 3D-printing process. A simulation engine can determine the strategic locations by modeling 3D geometry and material properties and simulating results from the application of various loads to determine the likely structural failure locations of the building component. The local processor can receive sensor data, filter the data, format the data for analysis, store the data, and forward the formatted data to a remotely located processing system for analysis. Additional system components can include an environmental subsystem and tensometers to collect humidity, temperature, and material deformation data.
US11940335B2
A system and a method of detecting a temperature of a battery, which calculate a resistance value of a temperature detecting unit based on a size of a voltage applied to the temperature detecting unit connected with a battery for measuring a temperature of the battery, and detect the temperature of the battery connected with the temperature detecting unit based on the calculated resistance value.
US11940326B2
A spectroscopic analysis device includes: a film that contacts a sample subject to spectroscopic analysis; a first irradiator that irradiates a first irradiation light having transition energy to decompose attached material attached to a boundary surface of the film; and an optical waveguide that transmits the first irradiation light irradiated from the first irradiator. A first evanescent wave, based on the first irradiation light, is generated on a front surface of the optical waveguide, and is then projected on an attached region of the attached material.
US11940323B2
An electromagnetic wave module comprising a chip and a lens unit. The chip has a first face, a second face opposed to the first face, and a third face connecting the first face and the second face. The lens unit has a curved face forming a lens, a fourth face opposed to the curved face, and a recessed portion encompassed in an outer edge of the curved face on a projected plane in an optical axis of the lens. The recessed portion has a fifth face disposed at a position closer to the curved face than the fourth face, and a sixth face connecting the fifth face and the fourth face. At least a part of the sixth face of the recessed portion is in contact with at least a part of the third face of the chip.
US11940303B2
There is provided a position detection device to suppress an influence of a signal distortion due to a processing error or the like, the position detection device including: a reference position calculation unit that calculates a reference position of a moving body on the basis of a first signal and a second signal, the first signal being detected from a first track provided on the moving body and having a scale of predetermined cycles, and the second signal being detected from a second track provided on the moving body and having a scale of cycles less than the predetermined cycles; a slit specifying unit that specifies a slit corresponding to a position of the moving body; an in-slit position calculation unit that calculates an in-slit position of the moving body in the specified slit; and a correction unit that corrects an absolute position of the moving body.
US11940301B2
Provided is a position indicator of an electromagnetic induction type including a position indicator cartridge housed in a hollow portion of a housing, in which the position indicator cartridge includes a first resonant circuit including a first coil wound around a magnetic core arranged on one end of the position indicator cartridge in an axial direction of the position indicator cartridge and a first capacitor, a second coil that is independent of the position indicator cartridge provided outside of the position indicator cartridge, at a position where the second coil, in operation, is magnetically coupled to the first coil of the position indicator cartridge, and a switch turned on and off by an operation portion provided outside of the position indicator cartridge, the operation portion, in operation, receiving an operation of a user, and a closed circuit including the second coil is formed when the switch is turned on.
US11940299B2
This invention describes a magnetoresistive inertial sensor chip, comprising a substrate, a vibrating diaphragm, a magnetic field sensing magnetoresistor and at least one permanent magnet thin film. The vibrating diaphragm is located on one side surface of the substrate. The magnetic field sensing magnetoresistor and the permanent magnet thin film are set on the surface of the vibrating diaphragm displaced from the base of the substrate. A contact electrode is also arranged on the surface of the vibrating diaphragm away from the base of the substrate. The magnetic field sensing magnetoresistor is connected to the contact electrode through a lead. The substrate comprises a cavity formed through etching and either one or both of the magnetic field sensing magnetoresistors and the permanent magnet thin film are arranged in a vertical projection area of the cavity in the vibrating diaphragm portion. A magnetic field generated by the permanent magnet thin film changes in the sensing direction of the magnetic field sensing magnetoresistor of magnetoresistive inertial sensor chip, which changes the resistance valve of the magnetic field sensing magnetoresistor, thereby producing a change in an output electrical signal. This magnetoresistive inertial sensor chip uses the high-sensitivity and high-frequency response characteristics of a magnetoresistor to improve the output signal strength and frequency response, thereby facilitating the detection of small and high frequency pressure, vibration, or acceleration changes.
US11940296B2
An apparatus and a method are for securing at least one measuring device to an object. The measuring device is configured for monitoring the object and is provided with a penetrating element for perforating a sheet forming part of the object. The apparatus has a body having a housing for holding the measuring device and an assembling device for moving the measuring device with respect to the housing. The assembling device has an engagement means movable between a retracted, passive position, and an extended, active position for engaging the measuring device to urge the penetrating element of the measuring device through the sheet of the object to secure the measuring device to the object. A control device is for operating the assembling device.
US11940293B2
A system may include one or more finger devices that gather input from a user's fingers. A finger device may include one or more self-mixing interferometric proximity sensors that measure a distance to the user's finger. The proximity sensor may measure changes in distance between the proximity sensor and a flexible membrane that rests against a side portion of the user's finger. The self-mixing interferometric proximity sensor may include a laser and a photodiode. In some arrangements, a single laser driver may drive the lasers of multiple self-mixing proximity sensors using time-multiplexing. The self-mixing proximity sensor may operate according to a duty cycle. Interpolation and stitching may be used to determine the total displacement of the user's finger including both the on periods and off periods of the self-mixing proximity sensor.
US11940283B2
A method for matching a vehicle with a user including receiving a user ride request for a vehicle from a plurality of available vehicles from a user, receiving a threshold vehicle risk score preference for the user, receiving a user risk score for the user, receiving a threshold user risk score preference for the plurality of available vehicles, identifying a subset of the plurality of available vehicles having a vehicle risk score at or below the threshold vehicle risk score preference of the user and a threshold user risk score preference at or above the user risk score of the user, and presenting the user with ride options for selecting one of the subset of the plurality of available vehicles of the subset of available vehicles for the user ride request.
US11940278B2
Systems and methods for indicating a navigable area that is reachable by a watercraft with a current amount of energy is provided. The system comprises a display, a processor and a memory, including a computer code configured to, when executed by the processor, cause the system to receive position data indicating a current geographic location of a watercraft; receive tidal data for the current geographic location of the watercraft; determine, based on energy remaining data, an estimated available travel distance for operating a motor of the watercraft before the watercraft runs out of energy; and generate an overlay for a chart. The overlay comprises a boundary area corresponding to the estimated available travel distance and the effect of the tide on the watercraft. The computer code further presents the overlay on the chart to visually indicate travel options from the current geographic location.
US11940275B2
A vibrator device includes a vibrator element, and a support substrate configured to support the vibrator element. The vibrator element includes a drive arm provided with a drive signal electrode and a drive constant-potential electrode, and a detection arm provided with a detection signal electrode and a detection constant-potential electrode. The support substrate includes a base, and a drive signal interconnection electrically coupled to the drive signal electrode, a drive constant-potential interconnection electrically coupled to the drive constant-potential electrode, and a detection signal interconnection electrically coupled to the detection signal electrode all provided to the base, and the drive arm includes a first surface located at the support substrate side, and a second surface located at an opposite side to the first surface. Further, the drive constant-potential electrode is disposed on the first surface, and the drive signal electrode is disposed on the second surface.
US11940273B2
A method (100) and system (500) for determining a floe size distribution (350), (516) for a plurality of floes within a geographical area (204), comprising determining a chord length distribution (512) for the geographical area (204), the chord length distribution (512) comprising a plurality of measured floe chord lengths, and determining the floe size distribution (350, 516) over the geographical area (204) based on the chord length distribution (512), the floe size distribution (350, 516) comprising a plurality of floe diameters (402).
US11940261B2
A bulkhead for transmitting detonation signals. The bulkhead is designed for use with a perforating gun assembly. The bulkhead comprises an elongated tubular body having a first end, a second end opposite the first end, and a bore extending from the first end to the second end. The bulkhead also includes a signal pin residing within the bore of the bulkhead. The signal pin also has a first end, and a second end opposite the first end. An electrically conductive wire is connected to the second end of the signal pin at the second end of the bulkhead. The bulkhead also comprises an end piece extending from the second end of the bulkhead. The end piece closely holds the conductive wire in place. Preferably, the end piece is over-molded to securely hold the detonator wire.
US11940247B2
Automated systems and methods for collecting environmental data along a ballistic trajectory are disclosed. The systems and methods may comprise automatically estimating the ballistic trajectory of a projectile. The systems and methods may comprise automatically converting the ballistic trajectory into a ballistic flight path comprising a plurality of coordinates. The systems and methods may comprise electronically communicating the ballistic flight path to a guidance system of an Unmanned Aerial Vehicle (UAV). The guidance system may be configured to cause the UAV to navigate along the ballistic flight path. The systems and methods may comprise automatically collecting environmental data along the ballistic flight path.
US11940241B2
A toy launcher with a drum magazine assembly that has a rotatable drum portion mounted for rotation, with a rear plate and a central support with an opening for a support axle. A ring of projectile holders is connected to the rear plate, with each projectile holder holding at least two projectiles arranged in a generally radially stacked configuration. Generally radially extending walls are located between adjacent projectile holders. Each of the projectile holders includes a slot on a radially inner side into which a projectile biasing arm extends at a projectile launch position. A pusher is located in the housing adjacent to the projectile launch position. Drive wheels are positioned in front of the drum magazine assembly at the projectile launch position. The drive wheels are motorized so that they rotate to propel a projectile pushed from the drum between the drive wheels for launching the projectile.
US11940240B2
A customizable firearm system includes a chassis. A barrel assembly is disposed in the chassis. The barrel assembly including a trunnion and a barrel nut assembly. The barrel nut assembly includes an outer barrel nut sleeve and an inner barrel nut sleeve receiving a barrel. The barrel nut assembly is removably disposed in the trunnion. A bolt carrier assembly is disposed in the chassis. The bolt carrier assembly includes a backplate assembly and a pair of guide rods. Each of the guide rods have a first end disposed in the backplate assembly, and a second end disposed in the trunnion. A bolt carrier slidably disposed on the guide rod.
US11940238B2
Provided herein are bolt carriers, firearms, and related methods, devices, and assemblies. A bolt carrier for a firearm of an example embodiment includes a cam slot configured to receive a cam pin of a bolt, the cam slot defining a cam path along which the cam pin is configured to travel, the cam path comprising a locked dwell, an unlocked dwell, and a transition section disposed between the locked dwell and the unlocked dwell, wherein the locked dwell defines a portion parallel to a first axis of the bolt carrier that is greater than 0.070 inches long.
US11940237B2
Disclosed is an automated gun barrel cleaning system (100) and a method thereof for straight hollow cylindrical objects, preferably gun barrels. The system (100) enables scrubbing, mopping, lubrication and wiping of the gun barrel without the need to remove the cleaning device out of the gun barrel during cleaning and to replace the brush or mopping/wiping cloth. The method of cleaning provides a time-stamped cleaning data to monitor the condition of the gun barrel and to estimate quality and effective service life of the gun barrel. The system (100) comprises of a cleaning device 102 connected to a main controller unit 106 wherein the cleaning device 102 includes drive wheel assembly 210, a driven wheel assembly 240, a spray nozzle assembly 260, a vision system 270 and a cleaning assembly 220 providing controlled scrubbing, mopping and wiping functions with controlled supply of pressurized cleaning agent and lubricant oil.
US11940231B2
A heat dissipation device includes a heat absorbing member being provided with a first accommodating chamber for accommodating a working medium and a mounting hole in communication with the first accommodating chamber; and a valve installed in the mounting hole. The valve is adjustable between a first state and a second state to change the first accommodating chamber between a closed state and an open state. When the first accommodating chamber is in the open state, the first accommodating chamber is in fluid communication with outside so that the working medium can be injected into or discharged from the first accommodating chamber, so as to adjust the amount of the working medium in the first accommodating chamber. Thus, the heat dissipation device is applicable to various applications with different heat dissipating requirements.
US11940222B2
A heat sink includes a plurality of extrusions each including a base and a fin, the plurality of extrusions being aligned in a width direction orthogonal to an extrusion direction and joined to each other. The plurality of extrusions include a first extrusion including a plurality of fins, the first extrusion including, in the base, a through-hole in which a heat pipe is mountable, the through-hole extending in the extrusion direction.
US11940219B2
The present disclosure relates to a heat exchanger. The heat exchanger includes: a plurality of tube panels including a tube elongated in one direction; a pair of header modules coupled to both ends of the plurality of tube panels; and a pair of header cases having an open side, providing a space therein, and having the header module inserted in the space such that the tube panels communicate with the spaces, in which the header modules is composed of a plurality of header blocks stacked and coupled to each other, and an insertion hole in which the tube panel is inserted is formed at each of the plurality of header blocks. Accordingly, it is possible to increase the efficiency of manufacturing a heat exchanger, manufacture a heat exchanger flexibly in a custom-made type in accordance with the size of a product having the heat exchanger, reduce tolerance due to brazing, and improve stability of a product.
US11940217B2
A method for moulding a sheet into a component of complex shape having areas with different mechanical properties, particularly a motor-vehicle component, includes a first heating step of the sheet carried out by a kiln, prior to forming the component. The kiln has a main body with a roller shape, having a plurality of sectors extending along a radial direction with respect to a longitudinal axis of the roller body. The sectors are configured to each receive a sheet, so that the main body with a roller shape is arranged to simultaneously carry a plurality of sheets. The kiln includes a plurality of heating elements incorporated in the roller-shaped main body, so as to heat the sheets in contact with the roller body. The kiln includes at least one electronically-controlled drive motor, arranged to rotate the roller-shaped main body around the longitudinal axis of the kiln, so as to vary the position of the sectors with respect to the inlet and outlet ports. An additional heating step follows extraction of the sheets from the kiln, wherein the sheets are locally heated only at one area, so as to obtain sheets with areas heated to different temperatures.
US11940216B1
Disclosed is a high-temperature flue gas recovery apparatus for a melting furnace, which relates to copper production, including a preheating chamber and a feeding mechanism, a lower end of the preheating chamber being in communication with a feeding port of the melting furnace, the feeding mechanism being disposed above the preheating chamber to deliver feedstock into the preheating chamber, a plurality of layers of buffer mechanisms layered in an upper-lower manner being provided in the preheating chamber, each layer of the buffer mechanism including a buffer element and a drive element, the drive element driving the corresponding buffer element to move such that the feedstock on the buffer element of an upper-layer buffer mechanism falls onto the buffer element of a lower-layer buffer mechanism, a gap allowing a gas to pass through being provided between the buffer mechanisms and an inner wall of the preheating chamber. The solution may recover the high-temperature flue gas produced by the melting furnace to preheat the feedstock, thereby enhancing the energy utilization ratio during the production process; moreover, with the plurality of buffer mechanisms, the solution may charge the feedstock into the melting furnace in small quantity per time and in multiple times, facilitating accurate control of the feeding rate and amount of the feedstock.
US11940213B2
The invention relates to a drying system (T) according to FIG. 1 for drying goods to be dried (LTG), comprising—a drying tunnel (TT), —a line (LAG) for exhaust gas (AG) containing (VOC) out of the drying tunnel (TT), —a controlled fan (GBL) for further transporting the exhaust gas (AG) to a heat exchanger (WT), —a heat exchanger (WT) for heating the exhaust gas (AG) using the clean gas (RG), —an exhaust gas line (LAG) downstream of the heat exchanger (WT) for further transporting the exhaust gas (AGWT) to a burner (BR) in a combustion chamber (BK) of a thermal post-combustion system (TNV), —a cold bypass (BP) which bypasses the heat exchanger (WT) and which can be regulated using an electronically controlled controller (R), —a fuel line (LEG) for a fuel (EG) to the burner (BER), —a clean gas line (LRG) for transporting the clean gas (RG) out of the combustion chamber (BK) to the heat exchanger (WT) in order to cool the exhaust gas (AG), —a clean gas line (LRG) for conducting the clean gas (RG) from the heat exchanger (WT) to the heat consumers (WA), —a heater (HZTT) for heating the drying zone (TT) by means of the heat consumers (WA), and —a clean gas line (LRG) for conducting the clean gas (RGD) to a stack (K). The invention also relates to a drying method and a method for a thermodynamic regulation (TDR).
US11940205B2
An insulating structure for an appliance includes a trim breaker, a first panel, a second panel, and an adhesive. The trim breaker defines a first groove and a second groove. The first panel is disposed within the first groove and is coupled to the trim breaker. The second panel is disposed within the second groove and is coupled to the trim breaker. The adhesive is disposed within the first and second grooves and is coupled to the first and second panels.
US11940202B2
An appliance includes a cabinet, defining a food storage chamber, and a door. The appliance includes a hinge system coupling the door to the cabinet. The hinge system includes a first hinge arm fixed to the door, a second hinge arm pivotably joined with the first hinge arm, a carrier fixed to the cabinet, the second hinge arm releasably received in the carrier, and a tether cable extending between a first end and a second end. The first end of the tether cable fixed to the second hinge arm, the second end of the tether cable removably attached to a surface inside the food storage chamber. The tether cable configured such that the door may be detachable from the cabinet when the second end of the tether cable becomes detached from the surface inside the food storage chamber.
US11940200B2
The present invention provides a control method of a refrigerator, comprising: a first defrosting step of defrosting an evaporator and terminating the defrosting when the evaporator reaches a first temperature; a step of detecting pressure difference by means of a differential pressure sensor for measuring pressure difference between a first thru-hole, disposed between the evaporator and an inlet through which air flows in from a storage compartment, and a second thru-hole disposed between the evaporator and an outlet through which the air is discharged into the storage compartment; and a second defrosting step of additionally defrosting the evaporator if the measured pressure difference is greater than a configured pressure.
US11940199B2
A refrigerator including a housing mounted at a rear surface of a door to define a storage space of food, a basket disposed inside the housing, a duct extending to the housing from one side of an evaporator to supply cold air generated by the evaporator into the storage space of the housing, and a fan assembly coupled to the duct to allow the cold air to be forcibly supplied.
US11940192B2
An air conditioning device has: a refrigerant circuit that includes a compressor, a switching valve, a cascade heat exchanger, an expansion valve and an outdoor heat exchanger connected to one another by a first pipe through which a refrigerant flows, and that performs a defrosting operation in which the refrigerant discharged from the compressor is introduced into the outdoor heat exchanger; a heat-transfer medium circuit that includes a pump, the cascade heat exchanger, and the indoor heat exchanger connected to one another by a second pipe through which a heat-transfer medium flows; and a control device that controls the compressor and the pump. When an amount of heat storage of the heat-transfer medium is less than a threshold, the control device reduces the heating capability of the indoor heat exchanger when the air conditioning device transitions from a heating operation to the defrosting operation.
US11940187B2
A water treatment system of coupling a heat pump with multi-effect evaporation that comprises a lithium bromide absorption-type heat pump circulation system, a multi-effect evaporation circulation system and a compression-type heat pump circulation system is provided. The vapor in a tail-end evaporator of the multi-effect evaporation circulation system is introduced into a generator in the absorption-type heat pump to release heat and condense. A dilute solution in an absorber of the absorption-type heat pump is introduced into a first-effect evaporator to be evaporated by a treated water, and a condensation heat of the vapor generated by the generator of the absorption-type heat pump is recovered by an evaporator of a compressor heat pump, and another air source evaporator absorbs heat from ambient air to supply heat for the generator by a heat pump condenser.
US11940186B2
A refrigeration system includes a refrigeration circuit and a coolant circuit separate from the refrigeration circuit. The refrigerant circuit includes a gas cooler/condenser, a receiver, and an evaporator. The coolant circuit includes a heat exchanger configured to transfer heat from a refrigerant circulating within the refrigeration circuit into a coolant circulating within the coolant circuit, a heat sink configured to remove heat from the coolant circulating within the coolant circuit, and a magnetocaloric conditioning unit configured to transfer heat from the coolant within a first fluid conduit of the coolant circuit into the coolant within a second fluid conduit of the coolant circuit. The first fluid conduit connects an outlet of the heat exchanger to an inlet of the heat sink, whereas the second fluid conduit connects an outlet of the heat sink to an inlet of the heat exchanger.
US11940177B2
An air treatment apparatus (10), such as a dehumidifier or latent cooling system, has a desiccant wheel (12) having a plurality of similar internal structures (14), a shroud (16), at least a first fan (18, 20), a motor (30), an axle (32), slip rings (34), and sliding contacts (36). The similar internal structures are coated with a desiccant, and may be shaped as blades, cylinders, boxes, teeth, or corrugations. The shroud divides the wheel into an active area where the desiccant removes moisture to provide treated air (22), and a regeneration area where the desiccant is heated to release the adsorbed moisture from the air (28). Switches, such as magnetic switches, apply electrical power to heaters in the similar internal structures as they rotate into the regeneration area thereby heating and drying the desiccant.
US11940173B2
The present application provides a heat exchange device. The heat exchange device includes: a case, an interior of which is formed into an air-supply inflow space, an exhaust inflow space, an air-supply outflow space and an exhaust outflow space separated from each other, wherein a first extension wall is provided between the air-supply inflow space and the exhaust outflow space; and a heat exchange unit disposed in the case, and the air-supply inflow space and the air-supply outflow space communicate with each other by the heat exchange unit to form an air-supply air path, and the exhaust inflow space and the exhaust outflow space communicate with each other by the heat exchange unit to form an exhaust air path, wherein the air-supply air path and the exhaust air path exchange heat when passing through the heat exchange unit; the first extension wall is provided with a circulation air port communicating the air-supply inflow space and the exhaust outflow space, wherein the circulation air port may be selectively opened and closed. The heat exchange device may not only provide indoor air circulation but also ensure heat exchange efficiency.
US11940172B2
A plenum slot diffuser includes a plenum box having five walls formed by joining edges of a C-shaped bracket having first, second, and third walls of the five walls with additional edges of an L-shaped bracket having fourth and fifth walls of the fives walls. An air input opening of the plenum box is disposed in one of the five walls and is configured to be coupled to a duct, and an open end of the plenum box defines an air output opening. The plenum slot diffuser includes at least one blade and a blade holding rod comprising a neck, wherein the neck faces away from the air output opening of the plenum box.
US11940164B2
The purpose of the present invention is to provide a vehicle air conditioning system and a control method of the vehicle air conditioning system which enable detecting leaks of flammable refrigerant without requiring a separate sensor. This vehicle air conditioning system is provided with: a refrigeration cycle for cooling (23); a heat pump cycle for heating (33); a refrigerant that is very flammable, has an explosive range near room temperature, and circulates in the refrigeration cycle for cooling (23) and the heat pump cycle for heating (33); an outside temperature sensor (44) which detects the outside temperature; a pressure sensor (49) which detects the refrigerant pressure; and a control device which calculates the refrigerant density, which is the density of refrigerant, on the basis of the outside temperature and the pressure, and determines whether or not the refrigerant density has fallen below a prescribed threshold value which is based on the amount of sealed refrigerant, the total volume in the refrigeration cycle for cooling (23) and in the heat pump cycle for heating (33), the volume of the vehicle cabin, the standard density of the atmosphere, and the explosive limit of the refrigerant.
US11940163B1
A portable temperature-controlled device includes a housing and a controllable temperature element having a first surface and a second surface, wherein the first surface opposes the second surface. Inside the housing, a heat sink is disposed and in contact with the first surface of the controllable temperature element, and a fan is disposed adjacent the heat sink inside the housing and configured to direct heat away from the heat sink. The portable temperature-controlled device further includes a heat spreader in contact with the controllable temperature element for thermal energy transfer. The heat sink and the fan are supported on a support member inside the housing.
US11940159B2
A temperature probe for a cooktop appliance includes a probe body and a temperature sensor extending from the probe body. The temperature probe also includes a first arm and a second arm configured to mount on a cooking utensil. The temperature probe further comprises a controller configured to communicate with a controller of the cooktop appliance and to transmit a signal to the controller of the cooktop appliance corresponding to a size of the cooking utensil.
US11940145B1
A lighting device has a rectangular cubic shape and includes “leaves” which may be pivoted between closed and opened positions. Three separate options for illumination devices are included which are all unique and differ from one another. Illumination means is operated by a switch that closes a circuit activating illumination when a leaf is opened and opening the circuit thereby stopping illumination when a leaf is closed. The illumination means for each leaf consists of one or more LEDs. Known technology allowing the LEDs to change colors and to be dimmed or brightened may suitably be employed. If desired, artificial intelligence (AI) technology may be incorporated into the lighting device. For example, the device can be operated using voice prompts to dim or brighten LEDs, illuminate them or stop illumination and change colors. A dedicated phone App can be utilized in controlling the various modes of operation of the invention.
US11940140B2
Disclosed herein is a light transmissive fiber integrated knit textile for use on consumer electronic products. The knit textile is depicted to be constructed with light transmissive fibers integration through a weave-in/inlay knit technique with a flat-bed knitting construction. The light transmissive knitted textile is also tethered to a portable electronic device, allowing for the light transmitting fibers knitted into the fabric to define a lighting display on said fabric.
US11940135B2
Methods and apparatus for implementing a control apparatus for a light fixture for externally controlling the current to the LED light emitter of a landscape LED light fixture. In an exemplary embodiment a control apparatus for controlling current to an LED light source in a landscape lighting device includes an LED driver, a user control with a control setting indicator, and a driver housing including setting indicators.
US11940131B2
An adjustable utility lighting system that includes multiple flexible supports for different lights to effectively illuminate multiple areas of the engine compartment simultaneously. The adjustable utility lighting system includes a base member that includes a plurality of adjustable support legs for securing the base member in position when the ferromagnetic surface is not available for the base member to mount to. There are also gooseneck supports that are permanently attached to the base member by a coupling that couples a first end of each of the gooseneck supports to the top surface of the base member. There is also a rechargeable battery that is a 18650 rechargeable battery that is easy to replace.
US11940118B2
A lighting device for a vehicle, having a plurality of light sources, which are arranged in an array, in particular in line-by-line and column-by-column fashion, and can be operated independently of each other at least in part, wherein the light sources emit light during operation; an exit face through which the light emanating from the light sources passes; and a plurality of extensive boundary elements, which extend at least partly in a region between the light sources and the exit face and serve to separate the light emanating from different light sources, wherein at least some, preferably all, of the extensive boundary elements have a reflector which at least partly reflects the light emanating from one of the light sources in the direction of the exit face.
US11940116B2
To improve the sense of connection between a fixed-side lamp unit and a movable-side lamp unit. A vehicle lamp includes; a fixed-side unit, and a movable-side unit, the fixed-side unit has: a first light source; a first light guide body; and a first outer lens having a first front surface part, and a first leg part, the movable-side unit has: a second light source; and a second light guide body; and a second outer lens having a second front surface part, and a second leg part, the second leg part has a light control surface, and the light control surface performs control such that light emitted from at least one of the first light source and the second light source and incident on the light control surface passes through inside of the second leg part and is emitted from a front surface side of the second leg part.
US11940106B2
A low-profile modular lighting device with flexible installation mounting options includes a lower housing, a circuit board supported by the lower housing and having electronic devices mounted thereto, and a plurality of upper housings each configured to releasably couple to the lower housing. The electronic devices of the circuit board extend within the space defined by an interior surface and upper edge of the lower housing and within the space defined by an interior surface and lower edge of each of the plurality of upper housings when coupled to the lower housing. Each of the plurality of upper housings provide a different mounting configuration for the modular lighting device. The modular lighting device may include one or more of a motion sensor, a light sensor, and a wireless transceiver for communication with a wireless lighting system.
US11940103B1
Apparatus and system for producing light using LED lighting with output within a predetermined desired color temperature range for commercial lighting uses which may be bicolor or may be multicolored. A preferred embodiment includes a first and second group of LEDs arranged in an alternating matrix configuration, each group of LEDs configured to produce light in a predetermined color temperature range. In a preferred embodiment, an LED light system includes a tubular LED lamp having substantially the same size and dimensions as a traditional fluorescent lamp tube and a control box for controlling power input and power gain to the first, second, or both groups of LEDs.
US11940085B2
A cover structure of an upper unit in which a power source of an outboard motor is provided, the cover structure includes a main body cover including a pair of divided covers connected to each otter, the pair of the divided covers being configured to be divided into each other in a left-right direction with respect to a traveling direction of a boat, an attachable and detachable cover that is attachable to and detachable from a part of an outer surface of at least one of the pair of divided covers and that includes a light transmitting portion in at least a part of the attachable and detachable cover, the light transmitting portion configured to transmit light, and a light emitter that is provided at a mounting position of the attachable and detachable cover and that includes a light source.
US11940084B2
Thermal insulating sleeve liner for fluid flow device and fluid flow device incorporating such liner
A monolithic metal thermal insulating sleeve liner for fluid flow devices such as valves and piping used in severe industrial applications is additively manufactured (e.g., by 3D printing) to fit the bore of a protected fluid flow device. Tessellated support structures obliquely extending between inside surfaces of inner and outer shells provide increased resistance to thermal conduction while also providing increased strength against compression forces. Example support structures include an array of four obliquely oriented elongated members mutually intersecting mid-way between the inside surfaces of inner and outer cylindrical shells. If internal interstices are sealed they can be vacuumed or pressurized to enhance thermal insulating properties. A pressure equalizing aperture can be provided on or through the sleeve if needed in some applications.
US11940081B2
Disclosed are a cabin pipeline using a super thermal insulation material and a preparation method thereof, comprising an electrically conductive inner pipe, an anti-corrosion coating coated on the electrically conductive inner pipe, a thermal insulation layer formed by a super thermal insulation material wound on the anti-corrosion coating, and a resin sealing layer coated on an outside of the thermal insulation layer. The electrically conductive inner pipe has excellent corrosion resistance to liquefied natural gas in the pipeline; the protective layer formed by the anti-corrosion coating and the resin sealing layer can prevent the electrically conductive inner pipe from being directly exposed to the environment due to long-term seawater infiltration or accidental damage of the outer layer, avoid electrochemical corrosion and further improve the corrosion resistance.
US11940067B2
A system for remotely opening and closing a process equipment bolt flange joint may include a hydraulic cylinder actuator assembly for attaching to the flanges of a bolt flange joint to open and close the joint by operation of a remote hydraulic pump. More than one actuator assembly may be evenly spaced around the flange joint, to ensure even distribution of force around the joint. The system may have an accumulator for receiving hydraulic fluid expelled from the hydraulic cylinder during extension and to force hydraulic fluid back into the cylinder to close the flange joint upon pressure release at the pump. A drop trigger may be used to release hydraulic pressure at the pump for emergencies. The system may include a video camera for viewing the joint on a display. The components may be stored and transported on a mobile cart. A method of use is also disclosed.
US11940065B2
A connector for use in association with a lighting assembly that allows for components to be quickly assembled in an easily aligned configuration, including: a body having a first end, a second end, an interior sidewall, and an exterior sidewall; wherein the first end of the body and the second end of the body define a length therebetween; wherein a portion of the exterior sidewall of the body is threaded proximate the first end; wherein a portion of the exterior sidewall of the body is non-threaded proximate the second end; a first aperture associated with the first end of the body; a second aperture associated with the second end of the body; and a conduit positioned between the first aperture and the second aperture, wherein the conduit is adapted for containing an electrical cord from an associated lighting assembly.
US11940056B2
A vehicle driveline component that includes a tubular body, a relief valve, a vent cover and a pin. The tubular body has a first and second axial ends and defines an interior circumferential surface. The relief valve is mounted in the tubular body between the first and second axial ends. The vent cover is mounted to the tubular body and covers the second axial end. The pin is mounted to the tubular body at a location between the first axial end and the relief valve. The pin extends through the interior circumferential surface into a hollow interior of the tubular body.
US11940055B2
In general terms, the present invention relates to a safety valve or a pressure relief valve (PRV) that is developed to be used in combination boilers and similar appliances and utilized for the purpose of controlling or limiting system pressure. Relief valves are generally used as safety devices in systems where fluid pressure is important, and they reduce the system pressure either by discharging fluid from the system or simply by interrupting the fluid conveyance in case of an emergency when there is an increase in pressure. The present invention relates to a pressure relief valve, the rear cover of which is attached to the body by means of a clawed structure and manufactured from entirely recyclable thermoplastic material.
US11940051B2
The invention relates to a mechanical seal arrangement comprising a first slide ring seal (2) having a rotating slide ring (21) and a stationary slide ring (22) defining a sealing gap (23) therebetween, a shaft sleeve (4), a driver (5) which connects the shaft sleeve (4) to the rotating slide ring (21) and which is arranged to transmit rotation of the shaft sleeve (4) to the rotating slide ring (21) a connecting arrangement (6) for connecting the shaft sleeve (4) to the driver (5), the connecting arrangement (6) comprising at least two rotary locks (60) and at least two recesses (40) in the shaft sleeve (4), wherein each of the rotary locks (60) has a bearing portion (61) and a locking portion (62), wherein the locking portion (62) laterally projects beyond the bearing portion (61), and wherein a rotational axis (Y-Y) of each rotary lock (60) is parallel to a central axis (X-X) of the shaft sleeve (4).
US11940050B2
A seal for an axle shaft assembly which may be found in an automotive transmission or drive axle, is provided. The seal may accommodate significant axle deflection, while retaining a fluid-tight seal between multiple sealing surfaces. The seal may include dynamic flanges configured to seal against surfaces which are angled or orthogonal with respect to one another. The seal may also include one or more holes extending from an outer surface to an inner surface of the seal, such that a body of the seal forms a conduit which allows fluid, such as lubricating fluid, to flow through the seal.
US11940047B2
To provide a simple-structured chain guide assembly frame capable of reliably maintaining a correct positional relationship between a driven sprocket and a sprocket holding portion without the possibility of driven sprocket detachment. The chain guide assembly frame includes a main body having a fixed-guide-side sprocket holding portion and a pivoting-guide-side sprocket holding portion. The fixed-guide-side sprocket holding portion includes a first fixed-guide-side support portion that supports a driven sprocket at a first contact point, and a second fixed-guide-side support portion that supports the driven sprocket at a second contact point located more outside than the first contact point. When the driven sprocket is in an erected state in which the driven sprocket is supported at the first contact point and second contact point, the vector of gravity acting on the gravity center of the driven sprocket points between the first contact point and second contact point.
US11940043B2
A baffle plate (4) including a body portion (5), a cover portion (8, 9) and a seal member (88, 98), a final gear (25) and a driven sprocket (DS) disposed in an accommodating chamber (Sa, Sb) of the baffle plate (4), an oil pump (OP) serving as a source of oil (OL) for lubrication, and an oil pan (16) are provided. At least one of the body portion (5), the cover portions (8, 9) and the seal members (88, 98) includes a material that shrinks as the temperature of the oil (OL) decreases. The baffle plate (4) is dimensioned such that a gap (CL1, CL2) is sealed by the seal member (88, 89) when the temperature of the oil (OL) is equal to or higher than a predetermined oil temperature and an aperture (CL′) is formed when the temperature of the oil (OL) is less than the predetermined oil temperature. The gap (CL1, CL2) is the gap between an inner circumference of an outer wall portion (62, 72) of the body portion (5) and each of a base portion (80) of the cover portion (8) and a base (90) portion of the cover portion (9).
US11940033B2
A dirt shield for shock absorbers having a piston assembly and a cylinder member with a metal dirt shield cap connected to a rod of the piston assembly. A plastic dirt shield bracket is adapted to be fixed to the metal dirt shield cap and includes a first portion and a second portion hingedly connected to one another. A dirt shield tube is connected to the plastic dirt shield bracket.
US11940027B2
An aircraft brake temperature control system (BTCS) 100 for controlling a temperature of a brake 220 of a landing gear 201 of the aircraft 200. The BTCS 100 includes a controller 110 configured to cause at least one fluid moving device 230, 231, 232 to drive a flow of fluid onto the brake 220, selectively in one of a plurality of modes, to control the temperature of the brake 220. The BTCS 100 may be incorporated into an aircraft system 1000 with at least one fluid moving device 230, 231, 232, wherein the aircraft system is on an aircraft 200.
US11940009B2
A bearing seal including an anchoring portion fixed on an inner ring of the bearing, and a sealing portion capable of forming a sealing fit with an outer ring of the bearing, the seal providing rigid slinger of substantially circular shape, the slinger having a root portion formed at a position corresponding to the anchoring portion for stabilization and support, and a radial portion formed in the section corresponding to the area between the anchoring portion and the sealing portion for radial support, wherein the radial portion is formed with at least one slot with the opening direction facing the radial periphery.
US11940005B2
A radial foil bearing includes a bearing housing which has an insertion hole therein, a top foil which is disposed inside the insertion hole, and a foil structure which is interposed between the top foil and the bearing housing, the foil structure has a folded protruding portion that is bent outward in a radial direction of the insertion hole and is bent back inward in the radial direction, and the folded protruding portion is fitted to a fitting groove formed in an end surface of the bearing housing in an axial direction, the axial direction being a direction in which the insertion hole extends.
US11940002B2
The present disclosure relates to a two-part adjustable potted insert to be received within an insert hole of a honeycomb panel for fastening a threaded fastener thereon. The insert comprises an outer structural member which is configured to be received within the insert hole, and an inner structural member in a releasable engagement with the outer structural member. The outer structural member comprises an external main body which defines an external surface configured to resist pull-out and torque-out to retain the outer structural member in the honeycomb panel when inserted in the insert hole, a threaded opening within the external main body which defines a bottom surface, and a locking recess formed within the bottom surface.
US11939996B2
A locking system includes a locking element which is movable between a first, locking position and a second unlocking position and an unlocking actuator for moving the locking element (from the first position to the second position over an unlocking stroke length (Su). The system further comprises a control unit configured to command the unlocking actuator to move the locking element from the first position to a third position over an anti-icing stroke length (Sa) which is shorter than the unlocking stroke length (Su).
US11939992B1
A system for mounting a fan to a ceiling includes a connector adapted to attach to the ceiling. The connector includes at least one guide. An adaptor is adapted to attach the fan to the connector, and includes at least one rail adapted for being received within the at least one guide. A safety bracket is also provided, which is adapted to attach to the ceiling separate from the connector and connect to a safety cable without using a tool. A motor support is also provided with a cavity adapted to receive the power supply, and at least one retainer serves to retain the power supply within the cavity. A quick-connecting escutcheon is also adapted to rotatably connect to the connector.
US11939989B2
A ceiling fan or similar air-moving device can include a motor for rotating one or more blades to drive a volume of air about a space. A connector can be used to connect the blade to a blade iron to mount the blade to the motor. The connector can include a set of receptacles configured to insert into openings on the blade, with the set of receptacles connected by a set of arms. A set of mount posts on the blade iron can seat within the receptacles to mount the blade to the blade iron.
US11939985B2
A control circuit including a motor drive unit and a processing control unit is provided. The motor drive unit includes a drive current for a motor according to a modulation signal, and the motor is powered by a storage battery. The processing control unit obtains an actual speed of the motor, calculate the modulation signal by comparing the actual speed and a target speed, and transmit the modulation signal to the motor drive unit. Also, the modulation signal is used to control rotation of the motor by modulating the drive current, so that the actual speed tends to be equal to the target speed.
US11939980B2
An electronic unit, in particular for an electric fluid pump of a motor vehicle, having a functional element for holding electronics, and a heat sink arranged on the functional element, wherein the functional element and the heat sink are sealed from one another in fluid-tight fashion by means of a cured sealing compound of a liquid seal, and wherein the functional element has at least one ventilation opening, which is open in the course of a curing process for the sealing compound, and which, after the curing process, is sealed in fluid-tight fashion by means of a closure element.
US11939977B2
A scroll compressor comprising a fixed scroll (15); an orbiting scroll (16) supported in a manner allowing for orbiting motion; a discharge port through which a fluid compressed by the two scrolls (15, 16) is discharged; an end plate step portion (16E) provided on an end plate of the orbiting scroll (16) formed so that a height of the end plate is higher on a center portion side in the direction of a spiral wrap and lower on an outer end side; and a wrap step portion (15E) provided on a wall portion of the fixed scroll (15) that corresponds to the end plate step portion (16E) so that a height of the wall portion is lower on the center portion side of the spiral and higher on the outer end side; wherein the orbiting scroll (16) is treated for surface hardening and the fixed scroll (15) is not treated for surface hardening.
US11939957B2
A monitoring system for monitoring a time period of a locking state of a rotor of a wind turbine includes at least one motion sensor and at least one computing unit, wherein the computing unit is configured to receive at least one motion measurement from the at least one motion sensor and wherein the computing unit is configured to determine whether the rotor may remain in the locking state or the rotor should be unlocked based on the at least one motion measurement. A wind turbine having the monitoring system and a method for monitoring a time period of a locking state of a rotor of a wind turbine is also provided.
US11939952B2
A method of installing a wind turbine (10) at an offshore location. The wind turbine (10) includes a tower (18) and an energy generating unit (16). The tower (18) is configured to be secured to a transition piece (12, 42). Prior to shipping, the method includes electrically coupling electrical devices and/or systems (52) by cables (54) to energy generating unit (16) or wind turbine tower (18) or a test dummy therefor. The electrical devices and/or systems (52) are configured to be attached to transition piece (12, 42) once the tower (18) is installed. The method includes testing and commissioning the electrical devices and/or systems (52) while electrically coupled to the cables (54). Prior to shipping and after testing and commissioning, the method includes storing the electrical devices and/or systems (52) and attached cables (54) inside the tower (18). The cables (54) are long enough to permit the electrical devices and/or systems (52) to be attached to the transition piece (12, 42) without disconnecting the electrical devices and/or systems (52) from the cables (54).
US11939950B2
A modular blade connection structure includes a first module, a second module and a structural adhesive module. The first module is provided on an end face thereof with a bonding flange extending into the second module; a gap between the butting surfaces of the first module and the second module is injected with a structural adhesive, which is extruded and cured to form a structural adhesive module; and the thickness of the first module at the starting end of the bonding flange extends towards the inner surface to form a first reinforcement, and the structural adhesive module extends inside the second module in a direction away from the bonding flange to form a second reinforcement. The present disclosure facilitates the control the bonding quality of the double-sided overlapping of the modular blade by means of the bonding flange and the improvement of the fatigue resistance at the assembling position.
US11939948B2
Disclosed is a blade shell section of a wind turbine blade, such as wind turbine blade with a flatback section. The blade shell section extends in a longitudinal direction from a first shell section position to a second shell section position. The blade shell section comprises a first laminate layer forming the outer surface of the blade shell section and a second laminate layer forming the inner surface of the blade shell section. The blade shell section further comprising a first shell section and a corner shell section between the contour shell section and the flatback shell section.
US11939944B2
It is disclosed an electronic device to control an ignition coil of an internal combustion engine, comprising a high-voltage switch, a driving unit, a bias circuit and an integrating circuit. The high-voltage switch is connected in series with a primary winding of a coil. The driving unit is configured to control the closing and opening of the high-voltage switch. The integrating circuit is interposed between the bias circuit and a reference voltage. The integrating circuit comprises an integrating capacitor connected in series to the bias circuit and connected between the bias circuit and the reference voltage. The integrating capacitor is configured to maintain a substantially null charge during a phase of measurement of a ionization current as to measure a substantially null value of an integral of the ionization current, in the case of a misfire of the comburent-combustible mixture.
US11939935B2
A coupling system is utilized to form a multi-part rocket engine thrust compartment that maintains inner channels within walls of the thrust compartment for regenerative cooling. The coupling system includes an insert joint arranged between joint faces of a first segment and a second segment. The first segment and the second segment include inner edges that, when jointed together, form an inner wall. The joint insert is installed between the first segment and the second segment after the inner wall is formed and coupled to the first segment and the second segment. The joint faces of the first segment and the second segment include extending feature to form a flow passage along with cavities at least partially defined by the joint insert.
US11939931B2
An internal combustion engine controller comprising a memory and a processor is provided. The memory is configured to store a plurality of control maps, each control map defining a hypersurface of actuator setpoints for controlling an actuator of the internal combustion engine based on a plurality of input variables to the internal combustion engine controller. The processor comprises an engine setpoint module and a map updating module. The engine setpoint module is configured to output a control signal to each actuator based on a location on the hypersurface of the respective control map defined by the plurality of input variables. The map updating module is configured to calculate an optimised hypersurface for at least one of the control maps. The optimised hypersurface is calculated based on a real-time performance model of the internal combustion engine comprising sensor data from the internal combustion engine and the plurality of input variables. The map updating module further is configured to update the hypersurface of the control map based on the optimised hypersurface. A method of controlling an internal combustion engine is also provided.
US11939925B2
A gas turbine engine includes a core having a compressor section with a first compressor and a second compressor, a turbine section with a first turbine and a second turbine, and a primary flowpath fluidly connecting the compressor section and the turbine section. The first compressor is connected to the first turbine via a first shaft, the second compressor is connected to the second turbine via a second shaft, and a motor is connected to the first shaft such that rotational energy generated by the motor is translated to the first shaft. The gas turbine engine includes a takeoff mode of operation, a top of climb mode of operation, and at least one additional mode of operation. The gas turbine engine is undersized relative to a thrust requirement in at least one of the takeoff mode of operation and the top of climb mode of operation, and a controller is configured to control the mode of operation of the gas turbine engine.
US11939924B2
A system for modulating air flow in a gas turbine engine is provided. The system may include a seal wall comprising an opening, a seal door configured to slideably engage the seal wall, and an actuator configured to move the seal door over the opening. In various embodiments, the system may include a surface forward of the seal door. The seal door may be configured to seal a passage through the surface and the opening of the seal wall. A track may be disposed under the seal door. The track may comprise cobalt. Rollers may be coupled to the seal door with the rollers on the track. The seal door may comprise a nickel-chromium alloy. A sync ring may be coupled to the seal door. The actuator may be coupled through the sync ring to the seal door.
US11939921B2
A combustion-gas supply system and a combustion-gas supply method thereof, a device equipped with a turbine engine, and a fracturing system are provided. The combustion-gas supply system includes a main pipeline and a multi-functional pipeline; the main pipeline includes a first sub-pipeline and a second sub-pipeline; the first sub-pipeline includes a first gas intake pipe, a first gas supply valve and a first gas outlet pipe arranged in sequence; the second sub-pipeline includes a combustion-gas supply valve and a gas supply pipe, the first gas outlet pipe is connected with the combustion-gas supply valve, the gas supply pipe is configured to be connected with a turbine engine, the multi-functional pipeline includes a second gas intake pipe, a second gas supply valve and a second gas outlet pipe arranged in sequence, and the second gas outlet pipe is communicated with the first gas outlet pipe.
US11939914B2
There is described a method of operating a multi-engine system of an helicopter. The multi-engine system has a first turboshaft engine having a first shaft, a second turboshaft engine having a second shaft, a gearbox having a clutch system, and a range of rotation speeds defined as a placarded zone. The method generally has rotating the first shaft at a flight rotation speed when clutched and rotating the second shaft at a first idle rotation speed when unclutched, the first idle rotation speed above the placarded zone; decreasing a rotation speed of the first shaft from the flight rotation speed to a given rotation speed within the placarded zone; decreasing a rotation speed of the second shaft to the given rotation speed; clutching the second shaft; and decreasing the rotation speeds of the first and second shafts to a second idle rotation speed below the placarded zone.
US11939907B2
An ECM executes a catalyst early activation control at the cold start of an engine such that the activation of a catalyzer is promoted by opening a WGV. Further, the ECM performs a diagnosis process of diagnosing whether or not the WGV is stuck closed, based on the amplitude of the output fluctuation in an air-fuel-ratio sensor during execution of the catalyst early activation control.
US11939902B2
An apparatus of purifying exhaust gas of a hybrid vehicle includes an electric supercharger disposed on an air intake line, a post-treatment unit disposed on an exhaust gas line and including an electrically-heated catalyst, an exhaust gas recirculation unit including an exhaust gas recirculation cooler disposed on a recirculation line connecting the post-treatment unit and the intake line and an exhaust gas recirculation valve disposed on the recirculation line, a three-way valve disposed at a position at which the recirculation line diverges into a front end portion and a rear end portion of the intake line, and a controller electrically connected to the three-way valve and configured for controlling the three-way valve connecting the intake line and the recirculation line at the front end portion of the electric supercharger to be selectively opened or closed.
US11939901B1
An oxidizing reactor apparatus having a heat exchange reactor having an input port, an entry channel in fluid communication with the input port, an exit channel in fluid communication with the entry channel via a plurality of pores and an output port in fluid communication with the exit channel, wherein the exit channel is in thermal communication with the entry channel, an engine in fluid communication with the heat exchange reactor and a heater engaged with the heat exchange reactor to initiate and maintain the oxidation of fuel within the heat exchange reactor. The disclosed heat exchange reactor may be configured to receive engine exhaust from the engine and oxidize fuel within the engine exhaust prior to expelling the engine exhaust. The heat exchange reactor may be further configured to utilize heat released by the oxidation of un-combusted fuel to increase the temperature of the engine exhaust leaving the engine.
US11939896B2
A blowby gas return apparatus is provided that achieves inhibition of condensation of water vapor in blowby gas in branched return passages. A blowby gas return apparatus that returns blowby gas generated in an engine having a plurality of cylinders to an intake system of the engine includes a distribution portion inside a head cover of the engine, and distributes the blowby gas to intake paths of the cylinders. The distribution portion includes an introduction portion through which the blowby gas is introduced and a plurality of branch passages communicating with the introduction portion, plurality of branch passages branching from the introduction portion to communicate with the intake paths.
US11939893B2
A cylinder crankcase for an internal combustion engine includes at least one riser duct. The cylinder crankcase comprises at least one additional riser duct, which is configured to exchange oil between the main oil gallery and the cylinder head. The cylinder crankcase also comprises a connecting duct, via which the at least one riser duct and the at least one additional riser duct are connected in an oil-conducting fashion.
US11939890B2
A continuous variable valve duration apparatus includes: a camshaft, a front cam unit and a rear cam unit of which the phase relative to the camshaft can be varied, a front inner wheel and a rear inner wheel, a front guide bracket and a rear guide bracket, a front wheel housing and a rear wheel housing, a front control shaft, a rear control shaft, a phase controller selectively changing the relative phase of the front control shaft and the rear control shaft, a main driving unit for driving the rear control shaft, vibration sensors that measure the vibration of each cylinder corresponding to the front cam unit and the rear cam unit and output a corresponding signal, and a controller for controlling the operation of the main driving unit and the phase controller according to the output signals of the respective vibration sensors.
US11939883B2
An airfoil includes an airfoil section that has an airfoil wall that defines a leading end, an arced trailing end, and first and second sides that join the leading end and the arced trailing end. The first and second sides span in a longitudinal direction between first and second ends. The airfoil wall circumscribes an internal core cavity that includes an exit region that spans between the first and second ends and that opens through the arced trailing end. The exit region includes pedestals arranged in a plurality of longitudinal pedestal rows. At least one of the longitudinal pedestal rows is straight and at least one of the longitudinal pedestal rows is arced.
US11939878B1
A turbomachine component is provided. The turbomachine component formed from an additive manufacturing system. The additive manufacturing system defines an axial build direction, a radial direction, and a circumferential direction. The turbomachine component includes an exterior portion. The exterior portion includes a first end wall, a second end wall, and an outer band extending axially between the first end wall and the second end wall. The turbomachine component further includes an interior portion disposed within the exterior portion. The interior portion includes a self-breaking inner band extending axially between the first end wall and the second end wall. The self-breaking inner band includes a plurality of teeth disposed between the first end wall and the second end wall.
US11939874B2
A valve for an air system in an aircraft engine, comprising: a housing defining a chamber having a valve axis; a body within the chamber about a piston axis collinear with the valve axis, extending from a first surface to a second surface, defining a bore extending from the first to the second surface, having a mating connector defined by the second surface and located radially outward of the bore relative to the piston axis; and a sleeve extending from a first end matingly engaged with the mating connector to a second end along a sleeve axis collinear with the valve axis, the first end axially stacked on the body via the first surface to define a first distance between the first end and the first surface, and via the second surface to define a second distance between the first end and the second surface greater than the first distance.
US11939870B2
A gas-cycle system operable using a Bell-Coleman cycle, the gas-cycle system comprising an expander (23) and a compressor (27) incorporated in a flow path (13). The expander (23) and compressor (27) are integrated in a rotary machine (41), and each comprises a rotor assembly (70) configured to define one or more zones (80) each of which changes continuously in volume during a rotation cycle of the rotor assembly. The expander (23) and compressor (27) are drivingly interconnected whereby rotational drive applied to one is transmitted directly to the other. Each rotor assembly (70) comprises an inner rotor (73) and an outer rotor (75) adapted to rotate about parallel axes at different rotational speeds. The inner rotors (73) are each drivingly connected to a common shaft for rotation therewith. The two outer rotors (75) are coupled together such that rotational drive applied to one is transmitted directly to the other. An air-cycle system and an air conditioning system (10) based on the gas-cycle system are also disclosed.
US11939869B2
Provided is a mineral bit and cutting tip therefor. The mineral bit is configured to penetrate geological materials in a dig face to effectively process the same. The mineral bit includes various geometric constraints to increase structural integrity and penetration capability. The cutting tip may have increased durability and may be self-sharpening.
US11939863B2
A method includes deploying an optical fiber attached to a distributed acoustic sensing (DAS) interrogator in a wellbore, pre-setting gauge length of the DAS interrogator based on an expected measurement signal, interrogating the optical fiber using the DAS interrogator, receiving reflected DAS signals along a length of the optical fiber using the pre-set gauge length, performing an analysis to estimate a location and a magnitude of a strain source associated with the reflected DAS signals, and dynamically adjusting the gauge length for at least a portion of the optical fiber within a pre-defined limit of the DAS interrogator as a function of the estimated location and magnitude of the strain source to enhance sensitivity and to optimize signal-to-noise ratio.
US11939861B2
A lead-free pinscreen imprint device for retrieving at least one imprint of a topmost surface of a fish located in a wellbore may include a housing with a central aperture that extends along a section of a central axis thereof. The lead-free pinscreen imprint device may include a pinscreen portion disposed in the housing. The pinscreen portion may include various pins that are disposed along a vertical axis that is parallel to the central axis. The pinscreen portion may include an imprint surface that faces in a downward direction and a scanning surface that faces in an upward direction. The lead-free pinscreen imprint device may include a three-dimensional (3D) laser image scanner disposed in the housing at a location that is immediately above the pinscreen portion. The 3D laser image scanner may be configured to scan the scanning surface and identify any depth changes in the scanning surface.
US11939855B2
A diverting agent and method for temporarily filling fractures. The diverting agent contains a powder-like polyvinyl alcohol-based resin (P1) and a pellet-like polyvinyl alcohol-based resin (P2), and has an adsorption coefficient kc of 0.01 or more and 1 or less.
US11939852B2
The present invention provides a method and system for providing on-site electrical power to a fracturing operation, and an electrically powered fracturing system. Natural gas can be used to drive a turbine generator in the production of electrical power. A scalable, electrically powered fracturing fleet is provided to pump fluids for the fracturing operation, obviating the need for a constant supply of diesel fuel to the site and reducing the site footprint and infrastructure required for the fracturing operation, when compared with conventional systems.
US11939851B2
A downhole tool includes a body including a microwave generator, a susceptor shell connected to the body, and a thermometer connected to the body. The susceptor shell includes a wall made of a susceptor material and a cavity formed between the wall and the body. A system includes a well extending from a surface, a microwave heating tool positioned in the well, and an electrical cable extending from a power source at the surface to the microwave heating tool. A method of treating condensate buildup in a well includes lowering a microwave heating tool into the well to a treatment zone including accumulated condensates, providing power to the microwave heating tool via an electrical cable, increasing a temperature of the treatment zone to an elevated temperature using heat generated by the microwave heating tool, and removing the accumulated condensates in the treatment zone.
US11939850B2
A treatment system comprises a treatment bladder associated with a volume of a tubing-casing annulus of a wellhead system to be treated. The treatment bladder contains a treatment fluid and is at an elevated pressure. The treatment bladder is coupled to the tubing-casing annulus utilizing a fluid conduit through a lower fluid junction. The fluid conduit permits two-way fluid communication between the treatment bladder and the tubing-casing annulus. A method for treating the tubing-casing annulus includes coupling the treatment bladder containing the treatment fluid of the treatment system to the tubing-casing annulus of the wellhead system using the fluid conduit, establishing two-way fluid communication between the tubing-casing annulus and the treatment bladder though the fluid conduit, halting fluid communication though the fluid conduit, and decoupling the treatment bladder from the tubing-casing annulus.
US11939843B2
Provided is a wellbore scraper assembly for use with a wireline. The wellbore scraper assembly, in one example, includes a tubular housing, a plurality of hydraulically deployable scraper features associated with the tubular housing, the plurality of hydraulically deployable scraper features configured to move from a first retracted state to a second radially extended state, and a hydraulic deployment system coupled to the plurality of hydraulically deployable scraper features, the hydraulic deployment system configured to move the plurality of hydraulically deployable scraper features from the first state to the second state.
US11939839B2
A valve arrangement is for a downhole apparatus having a tubular body having first and second ports in a wall thereof. The valve arrangement comprises a first valve arrangement comprising a first valve member associated with the first port of the tubular body; and a second valve arrangement comprising a second valve member associated with the second port of the tubular body. The first valve arrangement and the second valve arrangement are configurable to lock in a first configuration with the tubular body, such that the first port is closed and the second port is closed; to lock in a second configuration with the tubular body, such that the first port is open and the second port is closed; and to lock in a third configuration with the tubular body, such that the first port is closed and the second port is open.
US11939838B2
An ingress-barrier assembly for use with pressure-operated downhole equipment can be used to limit hydraulic fluid flow in a wellbore environment for completions and operations through the life of a well. An assembly can comprise a first port to communicate hydraulic fluid with a first fluid conveyance line. The assembly can include a second port to communicate hydraulic fluid with a second fluid conveyance line. The assembly can further include a first-end stop, a second-end stop, and a moveable seal. The moveable seal can move within a bore of the assembly between the first-end stop and the second-end stop to communicate pressure between the first port and the second port.
US11939830B2
A tool, system and associated methodorient core samples extracted during borehole drilling intended to be coupled to a core barrel and/or to the cable of a head assembly, which at least include electronic processing means provided with at least one processing unit and orthogonally coupled triaxial accelerometers communicated with the processing unit, configured to record data on the movement and/or instantaneous vibration of the tool, which further includes orthogonally coupled micromechanical gyroscopes, configured to rotate relative to an axis of rotation of the tool and transmit the orientation data to the processing unit, wherein the processing unit is configured to, from the data of the set of triaxial accelerometers and the set of micromechanical gyroscopes, calculate the orientation of the core sample with respect to true north and the trajectory of the drilled borehole.
US11939829B2
A setting tool for actuating a downhole component includes an inner tubular configured to be connected in fluid communication with a borehole string, a housing configured to define a first fluid chamber and a second fluid chamber isolated from the first fluid chamber and in fluid communication with the inner tubular, and a setting piston in pressure communication with the second fluid chamber. The setting tool includes a metering module coupled to the housing and disposed at an end of the first fluid chamber, the metering module including a fluid path forming a restriction therein, and an outlet connected to the fluid path. The outlet is configured to be opened to permit fluid to flow out of the first chamber at a controlled rate to generate a differential pressure between the first and second chambers that causes the setting piston to apply a gradually increasing force on the component.
US11939826B2
A wellhead adapter assembly is disclosed. A wellbore adapter is designed for connection to a drillstring, with a riser fluidly connected to the wellbore adapter. At least one tubular arm section is rotatably and fluidly connected to the riser. A positioning system is attached to the at least one tubular arm. The positioning system is adapted to maintain the at least one tubular arm in a desired position relative to the riser, despite relative movement between the drillstring and a floating structure such as a drilling rig.
US11939824B2
A tong for handling a tubular includes a jaw carrier having an active jaw movable from a retracted position to an extended position relative to the jaw carrier; a cam body disposed about the jaw carrier and rotatable relative to the cam body; and a brake assembly including an first brake member for engaging an upper surface coupled to the jaw carrier.
US11939823B2
One illustrative production/annulus bore stab disclosed herein includes a one-piece body that comprises a first cylindrical outer surface and a second cylindrical outer surface and a plurality of individual fluid flow paths defined entirely within the one-piece body. In this illustrative example, each of the individual fluid flow paths is fluidly isolated from one another and each of the fluid flow paths comprise a first inlet/outlet at a first end of the fluid flow path that is positioned in the first cylindrical outer surface and a second inlet/outlet at a second end of the fluid flow path that is positioned in the second cylindrical outer surface.
US11939817B2
The present discloses an automatically locked retractable protective door sill, including a retractable curtain assembly, a scroll assembly, an upper fixing base and a lower fixing base, a dial mechanism and a locking mechanism are arranged in the upper fixing base, the locking mechanism includes a hydraulic rod capable of retracting at a fixed time, and the hydraulic rod is connected to the dial mechanism; the sliding base is connected to the hydraulic rod, and the hydraulic rod drives the sliding base and drives the linkage base to reset automatically, so the automatic locking of the locking mechanism is achieved, and then the scroll assembly is locked. The whole device has a simpler structure and more convenient operation, the dial button may be manually pushed to return for locking after not reaching the set time, so as to prevent children opening the door sill during an automatic locking process.
US11939813B2
A window covering includes a tilt mechanism positionable in a first rail. The tilt mechanism includes a tilt shaft gear, a control gear, and a wand connector. An upper end of the wand connector has a hole in communication with a channel defined in a body of the wand connector such that a central projection of the control gear is insertable into the wand connector via the hole and the channel. A plurality of protrusions extend from the body of the wand connector around a periphery of the body of the wand connector. Each of the protrusions can have an upper surface configured to contact a respective one multiple prongs that extend from the control gear to engage the prongs to facilitate a direct connection of the wand connector to the control gear.
US11939805B2
A door drive for a motor vehicle door or motor vehicle flap, which is provided with an electromotive drive, a transmission downstream of the drive, and a force-transmission element. The force-transmission element is operatively connected to a leaf of the motor vehicle door or motor vehicle flap. An output element of the transmission and the force-transmission element are coupled by a toothing with compensation for play. According to the invention, the output element and/or the force-transmission element are not only designed to be moveable for play compensation, but can also be permanently fixed after the compensation for play.
US11939801B2
A hinge bracket assembly includes an anchor plate. A retention member extends perpendicular to the anchor plate. The anchor plate defines a first receiving aperture. A hinge plate is aligned with the anchor plate and includes a hinge arm and a protrusion. The protrusion extends from an edge of the hinge plate opposite the hinge arm. The hinge plate defines a second receiving aperture aligned with the first receiving aperture when the protrusion is received by a space defined by the retention member. A locking arm is rotatable between an unlocked position and a locked position and is configured to be at least partially received by the first and second receiving apertures to couple the anchor plate and the hinge plate.
US11939796B2
A dock for a portable electronic device includes a base and a first arm supported by the base. The first arm includes a first hook coupled to an end of the first arm. The first hook is configured to engage a first edge of the portable electronic device. The dock further includes a second arm supported by the base. The second arm includes a side door movably coupled to an end of the second arm. The side door has a second hook configured to engage a second edge of the portable electronic device. The side door is movable between a first position, in which the portable electronic device is secured to the dock, and a second position, in which the portable electronic device is removable from the dock.
US11939788B2
A fence panel configured to occupy an opening between adjacent pickets of a fence, the fence panel comprising a primary panel, a suspension panel extending substantially horizontally from an upper portion of the primary panel and above a rail of the fence, a vertical portion extending downwardly from the suspension panel behind the rail, a horizontal tab configured to wrap about the rail, at least one flange extending from the primary panel and at least one vertical tab extending from the at least one flange and configured to wrap about a picket.
US11939781B2
A module for a fall protection system comprises a structural sheet having a ridge and an attachment panel extending laterally therefrom and one or more attachment sections. The attachment panel can be secured to a structure. The module has one or both of: (i) an anchorage connector attached to the ridge at an attachment section; and (ii) a rail clamp having a sleeve portion and a leg portion attached to the ridge at an attachment section; a rail extending through and supported by the sleeve portion; and a slider supported on the rail. The slider is slideably movable along the rail and has a slider anchorage connector. The ridge may be received in a flashing ridge having a flashing extending laterally therefrom to provide coverage for the attachment panel. A person may be attached to the anchorage connector or the slider anchorage connector via a safety line.
US11939771B2
Support members for a roof system are provided to allow for positioning panels of a roof apart from building members so that building components, such as insulation may be placed between the roof panels and the building members. The support members may be utilized in new buildings or to retrofit existing buildings. Each of the support members may comprise a single support member that has a base portion operatively coupled to an offset portion that is operatively coupled to an upper portion. One or more channels may be provided in the base portion, offset portion, and/or the upper portion to provide structural support and to allow the support members to be operatively coupled to each other and other building members without the need for additional components.
US11939767B1
A cap and tube or seal setting apparatus comprises an anchor holding fixture having a surface for receiving a post tension anchor. An actuator is operably mounted to one side of the anchor holding fixture and in some embodiments has a cap setter attached to a movable part of the actuator. In some embodiments a tube or seal holding fixture is mounted to a support base and disposed on an opposed side of the anchor holding device.
US11939764B2
Provided is a ventilation member suitable for ensuring the ventilation of a ventilation layer provided on the back side of a wall material. A ventilation member X according to the present invention is a ventilation member that can be attached to a wall material, and includes a fixed plate portion 10, a top plate portion 20, a partition plate portion 30, a bottom plate portion 40, a front plate portion 50, and a first baffle plate portion 61. The fixed plate portion 10 has a first surface that abuts against a building framework, and a second surface on a side opposite to the first surface, and includes a first end portion 13 located on one side in a state in which the ventilation member X is attached to the wall material, and a second end portion 14 located on another side. The top plate portion 20 extends from the first end portion 13 of the fixed plate portion 10 on the second surface side. The partition plate portion 30 extends from the top plate portion 20 in a direction from the first end portion toward the second end portion of the fixed plate portion 10. The bottom plate portion 40 extends from the partition plate portion 30 in a direction away from the fixed plate portion 10. The front plate portion 50 extends from the bottom plate portion 40 in a direction from the second end portion toward the first end portion of the fixed plate portion 10. The first baffle plate portion 61 extends from the front plate portion 50 to the partition plate portion 30 side. The bottom plate portion 40 has a first hole 42. A wall material construction structure Y1 according to the present invention includes such a ventilation member X.
US11939749B2
An apparatus, system, and method for the extraction of water molecules from the air includes a combination of electrical mechanisms and materials engineering. With the help of hydrophobic and hydrophilic materials on an array of thermally conductive and electrically insulated materials, the extraction of water from the air is significantly increased. A combination of hydrophobic and hydrophilic materials and an electric field gradient moves the water molecules towards the collection system thus speeding up the water formation process. This also inhibits the re evaporation of the water droplets.
US11939745B2
An electrically driven construction machine is provided in which, in a case where a plurality of electrically driven construction machines operate simultaneously, it is possible to avoid exceeding the allowable electric power that can be output by the electric power receiving facility of a commercial electric power supply. A controller computes an own demanded power Pd1 for driving the plurality of hydraulic actuators, on the basis of operation signals of the operation devices, computes an allowable power as a power limit value usable by the electric motor on the basis of the own demanded power, the demanded powers of the other electrically driven construction machines received through the communication device, and an allowable electric power of the electric power receiving facility of the commercial electric power supply, and controls the electric motor such that a power consumption of the electric motor does not exceed the allowable power.
US11939733B2
A cable barrier system is managed by a cable barrier management system including a management system controller having a management processor and a plurality of turnbuckle subsystems joined to respective barrier cables to provide pretension. Each of the turnbuckle subsystems has a strain gauge mounting zone, and strain is communicated from a strain gauge circuit to the management processor. The controller is configured to determine excess strain events. Strain event data is sent via a wireless data communications interface to a remote recipient computing device.
US11939725B2
A hot-extraction paper consisting substantially of cellulose and manufacturing assistants needed in cellulose and manufacturing assistants needs in cellulose production, such as pH modifiers based on acids and/or bases, the paper comprises exclusively cellulose having fibre lengths of at least 2.0 mm on length-weighted average, more particularly at least 2.5 mm on length-weighted average, and has isotropic extension properties which are substantially equal in machine and cross directions and amount to at least 7.5%, more particularly at least 8.5%.
US11939717B2
An appliance includes a cabinet defining at least one chamber accessible via an opening. The appliance also includes a cover member movable between an open position and a closed position for providing selective access to the opening. The appliance includes a hinge assembly constructed of a polymer material and operably coupled to the cover member. The hinge assembly includes first and second hinge members. The first hinge member is fixedly secured to the cabinet. The second hinge member includes a base portion fixedly secured to cover member and a pin portion. The pin portion is rotatably secured to the first hinge member to move the cover member between the open and closed positions. In the open position, the first and second hinge members cooperatively engage together to restrict movement of the cover member in the open position. In the closed position, the cabinet restricts movement of the cover member.
US11939716B2
Disclosed is a clothes treating apparatus including a drum configured to receive laundry, a tub in which the drum is built, a main body in which the drum and the tub are disposed, detergent drawer compartments provided in the main body to be withdrawn from or inserted in the main body, a spray nozzle configured to spray washing water to the detergent drawer compartments, a water-collecting container disposed below the tub to receive the washing water, a washing line configured to supply the washing water of the water-collecting container to the spray nozzle, a circulation line configured to supply the washing water of the water-collecting container into the drum, and a flow-path conversion pump configured to receive the washing water from the water-collecting container and supply the washing water selectively to the washing line or the circulation line.
US11939715B2
A liquid discharge apparatus includes a liquid discharge head including a nozzle face in which a nozzle is formed and configured to discharge a liquid, a carriage on which the liquid discharge head is mounted, and a guide shaft configured to hold the carriage movably. The liquid discharge apparatus further includes a driver configured to move the carriage, and a coupling between the carriage and the driver. The coupling is disposed on an axis of the guide shaft in a direction orthogonal to the axis of the guide shaft.
US11939705B2
Present invention teaches a bamboo fabric shade that is woven in a weft and warp fashion from a plurality of bamboo filaments. An alternative embodiment of dual bamboo filaments as a single unit for the weaving is done in a similar fashion. Each bamboo filament has a high molecular mass bamboo thread inside a layer of coating wherein the coating is made to be thicker at a middle node section with the thickness tapering off towards the two distal ends of the high molecular mass bamboo thread. The coating uses PVC material, with optional addition of UV-absorbent materials. Such construction of the bamboo fabric adds to the reduction of light pollution when used for home decoration purposes.
US11939694B2
The present invention relates to a method for coating a component of a turbomachine in a bath, in which method, the component is partially immersed in the bath containing a coating material; the component is rotated at least intermittently around an axis of rotation, which lies outside of the bath, during the at least partial immersion; the component is at most immersed partially over and beyond the rotation.
US11939688B2
Photoelectrochemical (PEC) technology for the conversion of solar energy into chemicals may require cost-effective photoelectrodes to efficiently and stably drive anodic and/or cathodic half-reactions to complete the overall reactions for storing solar energy in chemical bonds. Apparatus and systems incorporating effectively transparent metal catalysts enable the design and/or implementation of PEC devices for light harvesting. Triple-junction photocathodes with the triangular catalyst grids are provided to improve the efficiency of the photocathodes to generate renewable fuel from sunlight.
US11939682B2
The embodiments of the present disclosure relate to a method and apparatus for producing a carbon nanomaterial product (CNM) product that may comprise carbon nanotubes and various other allotropes of nanocarbon. The method and apparatus employ a consumable carbon dioxide (CO2) and a renewable carbonate electrolyte as reactants in an electrolysis reaction in order to make CNTs. In some embodiments of the present disclosure, operational conditions of the electrolysis reaction may be varied in order to produce the CNM product with a greater incidence of a desired allotrope of nanocarbon or a desired combination of two or more allotropes.
US11939681B1
A a plant composite corrosion inhibitor for an oil field and a preparation method thereof belong to the technical field of preparation of oil field chemical agents. The plant composite corrosion inhibitor comprises a first plant ingredient, a second plant ingredient, a corrosion inhibition synergist and an organic solvent. The first plant ingredient is zeaxanthin and a derivative thereof obtained by supercritical CO2 extraction of marigold; the second plant ingredient is prepared from luffa leaves, guava leaves and eclipta according to a mass ratio of 5:8:9; the corrosion inhibition synergist is prepared by mixing potassium iodide, 8-hydroxyquinoline and sodium dodecyl benzene sulfonate according to a mass ratio of 3:4:2; and the organic solvent is ethanol with a mass concentration of 82%. The composite corrosion inhibitor has a good corrosion inhibition effect, and reduces harmful chemical ingredients in the corrosion inhibitor.
US11939674B2
Exemplary deposition methods may include delivering a silicon-containing precursor and a boron-containing precursor to a processing region of a semiconductor processing chamber. The methods may include providing a hydrogen-containing precursor with the silicon-containing precursor and the boron-containing precursor. A flow rate ratio of the hydrogen-containing precursor to either of the silicon-containing precursor or the boron-containing precursor is greater than or about 1:1. The methods may include forming a plasma of all precursors within the processing region of a semiconductor processing chamber. The methods may include depositing a silicon-and-boron material on a substrate disposed within the processing region of the semiconductor processing chamber.
US11939665B2
A film thickness measurement apparatus includes: a stage that places a substrate having a film formed thereon and measures a thickness of the film in-situ in a film forming apparatus; a film thickness meter including a light emitter that emits light toward the substrate disposed on the stage and a light receiving sensor that receives the light reflected by the substrate for measuring the thickness of the film in-situ; a moving mechanism including a multi-joint arm that moves an irradiation point of the light on the substrate; a distance meter that measures a distance between the light receiving sensor and the irradiation point on the substrate; and a distance adjustor that adjusts the distance between the light receiving sensor and the irradiation point on the substrate.
US11939640B2
A method for producing a hot-rolled steel sheet, a method for producing a cold-rolled full-hard steel sheet, and a method for producing a heat-treated sheet are provided herein. The methods comprising hot rolling a steel material of a composition comprising, in mass %, C: 0.05 to 0.12%, Si: 0.80% or less, Mn: 1.30 to 2.10%, P: 0.001 to 0.050%, S: 0.005% or less, Al: 0.01 to 0.10%, N: 0.010% or less, one or more selected from Cr in an amount of 0.05 to 0.50%, and Mo in an amount of 0.05 to 0.50%, one or more selected from Ti in an amount of 0.01 to 0.10%, Nb in an amount of 0.01 to 0.10%, and V in an amount of 0.01 to 0.10%, and the balance Fe and unavoidable impurities.
US11939637B2
In one aspect, provided herein is a method comprising: (a) (i) determining cytolytic activity in a tumor from the subject; and/or (ii) determining genetic alterations associated with cytolytic activity in the tumor; and (b) administering an immunotherapeutic agent to the subject if (i) cytolytic activity is detected in the tumor and/or (ii) a genetic alteration associated with induction of cytolytic activity, tumor resistance to cytolytic activity and/or suppression of cytolytic activity is detected in the tumor.
US11939633B2
A COTL1 gene or protein maintains and regulates the homeostasis of hematopoietic stem cells. A method of diagnosis and treatment of blood-related disease caused either by abnormalities in the homeostasis of hematopoietic stem cells, which result from a mutation in the COTL1 gene or a decrease in the expression of the COTL1 protein, or by an imbalance between the differentiation or proliferation and damage or death of hematopoietic stem cells, or by abnormalities in mitochondrial homeostasis are disclosed. The COTL1 gene or protein plays an important role in regulating mitochondrial morphology, and when it is knocked down, the number of hematopoietic stem cells decreases.
US11939625B2
A method and a sensor for detecting L-cystine are disclosed. The method is implemented by assembling a sodium 3,3′-dithiodipropane sulfonate (SPS) membrane on a surface of Au membrane layer of an Au electrode and using an extended gate of field effect transistor (FET) and in-situ signal amplification of the FET to detect L-cystine sensitively. The polyanion of the SPS membrane adsorbs and binds a positively charged target L-cystine through electrostatic interaction, thus forming an electric double layer structure to generate a membrane potential identifying a monovalent organic ammonium ion. The sensor includes the FET, wherein a gate-extended gold electrode is arranged on the FET, and the SPS membrane is assembled on the surface of the Au membrane layer of the gate-extended gold electrode. The sensor has an excellent Nernst response to L-cystine.
US11939613B2
The present disclosure relates to the production of cannabinoids in yeast. In as aspect there is provided a genetically modified yeast comprising: one or more GPP producing genes and optionally, one or more GPP pathway genes; two or more olivetolic acid producing genes; one or more cannabinoid precursor or cannabinoid producing genes; one or more Hexanoyl-CoA producing genes, and at least 5% dry weight of fatty acids or fats.
US11939606B2
A new CRISPR-associated (Cas) protein, termed “CasM,” is described, as well as polynucleotides encoding the same and methods of using CasM for site-specific genome engineering. CasM proteins are capable of targeting and cleaving single-stranded RNA.
US11939600B2
This invention provides a range of translatable polynucleotide and oligomer molecules for expressing a human phenylalanine hydroxylase (PAH), or a fragment thereof having PAH activity. The polynucleotide and oligomer molecules are expressible to provide the human PAH or a fragment thereof having PAH activity. The molecules can be used as active agents to express an active polypeptide or protein in cells or subjects. The agents can be used in methods for ameliorating, preventing, delaying onset, or treating a disease or condition associated with phenylketonuria, decreased metabolism of phenylalanine, or increased levels of phenylalanine in a subject.
US11939595B2
This disclosure provides nano-scale Artificial Antigen Presenting Cells (aAPC), which deliver stimulatory signals to lymphocytes, including T-helper lymphocytes, for use as a powerful tool for immunotherapy.
US11939580B2
A self-circularization RNA construct that can be expressed in a DNA vector and simultaneously circularized through a self-targeting and splicing reaction to form a circRNA is disclosed. The circRNA can consist only of a gene of interest which can be a coding, non-coding, or a combination thereof. The gene of interest has the advantage of being able to rapidly express a peptide or protein. The formed circRNA has a circular structure and has a stable and high half-life because 5′ and 3′ ends are not exposed. Accordingly, functional RNA such as miRNA, anti-miRNA, siRNA, shRNA, aptamer, functional RNA for gene/RNA editing, ADAR (adenosine deaminase acting on the RNA)-recruiting RNA, mRNA vaccine, mRNA therapeutic agent, vaccine adjuvant, and CAR-T mRNA can be produced as a stable circRNA in cells.
US11939579B2
The present invention relates to a tissue-specific promoter system for expressing microRNA (miRNA) for RNA interference-based methods of gene therapy. In these systems, the miRNA will inhibit gene expression or replace natural miRNA expression using microRNA.
US11939578B2
The present invention relates to the field of biomedicine, particularly to double-stranded RNA molecules targeting CKIP-1 and uses thereof, particularly to use of the double-stranded RNA molecules for the treatment of inflammatory diseases such as arthritis, particularly rheumatoid arthritis.
US11939575B2
Provided are compositions and methods for altering gene expression in cells. The compositions and methods may utilize a nucleic acid sequence that has a genetically modified trans-activating crRNA (tracrRNA) sequence, where at least one uracil nucleotide of the tracrRNA sequence is replaced with a nucleotide other than uracil, and/or a nucleic acid sequence that has a guide RNA (gRNA) sequence wherein one or more cytosine nucleotides and/or one or more uracil nucleotides of said gRNA sequence are modified nucleotides. Also provided are methods of treating a disorder in a subject in need of the treatment. The method may involve administering to the subject the nucleic acid or a vector thereof in combination with an RNA-guided DNA endonuclease enzyme.
US11939572B2
The invention relates to a chimeric antigen-receptor polypeptide heterodimer comprising two polypeptides, wherein the first contains an extracellular part of the major histocompatibility complex I alpha chain and the second contains a 32-microglobulin domain, or the first contains an extracellular part of the major histocompatibility complex II alpha chain and the second contains a major histocompatibility complex II beta chain. One of the polypeptides further contains a transmembrane domain, a hinge region and an intracellular domain of the T cell receptor alpha chain and the other one contains a transmembrane domain, a hinge region and an intracellular domain of the T cell receptor beta chain, and additionally an antigen-peptide covalently linked to said extracellular MHC domain. The invention further relates to a method for the identification of a TCR recognizable peptide sequence making use of the heterodimer of the invention.
US11939570B2
A microfluidic lab-on-a-chip system for DNA gene assembly that utilizes a DNA symbol library and a DNA linker library. The lab-on-a-chip has a fluidic platform with a plurality of arrays operably connected to a voltage source and a controller for the voltage source, a set of first inlets operably connected to the fluidic platform, each first inlet for one DNA symbol from a DNA symbol library, a set of second inlets operably connected to the fluidic platform, each second inlet for one DNA linker from a DNA linker library, and a mixing area operably connected to the fluidic platform and to the plurality of first inlets and the plurality of second inlets.
US11939567B2
Reactors, systems and processes for the production of biomass by culturing microorganisms in aqueous liquid culture medium circulating inner loop reactor which utilize nonvertical pressure reduction zones are described. Recovery and processing of the culture microorganisms to obtain products, such as proteins or hydrocarbons is described.
US11939565B1
Provided herein is a method for incubating living cells, in accordance with principles of the disclosure, may include the steps of: (a) providing a pressurized gas to a medium reservoir, the pressurized gas providing an impetus that moves a growth medium in the medium reservoir to a bioreactor chamber via a first incoming fluid line connecting the medium reservoir to the bioreactor chamber; (b) simultaneously or subsequently to step (a), providing a pressurized gas to a cell reservoir holding a suspension of the living cells, the pressurized gas providing an impetus that moves the suspension to the bioreactor chamber via a second incoming fluid line connecting the cell reservoir to the bioreactor chamber; and (c) incubating the growth medium and the living cells in the bioreactor chamber, under conditions compatible with cell viability.
US11939555B2
A fabric care composition is provided including water; a modified carbohydrate polymer having a weight average molecular weight of <500,000 Daltons and a Kjeldahl nitrogen content corrected for ash and volatiles, TKN, of ≥0.5 wt %; and a cleaning surfactant; wherein the modified carbohydrate polymer is a carbohydrate polymer functionalized with quaternary ammonium moieties; wherein the quaternary ammonium moieties on the modified carbohydrate polymer include: trimethyl ammonium moieties having formula (I) and dimethyl(alkyl) ammonium moieties having formula (II) wherein each R is independently selected from a C8-22 alkyl group.
US11939553B2
Disclosed are detergent compositions and methods of cleaning articles and/or membranes using the surfactants herein. Compounds, compositions, and methods for using these compounds and compositions in detergent or cleaning compositions are also provided. These compounds, compositions, and methods are particularly directed to cleaning compositions and methods that have advantageous cleaning properties at a pH of 7 or less. In particular, the compounds, compositions, and methods described herein can also be used as general surfactants in detergent compositions or in methods of cleaning articles or membranes.
US11939552B2
The present invention relates to processes of recovering oil after liquefaction and/or from thin stillage and/or syrup/evaporated centrate from a fermentation product production process by adding a thermostable protease to the whole stillage, thin stillage and/or syrup.
US11939551B1
An electric motor driveline fluid for an electric motor system including a lubricating base oil, at least one sulfurized component, and at least one dispersant derived from a polyisobutylene having an average number molecular weight of at least 2000. The electric motor driveline fluid provides acceptable wear performance as well as good electrical conductivity and oxidative stability for use in electric motor system fluids having a low viscosity when select elemental relationships of phosphorus, sulfur, and calcium and included in the fluid.
US11939548B2
A nanostructure includes a plurality of substantially spherically curved carbon layers having diameters in a range of 1 nanometer to 1000 nanometers and a plurality of halogen atoms attached to an outer convex side of the carbon layers. A composition of matter includes a liquid fuel and an additive including at least one liquid and a plurality of carbon nano-onions. A method of fabricating an additive for liquid fuel includes creating a carbon-based material using a plasma in an environment including at least one hydrocarbon gas and/or at least one liquid containing hydrocarbons, organometallic metal-complex, and/or element-organic compounds, evaporating organic material from the carbon-based material, halogenating the carbon-based material, and extracting carbon nano-onions from the halogenated carbon-based material.
US11939543B2
In an embodiment, a method for decreasing reactor fouling in a steam cracking process is provided. The method includes steam cracking a hydrocarbon feed to obtain a quench oil composition comprising a concentration of donatable hydrogen of 0.5 wt. % or more based on a total weight percent of the quench oil composition; exposing a steam cracker effluent flowing from a pyrolysis furnace to the quench oil composition to form a mixture; and fractionating the mixture in a separation apparatus to obtain a steam cracker tar. In another embodiment, a hydrocarbon mixture is provided. The hydrocarbon mixture includes a mid-cut composition.
US11939538B2
In accordance with one or more embodiments of the present disclosure, a method for producing aromatic compounds from pyrolysis gasoline comprising C5-C6 non-aromatic hydrocarbons includes aromatizing the pyrolysis gasoline in an aromatization unit, thereby converting the C5-C6 non-aromatic hydrocarbons to a first stream comprising benzene-toluene-xylenes (BTX); hydrotreating the first stream comprising BTX in a selective hydrotreatment unit, thereby producing a de-olefinated stream comprising BTX hydrodealkylating and transalkylating the de-olefinated stream comprising BTX in a hydrodealkylation-transalkylation unit, thereby producing a second stream comprising BTX, the second stream comprising BTX having a greater amount of benzene and xylenes than the first stream comprising BTX; and processing the second stream comprising BTX in an aromatics recovery complex, thereby producing the aromatic compounds from the pyrolysis gasoline, the aromatic compounds comprising benzene, toluene, and xylenes.
US11939534B2
A composition having a recycle content value is obtained by reacting a recycle content feedstock to make a recycle content alpha olefin or by deducting from a recycle inventory a recycle content value applied to an alpha olefin composition. At least a portion of the recycle content value in the feedstock or in an allotment obtained by an alpha olefin manufacturer has its origin in recycled waste and/or pyrolysis of recycled waste and/or in thermal steam cracking of recycle content pyoil.
US11939510B2
The invention relates to a polymerisable LC material comprising at least one di- or multireactive mesogenic compound of formula T, RT1-(AT1ZT1)m1-GT1-(ZT2-AT2)m2-RT2 T and at least one compound of formula CO-1, wherein the parameter are RT1, AT1, ZT1, m1, GT1, ZT2, AT2, m2, RT2, L1 to L3, R1 and R2, and n are defined as given in claim 1. Furthermore, the present invention relates also to a method for its preparation, a polymer film with improved thermal durability obtainable from the corresponding polymerisable LC material, to a method of preparation of such polymer film, and to the use of such polymer film and said polymerisable LC material for optical, electro-optical, decorative or security devices.
US11939506B1
A method of reducing salinity of saline soil, comprising providing a sawdust and corn stover-based biochar, contacting the sawdust and corn stover-based biochar with a saline soil, and adsorbing salts in the soil with the sawdust and corn stover-based biochar. The sawdust and corn stover-based biochar can be prepared by hydrothermally carbonizing a mixture including equal proportions of corn stover and sawdust.
US11939505B2
Provided are a silicon nitride film etching composition, a method of etching a silicon nitride film using the same, and a manufacturing method of a semiconductor device. Specifically, a silicon nitride film may be stably etched with a high selection ratio relative to a silicon oxide film, and when the composition is applied to an etching process at a high temperature and a semiconductor manufacturing process, not only no precipitate occurs but also anomalous growth in which the thickness of the silicon oxide film is rather increased does not occur, thereby minimizing defects and reliability reduction.
US11939502B2
The present disclosure relates to quantum dots with a core of III-V material, a first layer of II-VI material and an external shell of II-VI material to be used, for example, in downconverters. The external shell is preferably made of an alloy of Zn and Cd with Se or S. Introducing a small amount of Cd in the external shell provides excellent absorbance performance in blue, violet and UV wavelengths. The amount of Cd needed for this increase in absorbance can be very low. Further, the emitted light can be nearly monochromatic, which is especially interesting in electronic applications.
US11939497B2
Provided is: a layered body wherein a sheet surface has slight adhesiveness, enabling easy temporary securing of a semiconductor chip, or the like, that has been diced, onto a semiconductor substrate, and wherein permanent adhesion to an adhered object is expressed through post-curing; a layered body that includes the same; a semiconductor device that uses the same; and a method for manufacturing the semiconductor device. A silicone-based adhesive sheet is disclosed herein, wherein, prior to heating, the delamination mode of the adhesive surface from a non-adhesive substrate is interfacial delamination, and after heating of the adhesive surface in a range of between 50 and 200° C., the delamination mode of the adhesive surface from another non-adhesive substrate changes to cohesive fracturing, and exhibits permanent adhesion.
US11939492B2
The present invention provides an adhesive resin composition that has excellent adhesiveness and durability, a method for bonding adherends, and an adhesive resin film. More specifically, the present invention relates to an adhesive resin composition containing more than 50 parts by mass and 99.5 parts by mass or less in a solid content of an acid-modified polyolefin resin having a melting point of 50 to 100° C., 0.5 parts by mass or more and less than 50 parts by mass in a solid content of an epoxy resin having a novolac structure, and an organic solvent; a method for bonding adherends including forming an adhesive layer on a first adherend by applying the adhesive resin composition and drying, and then bonding a second adherend to the adhesive layer by laminating the second adherend on the adhesive layer; and an adhesive resin film including a first adhesive layer, a substrate layer, and a second adhesive layer in that order, in which any one or both of the first adhesive layer and the second adhesive layer include(s) the adhesive resin composition.
US11939488B2
Methods for abating airborne pollutants include applying a coating composition ath includes a an aqueous carrier, a binder, a pigment, and a formaldehyde scrubbing urea compound and curing the coating composition. The coated substrate absorbs formaldehyde and other air pollutants from passing air.
US11939487B2
The present invention discloses a spirooxazine photochromic exterior wall coating, comprising the following components by mass percent: 0.6%-1.5% of spirooxazine photochromic compound, 40%-45% of resin, 0.3%-1% of dispersant, 0.2%-0.3% of antifoamer, 1%-3% of additive, 22%-24% of pigment and 30%-32% of solvent. The additive comprises 0.9 wt %-2 wt % of NaCl or KCl solution. The present invention further provides a preparation method for the spirooxazine photochromic exterior wall coating, comprising measuring, grinding, dispersing, mixing, adjusting pH and filtering. Experiments prove that the spirooxazine photochromic exterior wall coating provided by the present invention has good light fatigue resistance effect and can meet the needs of long-term use of building exterior walls.
US11939484B2
A multi-fluid kit for three-dimensional printing can include a fusing agent with water and a radiation absorber, and a detailing agent. The radiation absorber can absorb radiation energy and converts the radiation energy to heat. The detailing agent can include water and from about 0.1 wt % to about 20 wt % organosilanes based on a total weight of the detailing agent, wherein the organosilanes include an organosilane compound with a central silicon having both a water-solubilizing group and multiple hydrolyzable groups attached thereto.
US11939469B2
Described herein is a method of using copolyamides c) produced by polymerization of components A′) 15% to 84% by weight of at least one lactam, and B′) 16% to 85% by weight of a monomer mixture (M) including components B1′) at least one C32-C40-dimer acid and B2′) at least one C4-C12-diamine, where the percentages by weight of the components A′) and B′) are in each case based on the sum of the percentages by weight of the components A′) and B′), the method including using the copolyamides c) to increase an impact strength and/or breaking elongation of molded articles made of molding materials including thermoplastic polyamides, which are different from copolyamides c).
US11939459B2
An object of the present invention is to provide a photosensitive resin composition having good liquid repellency. The photosensitive resin composition of the present invention at least contains a fluororesin having a crosslinking site, a solvent, and a photopolymerization initiator, and the fluororesin contains a repeating unit derived from a hydrocarbon having a fluorine atom.
US11939456B2
A composition for preparing a foam, a foam, and a shoe employing the foam are provided. The composition for preparing a foam includes 3-30 parts by weight of a first polymer and at least one of a second polymer and a third polymer. The first polymer is cyclic olefin polymer (COP), cyclic olefin copolymer (COC), metallocene based cyclic olefin copolymer (mCOC), fully hydrogenated conjugated diene-vinyl aromatic copolymer, or a combination thereof. The total weight of the second polymer and the third polymer is 70-97 parts by weight. The second polymer is polyolefin, olefin copolymer, or a combination thereof. The third polymer is conjugated diene-vinyl aromatic copolymer, partially hydrogenated conjugated diene-vinyl aromatic copolymer, or a combination thereof. The total weight of the first polymer and at least one of the second polymer and the third polymer is 100 parts by weight.
US11939447B2
A thermosetting composition including a thermosetting compound and hexagonal boron nitride D, wherein the thermosetting compound contains a cyanate compound A and/or a maleimide compound B, and a modified polyphenylene ether C having a substituent with a carbon-carbon unsaturated double bond at at least one terminal, and a content of the hexagonal boron nitride D is 0.1 parts by mass or more and 25 parts by mass or less based on 100 parts by mass of the thermosetting compound.
US11939439B2
The present invention is applicable to a field of a substrate for a high-frequency circuit, and relates, for example, to a composite polyimide film, a producing method thereof, and a printed circuit board using the same. More specifically, the composite polyimide film includes a film matrix including polyimide; and a plurality of filler particles dispersed in the film matrix, wherein each of the filler particles includes an inorganic particle, and a fluorine polymer coating formed on the inorganic particle.
US11939437B2
A method for producing a fiber for reinforcing rubber, comprising applying an adhesion treatment liquid containing a thermoplastic elastomer, a blocked polyisocyanate, and a rubber latex to a fiber cord to obtain a fiber for reinforcing rubber, wherein the thermoplastic elastomer is incorporated in the form of a water dispersion into the adhesion treatment liquid, wherein the thermoplastic elastomer particles in the water dispersion have an average particle diameter of 0.01 to 1.0 μm.
US11939435B2
The present disclosure provides poly(tetrafluoroethylene) (PTFE) microparticles with a Dv50 of about 20 μm to about 30 mm and a specific surface area (SSA) of at least about 3.0 m2/g when measured by a multipoint BET method of ISO 9277. Such PTFE microparticles can be obtained via a method including thermomechanically degrading scrap PTFE in the presence of air and/or oxygen and reducing the particle size of the resultant degraded PTFE.
US11939429B1
Infrared-transparent polymers, useful for LWIR and/or MWIR transparency, are disclosed. The disclosed infrared-transparent polymers are low-cost, damage-resistant, and economically scalable to commercially relevant substrate areas (1 ft2 and greater). In some disclosed infrared-transparent polymers, the carbon-free polymer backbone contains a plurality of polymer repeat units of the form wherein R1 is selected from the group consisting of alkyls, hydroxyl, amino, urea, thiol, thioether, amino alkyls, carboxylates, metals, metal-containing groups, and deuterated forms or combinations thereof; wherein R2 is (independently from R1) selected from the group consisting of alkyls, hydroxyl, amino, urea, thiol, thioether, amino alkyls, carboxylates, metals, metal-containing groups, and deuterated forms or combinations thereof; wherein n is selected from 2 to about 10,000; and wherein the carbon-free polymer backbone is linear, cyclic, branched, or a combination thereof.
US11939413B2
An acrylic resin powder soluble in acetone, including a multi-stage polymer (M) that includes a polymer (B) obtained by polymerizing a monomer mixture (b) containing methyl methacrylate and an alkyl (meth)acrylate ester (mb) in the presence of a polymer dispersion that contains a polymer (A) obtained by polymerizing a monomer mixture (a) containing an alkyl (meth)acrylate ester (ma), in which an alkyl group in the alkyl (meth)acrylate ester (ma) has 4 to 8 carbon atoms, an alkyl group in the alkyl (meth)acrylate ester (mb) has 4 to 8 carbon atoms, a glass transition temperature of the polymer (A) is 20° C. or lower, a glass transition temperature of the polymer (B) obtained by polymerizing the monomer mixture (b) is 55° C. or higher, and a mass average molecular weight of the multi-stage polymer (M) is 10,000 or more and 300,000 or less.
US11939411B2
Ethylene-based polymers of this disclosure include an average g′ less than 0.86, where the average g′ is an intrinsic viscosity ratio determined by gel permeation chromatography using a triple detector; and a molecular weight tail quantified by an MWD area metric, ATAIL, and ATAIL is less than or equal to 0.04 as determined by gel permeation chromatography using a triple detector.
US11939385B2
The present application provides activatable antibodies comprising an antibody comprising an antigen-binding domain (ABD), wherein the ABD comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the N-terminus of the VH is fused to a first polypeptide shield moiety (S1), and the N-terminus of the VL is fused to a second polypeptide shield moiety (S2), wherein S1 comprises a first disease-sensing releasable moiety (DS1) and/or S2 comprises a second disease-sensing releasable moiety (DS2), wherein association of S1 with S2 blocks binding of the ABD to its target, and wherein the ABD does not specifically bind to S1, S2, or association thereof. Composition, methods of treatment using the activatable antibodies, and methods of preparation thereof are further provided.
US11939380B2
This disclosure relates to combination therapies targeting two or all of PD-1, TIM-3, and LAG-3 using antibodies specific for these targets in patients who are in need of enhanced immunity. Also included in the disclosure are compositions useful in the therapies. The therapies are useful in treating diseases such as cancers.
US11939378B2
The invention features methods of diagnosis by assessing B7-H1 expression in a tissue from a subject that has, or is suspected of having, cancer, methods of treatment with agents that interfere with B7-H1-receptor interaction, methods of selecting candidate subjects likely to benefit from cancer immunotherapy, and methods of inhibiting expression of B7-H1.
US11939372B2
Compositions and methods relating to epitopes of sclerostin protein, and sclerostin binding agents, such as antibodies capable of binding to sclerostin, are provided.
US11939368B2
The present invention is directed to QTY CCR9 and CXCR2 variant Fc receptor fusion proteins, methods for the preparation thereof and methods of use thereof.
US11939367B2
The present invention is based on the seminal discovery that BTLA agonist fusion proteins modulate an immune response. Specifically, the present invention provides fusion proteins that bind BTLA enhancing BTLA signaling. The present invention further provides methods of treating cancer and immune and inflammatory diseases and disorders with a BTLA agonist fusion protein as described herein.
US11939354B1
Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.
US11939353B2
The present invention relates to fluorinated and alkylated bile acids.
US11939352B2
Biotransformation of an aromatase inhibitor, testolactone (1), yielded four metabolites, 7β-hydroxy-3-oxo-13,17-seco-5β-androsta-1-eno-17,13α-lactone (2), 3α,11β-dihydroxy-13,17-seco-5β-androsta-17,13α-lactone (3), 4β,5β-epoxy-3β-hydroxy-13,17-secoandrosta-1-eno-17,13α-lactone (4), and 4β,5β-epoxy-3α-hydroxy-13,17-secoandrosta-1-eno-17,13α-lactone (5). Aromatase (estrogen synthase) involves in the synthesis of estrogen, and promotes the growth of breast cancerous cells. It is a key target for the discovery of chemotherapeutic agents against ER+(estrogen-positive) breast-cancers. Metabolites 2 (IC50=8.63±0.402 nM), and 3 (IC50=9.23±1.31 nM) were identified as potent inhibitors against human aromatase enzyme, in comparison to 1 (IC50=0.716±0.031 μM), and the standard aromatase inhibiting drug, exemestane (IC50=0.232±0.031 μM). Derivatives 4 (IC50=10.37±0.50 μM) and 5 (IC50=0.82±0.059 μM) also showed a good inhibition against aromatase enzyme. Therefore, metabolites 2-5 have the potential to serve as therapeutic agents against ER+ (estrogen-positive) breast-cancers.
US11939348B2
The invention relates to compounds and compositions for modulation of nicotinamide adenine dinucleotide (NAD+). The invention also relates to methods of making such compounds and compositions. The invention relates to pharmaceutical compositions containing one or more NAD+ modulating compounds as a first ingredient in combination with one or more active pharmaceutical ingredients. Further, the invention relates to methods of using such compounds or compositions to promote the increase of intracellular levels of nicotinamide adenine dinucleotide (NAD+) in cells and tissues for treating diseases and/or improving cell and tissue survival.
US11939344B2
The specification relates to spirocyclic compounds of Formula (I) and pharmaceutically acceptable salts thereof. The specification also relates to processes and intermediates used for their preparation, pharmaceutical compositions containing them and their use in the treatment of cell proliferative disorders.
US11939338B2
The present disclosure relates to a spiropyran composite having improved mechano-sensitivity, a method for manufacturing the same, and a chromic article including the same. Particularly, the spiropyran composite is obtained by bonding spiropyran covalently to a polymer, an inorganic material or a mixture thereof to form spiropyran composite, and impregnating the spiropyran composite with a sensitivity-enhancing agent for a suitable time through a wet infiltration process to form non-polar environment at the inner part of the spiropyran composite, to cause pre-stretch and to increase a change in color or fluorescence in response to force, stress or strain, thereby providing significantly improved mechano-sensitivity. In addition, a wet filtration process is used and no expensive equipment is required to simplify the process. Further, the process can be performed rapidly within several minutes to reduce the processing time.
US11939337B2
Compounds are disclosed that inhibit RhoGTPases that are useful for inhibiting hyperprofilerative and neoplastic diseases. Specifically, the compounds inhibit the GTPases Rac and Cdc42 that are overactive or overexpressed in signaling pathways in cancer and metastasis. Methods for treatment of cancer and hyperproliferative diseases are disclosed.
US11939332B2
Disclosed herein are synthesis methods for coelenterazine. Also disclosed are articles including the coelenterazine and coelenterazine derivatives. Representative absorbent articles include disposable diapers and adult incontinence products.
US11939330B1
Novel pyrido[3,4-b]indole-6-carboxylic acid compounds, a method of synthesizing said compounds, a pharmaceutical composition comprising said compounds and a suitable carrier, and a method of using the compounds. The pyrido[3,4-b]indole-6-carboxylic acid compounds, identified as CK2 inhibitors, are useful as anticancer and/or antitumor agents, and as agents for treating other kinase-associated conditions including inflammation, pain, and certain immunological disorders, and other types of diseases such as diabetes, viral infection, neurodegenerative diseases.
US11939317B2
Disclosed embodiments concern novel interleukin receptor associated kinases (IRAK) inhibitors and compositions comprising such inhibitors. Also disclosed are methods of making and using the compounds and compositions. The disclosed compounds and/or compositions may be used to treat or prevent an IRAK-associated disease or condition.
US11939301B2
Provided herein are compounds of the formula (I): as well as pharmaceutically acceptable salts thereof, wherein the substituents are as those disclosed in the specification. These compounds, and the pharmaceutical compositions containing them, promote mitochondrial biogenesis and are useful for the treatment of, for example, acute kidney injury and chronic kidney disease.
US11939298B1
A 5-(4,5-bis(4-bromophenyl)-2-(4-chlorophenyl)-1H-imidazol-1-yl)pentanoic acid compound, its synthesis, and its use as an antimicrobial agent.
US11939295B1
A 6-(3-hydroxyphenyl)-2-methoxy-4-(3-methylphenyl)nicotinonitrile as an antimicrobial compound, its synthesis, and its use as an antimicrobial agent.
US11939289B2
The selective dimerization of isoolefins, such as isobutene or isopentane, or mixtures thereof, may be conducted in a system including a series of fixed bed reactors and a catalytic distillation reactor. The system may provide for conveyance of the fixed bed reactor effluents, without componential separation, to a downstream reactor. It has been found that a high selectivity to the dimer may be achieved even though intermediate separation of the desired product from unreacted components between reactors is not performed. Further, embodiments provide for use of a divided wall column for recovery of a high purity dimer product, reducing unit piece count and plot size.
US11939287B2
The present disclosure provides methods and processes for the recovery of compounds (e.g., pendant groups) from polymeric materials, as well as methods for recycling and reusing such compounds by synthetically converting a recovered compound to building blocks that can be used in, e.g., curable resins for the fabrication of new devices, such as medical devices (e.g., orthodontic appliances).
US11939285B2
This invention relates to novel derivatives of 4-hydroxybutyric acid and prodrugs thereof, and pharmaceutically acceptable salts of the foregoing. This invention also provides pharmaceutical compositions comprising a compound of this invention and the use of such compositions in methods of treating narcolepsy, fibromyalgia, other disorders or conditions that are beneficially treated by improving nocturnal sleep or by administering sodium oxybate.
US11939277B2
The invention provides a continuous preparation method of 2,3,3,3-tetrafluoropropene, comprising the following steps: carrying out liquid-phase catalytic telomerization reaction on ethylene and carbon tetrachloride serving as initial raw materials in the presence of a composite catalyst to obtain a reaction product; performing two-stage membrane separation and purification on the reaction product, and then sequentially performing a primary high-temperature cracking reaction, a gas-phase chlorination reaction, a secondary high-temperature cracking reaction, a primary gas-phase catalytic fluorination reaction and a secondary gas-phase catalytic fluorination reaction to obtain a reaction product; condensing and rectifying the secondary gas-phase catalytic fluorination reaction product to obtain the 2,3,3,3-tetrafluoropropene product.
US11939273B2
A limestone calcined clay cement construction composition comprises a) a cementitious binder comprising one or more calcium silicate mineral phases and one or more calcium aluminate mineral phases, and having a Blaine surface area of at least 3800 cm2/g; b) a supplementary cementitious material having a Dv90 of less than 200 μm comprising (b-1) a calcined clay material and (b-2) a carbonate rock powder in a weight ratio of (b-1) to (b-2) in the range of 0.5 to 2; c) optionally, an extraneous aluminate source; d) a sulfate source; and e) a polyol. The composition contains a controlled amount of available aluminate, calculated as Al(OH)4−, from the calcium aluminate mineral phases plus the optional extraneous aluminate source; and the molar ratio of total available aluminate to sulfate is 0.4 to 2.0. The construction composition further comprises f) an ettringite formation controller. The limestone calcined clay cement construction composition is a reduced carbon footprint composition and exhibits high early strength, high final strength, sufficient open time and high durability.
US11939268B2
A method of forming low-k material is provided. The method includes providing a plurality of core-shell particles. The core of the core-shell particles has a first ceramic with a low melting point. The shell of the core-shell particles has a second ceramic with a low melting point and a low dielectric constant. The core-shell particles are sintered and molded to form a low-k material. The shell of the core-shell particles is connected to form a network structure of a microcrystal phase.
US11939267B2
A method and apparatus for producing AlN whiskers includes reduced incorporation of metal particles, an AlN whisker body, AlN whiskers, a resin molded body, and a method for producing the resin molded body. The method for producing AlN whiskers includes heating an Al-containing material in a material accommodation unit to thereby generate Al gas; and introducing the Al gas into a reaction chamber through a communication portion while introducing nitrogen gas into the reaction chamber through a gas inlet port, to thereby grow AlN whiskers on the surface of an Al2O3 substrate placed in the reaction chamber.
US11939264B1
The present disclosure provides a preparation method for hydrothermal synthesis of fly ash silicate aggregate including: mixing sodium metasilicate, potassium hydroxide, and inorganic-organic hybrid excitation monomer as raw materials to obtain an inorganic-organic composite activator; preparing a silicate aggregate raw material, mixing measured fly ash, carbide slag, quicklime, and vitrified micro bubble by mass, adding the inorganic-organic composite activator and continue stirring to produce a mixture; forming a ball disc, wetting an expanded perlite that forms a core of the ball by spraying water, adding a prepared mixture, spraying water while adding, standing and curing, performing a maturation and activation treatment in an autoclave, undergoing a silicon calcium reaction for a hydrothermal synthesis to obtain the silicate aggregates. The present disclosure obtains silicate aggregates with high-performance by accelerating an internal activity of fly ash at an early stage and fully activating the activity of fly ash in all process.
US11939252B2
Mobile water filtration enables on-site recycling of wastewater for reuse in mechanical decoking operations of fired-heaters, furnaces, boilers, or systems prone to build up of deposits, residue, or scale and enables on-site disposal of wastewater in a safe and environmentally conscious manner. In batch operations, a coagulant, a flocculant, and a plurality of cascaded filters of increasingly fine pitch may be used to treat wastewater and remove particulate matter, such as, for example, coke, for reuse or safe disposal. In continuous operations, a plurality of cascaded filters of increasingly fine pitch may be used. A control system may be used to automate the operation of a mobile water filtration system for use with a decoking system, such that it does not require human intervention exception for maintenance operations related to filters. The filtered water may be disposed of on-site, eliminating the need for further treatment or transport off site.
US11939251B2
A peritoneal dialysis system includes a cycler including a pump actuator, a heater and a heating pan operable with the heater, and a disposable set operable with the cycler. The heating pan includes a sidewall forming a slot. The disposable set includes a pumping cassette and a heater/mixing container. The pumping cassette includes a pump chamber configured to be actuated by the pump actuator. Additionally, the heater/mixing container is in fluid communication with the pumping cassette and is sized to be received at the heating pan. The heater/mixing container includes a port configured such that when the port is slid into the slot of the heater pan sidewall, the port is prevented from rotating about an axis transverse to a direction of flow through the port.
US11939248B2
A system and method using a subterranean biological reactor can include a pre-reactor storage unit configured to receive a feedstock including a slurry of biologically derived material and at least one pump configured to pump the effluent from the pre-reactor storage unit. The system may include at least one wellbore containing a subterranean biological reactor configured to receive the effluent from the pre-reactor storage unit. At least a portion of the subterranean biological reactor may be configured to perform anaerobic digestion upon the effluent to generate a biogas.
US11939243B1
Water purification occurs under the influence of cold plasma obtained in water, which has a two-phase state, in which water and the smallest bubbles filled with gases dissolved in water are simultaneously present in the turbulence zone. The plasma is ignited inside the gas bubbles when exposed to an electric high-voltage nanosecond pulse. Since the turbulence zone located behind the flow body is saturated-saturated with fine bubbles, the plasma discharge in the bubbles becomes voluminous and diffuse in consistency. The combination of the hydrodynamic effect on water by the flow body and the generation of reactive oxygen species (ROS) in a volumetric plasma discharge in the turbulence zone causes a synergistic effect that increases the efficiency of water treatment.
US11939223B2
A process for the hydrophobization of a porous silica based compound involves the steps of providing a composition (I) containing a porous silica based compound, treating the composition (I) with a composition (II) containing hexamethyldisiloxane or its hydrolyzed form, and removing the treated silica based compound. The porous silica based compound obtained by the process is useful. A porous silica based compound obtained or obtainable by the process can be used for medical and pharmaceutical applications, as adsorbents, for cosmetic applications, as an additive for food, as a catalyst support, for the preparation of sensors, or for thermal insulation.
US11939222B2
A nanodiamond particle dispersion including nanodiamond particles highly dispersed in an organic solvent is provided. A nanodiamond particle dispersion of the present invention includes nanodiamond particles dispersed in an organic solvent, in which the nanodiamond particles have a silane compound (excluding a silane compound having a (meth)acryloyl group) bonded to a surface of the nanodiamond particles, the organic solvent has an SP value from 8.0 to 14.0 (cal/cm3)1/2, and the nanodiamond particles are dispersed with a particle diameter (D50) from 2 to 100 nm. The organic solvent is preferably at least one type of organic solvent selected from ketones, ethers, alcohols, and carbonates.
US11939216B2
A method includes producing a semiconductor wafer. The semiconductor wafer includes a plurality of microelectromechanical system (MEMS) semiconductor chips, wherein the MEMS semiconductor chips have MEMS structures arranged at a first main surface of the semiconductor wafer, a first semiconductor material layer arranged at the first main surface, and a second semiconductor material layer arranged under the first semiconductor material layer, wherein a doping of the first semiconductor material layer is greater than a doping of the second semiconductor material layer. The method further includes removing the first semiconductor material layer in a region between adjacent MEMS semiconductor chips. The method further includes applying a stealth dicing process from the first main surface of the semiconductor wafer and between the adjacent MEMS semiconductor chips.
US11939212B2
A MEMS device is provided. The MEMS device includes a substrate having at least one contact, a first dielectric layer disposed on the substrate, at least one metal layer disposed on the first dielectric layer, a second dielectric layer disposed on the first dielectric layer and the metal layer and having a recess structure, and a structure layer disposed on the second dielectric layer and having an opening. The opening is disposed on and corresponds to the recess structure, and the cross-sectional area at the bottom of the opening is smaller than the cross-sectional area at the top of the recess structure. The MEMS device also includes a sealing layer, and at least a portion of the sealing layer is disposed in the opening and the recess structure. The second dielectric layer, the structure layer, and the sealing layer define a chamber.
US11939209B2
A metering pump for dispensing a fuel additive includes a pump body, an inlet and an outlet at which fuel additive respectively enters and exits the metering pump, a piston contained within a piston bore and being configured to draw fuel additive into the metering pump through the inlet and to dispense fuel additive from the metering pump through the outlet, an inflow valve configured to permit fuel additive to flow in a single direction away from the inlet and to prevent fuel additive from flowing in an opposite direction back into the inlet, and an outflow valve configured to permit fuel additive to flow in the single direction towards the outlet, wherein the metering pump has a configuration in which the inlet, the outlet, the piston, the piston bore, the inflow valve, and the outflow valve are centrally positioned along a central plane of the pump body.
US11939208B2
A liquid is efficiently suctioned and discharged from and to a container formed by a plurality of aligned storing portions for storing the liquid, using a plurality of nozzles. Provided is a liquid suction/discharge device including a container support device for supporting a culture container formed by a plurality of aligned storing portions, and a nozzle support device for supporting a plurality of nozzles in a state in which distal ends of the nozzles are directed downward. The nozzle support device includes a nozzle support member that swingably supports the plurality of nozzles using prescribed parts as support points, and the liquid suction/discharge device further includes a nozzle inclination device for causing each of the nozzles to be inclined with respect to the nozzle support member.
US11939204B2
A juice dispenser, including a first tank including a first inlet, a first outlet, and a first faucet for the first outlet, and a second tank surrounding first tank, and including a second inlet, a second outlet, and a second faucet for the second outlet, thereby the second tank is not heat insulated, and the second tank insulates the first tank and thereby after inserting heated water into the tanks, adjustable opening of the first and second faucets dispenses the water to a receptacle mixed at an adjustable temperature.
US11939198B2
In a transporting system for transporting a container, and a method for operating a production installation having a transporting system, the transporting system has a vehicle and a transport vehicle, on whose frame two wheel drives are disposed, which are set apart from each other and have a wheel in each case, in particular, the two wheels are disposed so as to touch a floor in order to generate traction force for the transport vehicle, in particular, the wheel axles of the two wheels are aligned parallel to each other. A first and a second shoulder part are situated and/or provided on the frame, and the first shoulder part is situated at a distance from the second shoulder part, and a space region is situated between the wheel drives and between the shoulder parts, into which the vehicle together with the container it accommodates is able to be driven and out of which the vehicle together with the container may be driven. The container has a width that is greater than the distance, in particular the smallest distance, between the shoulder parts, the vehicle has a lifting device, and the vehicle is able to be driven into the space region when the lifting device is lowered and also when it is raised. When the lifting device is raised, the container is able to be positioned above the shoulder parts on the vehicle, and when the lifting device is lowered, the container may be positioned so as to sit on the shoulder parts.
US11939196B1
An apparatus for lifting and lowering manhole covers is shown and described. The apparatus for lifting and lowering manhole covers includes a main beam secured to a vehicle connection support. A winch is secured along the main beam. The winch is configured to secure to a manhole cover. A support leg secured to the main beam such that the winch is positioned between the vehicle connection support and the support leg.
US11939181B1
A sheet post-processing apparatus including a binding mechanism, a tray, a shift mechanism, and a control unit is provided. The binding mechanism is configured to apply binding to a sheet. The sheet applied with the binding is stacked on the tray. The shift mechanism is configured to perform a shift operation in which a side surface of the sheet is pushed and the sheet is deviated in a sheet width direction orthogonal to a discharge direction during discharge of the sheet to the tray. The control unit is configured to cause the shift operation to be performed by dividing the number of times for the shift operation into a plurality of times.
US11939178B2
A device for neatly winding up cargo ties includes a moveable clamp arm a first end of which projects out of an opening of the housing such that the clamp arm and the housing together form a pair of jaws that can selectively be placed about a variety of surfaces and tightened. The jaws are loosened and tightened through the rotation of a threaded rod that engages with a second end of the clamp arm at the interior of the housing causing movement of the clamp arm along a clamping axis. In some embodiments, a nut which is prevented from rotating, is disposed at the second end of the clamp arm and comprises threading that engages with the threading on the threaded rod moving the clamp arm along the clamping axis.
US11939177B2
An image forming apparatus includes a sheet accommodating portion, an image forming portion, an accommodating portion opening portion, a lifter plate, a lifter plate lifting and lowering mechanism, a lower-limit detecting portion, a control unit lowering the lifter plate and opening the accommodating portion in accordance with an operation in a set mode of a plurality of modes when the control unit receives an instruction to open the accommodating portion, wherein the modes includes a first mode in which the accommodating portion is opened irrespective of whether or not the lifter plate lowers to the lower-limit position and a second mode in which the accommodating portion is opened after the lifter plate lowers to the lower-limit position; and an operating portion operable by an operator for changing setting of the mode, between the modes, executed when the control unit receives the instruction to open the accommodating portion.
US11939173B2
A transportation head for a microchip transfer device capable of minimizing mechanical and chemical damage to a microchip, a microchip transfer device having same, and a transfer method thereby, and the transportation head includes a head body having a pickup area and a dummy area; a first protruding pin disposed in the pickup area of the head body; and a liquid droplet attached to the first protruding pin.
US11939170B2
Devices, methods, and computer program products for article retrieval are provided. An example article retrieval device includes a frame and a pair of loading arms movably attached to the frame that move between a retracted position and an extended position. The device includes an engagement structure movably attached to at least one of the pair of loading arms that moves between a stored position and a deployed position. The device further includes a sensing device coupled with the pair of loading arms and a computing device operably coupled with the pair of loading arms, the at least one engagement structure, and the sensing device. The computing device causes the pair of loading arms to extend from the retracted position to a position proximate a first article and deploys the at least one engagement structure based upon sensor data generated by the sensing device.
US11939160B2
An article transport vehicle (3) includes: a travel unit (11) that travels to a set position (P1) that has been set so as to correspond to each of a plurality of storage units (1) configured to store an article (W); a support portion (12) configured to support the article (W); a lighting unit (13) that emits light; and a control unit that controls the travel unit (11) and the lighting unit (13). The control unit executes a travel control that controls the travel unit (11) such that the travel unit (11) travels to the set position (P1) that has been set so as to correspond to a target storage unit (1A), and a lighting control that controls the lighting unit (13) so as to emit light to a lighting position (P2) that corresponds to the target storage unit (1A).
US11939158B2
A storage and retrieval system including a vertical array of storage levels, each storage level having, picking aisles, storage locations, disposed within the picking aisles, and at least one transfer deck providing access to the picking aisles, a multilevel vertical conveyor system configured to transport the uncontained case units to and from the vertical array of storage levels, each storage level being configured to receive uncontained case units from the multilevel vertical conveyor system, at least one autonomous transport located on each storage level for transporting the uncontained case units between respective storage locations and the multilevel vertical conveyor system, and a controller configured to create a primary access path through the transfer decks and picking aisles to a predetermined one of the storage locations and at least one secondary access path to the predetermined one of the storage locations when the primary path is impassable.
US11939157B2
A robotic service device is described for use on a robotic picking system grid. The robotic service device is capable of driving to any location on the grid order to perform maintenance operations or cleaning. Additionally, the service device may be used to rescue robotic load handling devices operational in the picking system. The robotic service device may include a releasable docking mechanism to enable it to dock and latch on to malfunctioning load handling devices. The service device may also be provided with cleaning capability and a camera to enable the condition of the grid and other robotic devices to be monitored.
US11939155B2
A refuse container tipping device includes a first mounting plate, a second mounting plate, a hinge plate, and a plurality of fasteners. The first mounting plate defines a plurality of first slots. The plurality of first slots each extend in a first direction along substantially parallel axes. The second mounting plate is releasably coupled to the first mounting plate and defines a plurality of second slots. The plurality of second slots each extend in a second direction along substantially parallel axes. The first direction is perpendicular to the second direction. The hinge plate is coupled to the second mounting plate. The hinge plate supports a hinge and a grapple arm that is rotatably coupled to the hinge. The plurality of fasteners couple the second mounting plate to the first mounting plate by extending through the plurality of first slots and the plurality of second slots.
US11939153B2
A refuse container lid opening device includes a lid hingedly attached to a container body for covering the container body's top opening. The lid is free of grabbable handles or protuberances but an elongated tongue descending from its underside is received in a slot in the top rim of the container body and is accessible outward of the container body. Upward movement of the tongue when the lid is closed raises the lid above the top rim of the container body to form a manually accessible gap in which a hand can be inserted to fully open the lid.
US11939151B1
A dunnage assembly has a plurality of dunnage sections removably attached to each other and includes a forwardmost dunnage section and an aftmost dunnage section. The forwardmost dunnage section has the longest length and the aftmost dunnage section has the shortest length. Each dunnage section has a plurality of tubes and a plurality of tube collars that support the tubes such that the tubes are substantially parallel to each other. Each tube of each dunnage section has an interior region sized to receive a longitudinally extending item and is substantially coaxially aligned with a tube of an adjacent dunnage section. Each tube collar has a plurality of thru-holes therein where each thru-hole is sized to receive a portion of a tube. Each dunnage section includes a tube collar removably attached to a tube collar of an adjacent dunnage section.
US11939149B2
The present disclosure provides an industrial container and a method of opening an industrial container. The industrial container includes a container body, a pivot assembly, a counter-balancing spring assembly, and a locking assembly. The container body can have a plurality of walls, the plurality of walls including a pivotable ramp wall. The pivot assembly can connect the ramp wall with the container body for pivotal movement of the ramp wall, and the pivot assembly can include a pivot shaft supported by a pair of arms. The counter-balancing spring assembly can include one or more springs arranged about the pivot shaft for biasing the ramp wall from a downwardly inclined loading position upwardly toward a vertical closed position with a torque force. The locking assembly can be configured to lock the ramp wall in the vertical closed position.
US11939146B2
Embodiments of the present disclosure are directed to multilayer silo bags that may include a tube comprising at least two layers, a first open end, a second open end, and a first region and a second region disposed between the first and second end. One or more of the at least three layers may comprise an ethylene/alpha-olefin interpolymer having a density of 0.90 g/cc to 0.965 g/cc and an I2 of 0.1 to 6.0 g/10 minutes, a low density ethylene-based polymer having a density of 0.917 g/cc to 0.935 g/cc and an I2 of 0.1 to 2.0 g/10 minutes, or combinations thereof. The first region may have a thickness of at least 10% greater than a thickness of the second region. The first region may have a surface area that is at least 50% of an overall surface area of the multilayer silo bag.
