US10207823B2

A deployable assembly comprises a supporting structure, a set of panels, each being linked to the adjacent panel by a hinge defining an intermediate axis of rotation, capable of switching from a stowed configuration in which the panels are folded one on top of the other to a deployed configuration, by rotation of the panels about the respective intermediate axes of rotation, wherein the panels are arranged substantially in the same plane, an articulation device defining a main axis of rotation of the set of panels relative to the supporting structure. The set of panels is rotationally mobile about the intermediate axes of rotation and the main axis of rotation to switch from the stowed configuration to the deployed configuration and the set of panels is only rotationally mobile about the main axis of rotation in deployed configuration to orient the set of panels relative to the supporting structure.
US10207817B2

The present invention relates to a static discharger, an aircraft, and an installation process for the static discharger. According to an aspect of the present invention, a static discharger is provided which includes: a basement; and a discharger body installed to the basement. An installation orientation adjusting mechanism is provided between the basement and the discharger body, and the installation orientation adjusting mechanism allows the discharger body to be rotationally orientated, with respect to the basement, to a predetermined installation orientation during an on-site-installation of the static discharger. The static discharger further includes a first fixing mechanism adapted to fix the discharger body, which has been oriented to the predetermined installation orientation, to the basement. According to the present invention, for example, installation adaptation and universality of the static discharger and adjustment and determination of installation orientation of the static discharger can be improved.
US10207816B1

A distributed sensor module system comprises a plurality of sensor modules configured to be aerially deployable from a deployment device, the deployment device including an unmanned aerial vehicle (UAV) or an aeronautically deployable unitized container, the plurality of sensor modules configured to communicate with each other. A first sensor module comprises a first sensor configured to obtain first sensor information from a first environment proximate to the first sensor, a processor coupled to the first sensor, the processor configured to process the first sensor information to obtain locally processed first sensor information, and a communication transceiver coupled to the processor, the communication transceiver configured to communicate the locally processed first sensor information to a second sensor module, the first sensor module and the second sensor module configured to be aerially deployable.
US10207815B2

An aircraft interface device is configured to communicate with an aircraft avionics system that includes a plurality of sensors for an aircraft includes a tablet interface module configured to communicate with the aircraft interface device and with one or more tablets. The tablet interface module includes a user interface that is configured to establish, via a wireless transceiver, a communications channel between the tablet interface module and the one or more tablets and an indicator configured to indicate if the tablet interface module is connected to the one or more tablets. The tablet interface module provides the one or more tablets with information received from the aircraft interface device and wherein the tablet interface module comprises a power supply configured to connect to a power system of the aircraft and to provide power to the one or more tablet devices.
US10207813B1

An onboard aircraft inerting system includes an apparatus and method for regenerating an activated carbon media of a filter module while the aircraft is in flight. In regeneration mode, the activated carbon media is heated to a temperature sufficient to desorb the VOC contaminants adsorbed thereon and the air stream passing through the filter module is at a pressure lower than the air pressure of the air stream passing through the filter in normal inerting mode.
US10207798B2

A method for reducing aircraft turnaround time by improving airport ramp safety is provided. The method minimizes the time interval between an aircraft's landing and takeoff by independently moving the aircraft on the ground without the aircraft's engines by eliminating hazards from jet blast, the possibility of engine ingestion, and the time previously required to wait in the gate area upon arrival or at departure until jet blast or engine ingestion did not pose a danger. Turnaround time is further reduced by providing an onboard driver controllable to drive at least one of the aircraft's wheels between landing and takeoff, thereby eliminating the need for a tow vehicle and the time required to move the aircraft with a tow vehicle.
US10207797B2

A wheel assembly is disclosed, in which a ring gear is movably mounted to the rim of the wheel, so that torque can be transmitted between wheel and rim, while the ring gear is isolated from deformations induced in the wheel rim.
US10207794B1

This disclosure describes a system and method for determining the center of gravity of a payload engaged by an automated aerial vehicle and adjusting components of the automated aerial vehicle and/or the engagement location with the payload so that the center of gravity of the payload is within a defined position with respect to the center of gravity of the automated aerial vehicle. Adjusting the center of gravity to be within a defined position improves the efficiency, maneuverability and safety of the automated aerial vehicle. In some implementations, the stability of the payload may also be determined to ensure that the center of gravity does not change or shift during transport due to movement of an item of the payload.
US10207786B2

An elongated structure comprising a web extending along a length of the elongated structure and a flange comprising a first flange portion, the first flange portion extending away from an area of the web. The first flange portion comprises a variable width along at least a portion of the length of the elongated structure. The first flange portion of the elongated structure may comprise the variable width the length of the elongate structure. The first flange portion may comprise a constant width along at least a portion of the length of the elongated structure. The elongated structure may further comprise a second flange portion. The second flange portion may comprise a variable width along at least a portion of the length of the elongate structure. The first flange portion may comprise a first top flange portion.
US10207785B2

An outdrive for a marine vessel, such as a watercraft having an inboard engine, is provided. The outdrive can include a standoff box joined with a drive unit having a driveshaft that rotates in response to rotation of an input shaft coupled to an engine within a hull of the watercraft. The drive unit includes a propeller shaft that rotates in response to rotation of the driveshaft, and an associated propeller. The drive unit is vertically movable from a raised mode to a lowered mode, in which the propeller shaft is a preselected distance from a bottom of the boat hull, thereby lowering a thrust point produced by the propeller, all while the watercraft is moving through water and while the propeller is producing thrust. A related method and standoff box are also provided.
US10207782B2

A wind paddle sail assembly includes a sail having stiffened upper and lower ends and a paddle or pole having an upper fixed end and a lower portion with a lower free end. A fastener fastens the upper fixed end of the paddle or pole to the upper end of the sail. A downhaul strap fastens the lower end of the sail to the lower portion of the paddle or pole for adjusting tension in the sail. A method for operating a wind paddle sail assembly is also provided.
US10207775B2

A horizontal type cylindrical double-shell tank includes an inner shell and an outer shell. The inner shell includes an inner shell main part storing a liquefied gas and an inner shell dome protruding from the inner shell main part. The outer shell forms a vacuum space between the inner shell and the outer shell, and includes an outer shell main part surrounding the inner shell main part and an outer shell dome surrounding the inner shell dome. The inner shell dome is provided with an inner shell manhole. The outer shell dome is provided with an outer shell manhole at a position corresponding to a position of the inner shell manhole.
US10207768B2

A bicycle operating device is provided with a support structure, a release member, a first operating member and a release pawl. The release member is pivotally supported on the support structure to pivot about a pivot axis between a first non-releasing position and a first releasing position. The first operating member is movably supported on the support structure between a rest position and an operated position. The release pawl is movably mounted on the first operating member. The release member includes a first abutment and a second abutment. The second abutment is circumferentially spaced from the first abutment with respect to the pivot axis. The release pawl is selectively arranged to engage one of the first and second abutments, and pivot the release member during movement of the first operating member from the rest position towards the operated position without engaging the other of the first and second abutments.
US10207767B2

Responsive to a hydraulic piston advancing out of a piston housing in a second brake arm and contacting a piston cam surface of a first brake arm, the second brake arm pivots around a second pivot. As this is happening, a cam surface in the second brake arm lifts a contact surface of a first force transfer member of the first brake arm, imparting torque to the first brake arm which then pivots around a first pivot. The cam surface is shaped to impart synchronous motion to the first and second pad holders. Splitting one of the brake arms with a centering member permits a centering adjust feature.
US10207758B2

A kickstand assembly includes a post and a seat. A bicycle includes a frame and the kickstand assembly coupled to the frame. The post is disposed along a longitudinal axis and includes a first distal end and a second distal end. The seat is disposed at the first distal end of the post. The seat is movable between a use position and a non-use position. The kickstand assembly includes a kickstand disposed at the second distal end of the post, and extends outwardly away from the post transverse to the longitudinal axis. The kickstand is movable between a use position and a non-use position. The seat and the kickstand are fixed relative to each other at the respective first and second distal ends of the post such that movement of the seat to the non-use position directly causes movement of the kickstand to the use position.
US10207753B2

A trailer for carrying unit load devices (ULDs), including unloaded and/or loaded containers and pallets, or other cargo; the trailer designed to be towed on surface streets and highways by conventional motorized truck-tractor units. The trailers are equipped with adjustable decks for supporting ULDs in stacked configuration on the trailer. Using a lowered well portion permits selected ULD stacks to not exceed legal trailer height limits so that additional permitting is not required.
US10207751B2

A motor gearbox assembly is provided for a vehicle having two wheels on opposite sides of the vehicle. The assembly includes two independent drive systems that each include an electric motor and an associated gear train, each drive system being configured to independently drive one of the wheels. The assembly further includes a common housing that receives the motors and the gear trains such that the gear trains are at least partially positioned between the motors. Furthermore, at least portions of the drive systems have generally inverse orientations in a longitudinal direction of the vehicle when the motor gearbox assembly is mounted on the vehicle.
US10207747B2

A reinforcement member is provided and includes a reinforcement unit that has a pair of reinforcement unit bodies. Each of the reinforcement unit bodies has a protruding surface protruding from a middle part of the reinforcement unit body relative to a longitudinal direction of the reinforcement unit body. The protruding surfaces of the reinforcement unit bodies are in contact with each other while opposing each other, and opposite end parts of the reinforcement unit have rectangular cross sections when cutting the reinforcement unit perpendicularly to a longitudinal direction of the reinforcement unit. A plurality of reinforcement units are arranged and the cross sections of the opposite end parts of the reinforcement units form columns and rows of the reinforcement member.
US10207741B2

A vehicular radar assembly includes a radar mount positioned proximate an engine compartment within a vehicle. A radar carriage is slidably coupled to the radar mount and having a radar module coupled thereto. A biasing mechanism biases the radar carriage away from the radar mount toward a use position. Imposition of an impact force against the radar module temporarily overcomes the biasing mechanism and biases the radar carriage toward the radar mount.
US10207739B2

A vehicle (100) for use in the field of visual effects is provided, which has at least one adjustable dimension. The vehicle comprises a frame (101) and a plurality of wheels (110, 120, 130, 140), the wheels being adjustably attached to the frame such that the distance between a pair of wheels can be adjusted either manually or automatically. This adjustment may be a continuous adjustment. The vehicle may also comprise tracking markers which generate data in order to facilitate the production of a digital model. The vehicle may also comprise a camera (155) having a 360 degree field of view. The data captured by the camera can be used in the digital effects process to create realistic reflections of the surrounding environment on the digital model.
US10207726B2

A rail worker protection system having a first device configured to generate and send an identification code, a second device configured to transmit a request to the first device and to transmit a signal to one or more remote devices, and the remote device able to issue alarms to rail workers upon reception of the signal from the second device.
US10207724B2

A method is provided for operating a vehicle having a drive unit, a driving-data determination unit, a consumer set, and a power management unit for managing the consumer set. The driving-data determination unit identifies or determines driving curve data and the drive unit is controlled on the basis of the driving curve data. The method achieves an optimization with regard to a defined quality criterion while also taking the consumer set into account, in that the power management unit receives consumer data from the consumer set, the power management unit determines anticipatory load profile data at least on the basis of the consumer data, determination or identification data are transmitted to the driving-data determination unit in accordance with the load profile data, and the driving-data determination unit determines or identifies the driving curve data in accordance with the determination data.
US10207720B2

A device (1) to drive at least an output shaft (3) of a rail vehicle with a drive engine (4). The at least one output shaft (3) can be brought into an operational connection with a wheel (2), and a transmission assembly (6) is positioned on the drive side of the at least one output shaft (3). At least two gear ratios can be presented in the area of the transmission assembly (6). In addition, a method is described for operating such a device (1).
US10207696B2

A transmission shift is timed for a hybrid electric powertrain as a function of a torque capacity of an electric machine relative to a shifting torque required to change gearings of a transmission. A vehicle is being propelled by the machine, with an engine stopped, when the shift is requested. If the machine has insufficient torque capacity to change transmission gearings, then the shift request is delayed until the engine has started.
US10207694B2

A parking brake system for electrically controlling a parking brake of a vehicle is provided. The parking brake system includes a parking brake provided for each wheel, an air dryer controller, and an actuator. The air dryer controller is provided to an air dryer to electrically control the parking brake. The air dryer dries compressed air for use in the parking brake. The actuator is provided for each axle of the wheel to actuate the parking brake with the compressed air in accordance with an electric signal from the air dryer controller.
US10207688B2

A brake control system for a motor vehicle having a plurality of wheels, brakes for applying a braking effort to one or more of the wheels, and a movement sensor for detecting movement of the vehicle. The system comprises a brake actuator for actuating the brakes to supply a braking effort and a brake controller for controlling the brake actuator. The brake controller is configured to determine an acceleration of the vehicle based on movement detected by the movement sensor and to ensure that the brake actuator supplies a braking effort if the determined acceleration exceeds a set acceleration limit.
US10207679B2

A fastening device (100, 200) configured to fasten a windscreen wiper device on a fastening element (50) of a vehicle, in particular of a motor vehicle. The fastening device (100) comprises: a first receiving region (110), into which the fastening element (50) can be introduced; and a securing element (120) mounted rotatably about a first axis of rotation (122), wherein the first axis of rotation (122) extends substantially perpendicular to a longitudinal extent (51) of the fastening element (50), and wherein the securing element (120) is configured to form an engagement with the fastening element (50) through a first rotation (124) about the first axis of rotation (122).
US10207674B2

A method for setting a safety belt in a vehicle is provided. For the adjustment of the safety belt an adjusting apparatus is provided, the position of a deflection point for the safety belt being able to be set thereby and the safety belt extending therefrom in the direction of the shoulder of a vehicle occupant fastened-in by the safety belt, and the position of the deflection point is automatically set by means of at least one sensor device in order to adapt the path of the safety belt to the fastened-in vehicle occupant. Via the sensor device an angle is evaluated which is present between a belt portion which extends from the deflection point in the direction of the shoulder of the fastened-in vehicle occupant and a further belt portion and/or a part fixed to the bodywork or seat part.
US10207671B2

An inflator (10) is actuatable to provide inflation fluid for inflating an inflatable vehicle occupant protection device. The inflator (10) includes a volume of stored gas and a propellant (52) that is ignitable to undergo a reaction that produces reaction products. The reaction products include heat and gas that mix with the stored gas to produce a mixture of inflation fluid. The inflator (10) is configured to discharge the inflation fluid to inflate the protection device. The propellant (52) comprises an open cell foam fuel propellant (140). The reaction includes a combustion reaction in which the foam fuel propellant (140) reacts with a gas oxidizer comprising oxygen to produce heat and gas reaction products that mix with the stored gas.
US10207668B2

A side airbag device includes a folded-up airbag and a limitation member disposed around the airbag for constraining the airbag from protruding forward at airbag deployment. The limitation member is formed of a flexible sheet member into a band shape, and is joined to the folded-up airbag by the opposite end regions. The limitation member includes a loose region which is arranged around the folded-up airbag in such a manner as to be remote from the folded-up airbag. The loose region is disposed on a side of the folded-up airbag towards which the airbag protrudes. The loose region includes a tearable region in the region in a deployment direction of the airbag.
US10207666B2

A bumper for a vehicle includes a bumper crossbeam and two crash boxes extending away from a back of the bumper crossbeam. A one-piece blank made of fiber-reinforced sheet material extends from a wall section of the bumper crossbeam connecting the crash boxes, right into the crash boxes.
US10207660B2

An exterior member having a tubular shape so as to accommodate and protect one conduction path or a plurality of conduction paths includes a resin portion. The resin portion includes a flexible tube portion having flexibility and a straight tube portion so as to linearly route the conduction path. The flexible tube portion and the straight tube portion are continuously formed. The flexible tube portion includes a spiral projection portion in which a first projection having a projecting shape as seen from a tube outer surface side spirally extends in a circumferential direction of the tube outer surface. The straight tube portion includes a straight projection portion in which a second projection continuously extends from an end portion of the spiral projection portion extends in a tube axis direction as the straight tube portion.
US10207655B2

A laminated composite part, which includes a first member having a predetermined mating surface, and a second member that is made of an elastically deformable resin material, that has a plate portion substantially parallel to the mating surface and having a multiplicity of protrusions formed integrally therewith so as to protrude toward the mating surface so that space is created between the plate portion and the mating surface, and that is placed on the first member such that the protrusions contact the mating surface, which has cushioning properties as tip ends of the protrusions are pressed against the mating surface and elastically deformed, and in which one of the first and second members which is located on a design surface side has an engaging projection that projects to a larger extent than the protrusions, and the engaging projection is inserted through an insertion hole formed in the other of the first and second members and is retained in the insertion hole, whereby the first and second members are connected together, the insertion hole being provided with a stopper portion that is engaged with the engaging projection to retain the engaging projection in the insertion hole, in order to allow the engaging projection to move relative to the stopper portion in a direction parallel to the design surface due to a difference in thermal expansion between the first and second members, the stopper portion having a predetermined length in a direction of the relative movement that occurs due to the difference in thermal expansion, the stopper portion being a bridge extending across the insertion hole and having a slit in a middle so as to be separated into a plurality of parts, and the engaging projection having an annular shape and being inserted through the insertion hole such that the engaging projection elastically deforms the bridge and expands the slit, and the bridge thus extending through an opening of the annular shape, so that the engaging projection is retained in the insertion hole by the bridge and is allowed to move relatively in a longitudinal direction of the bridge.
US10207654B2

A retention system on a mounting structure for a generally cylindrical component extending in a transversal axis. The retention system includes a generally U-shaped spring clip comprising a base and a pair of resilient retainer arms extending from the base along a longitudinal axis and defining an inlet passage; and a member holding said U-shaped spring clip; the retainer arms are adapted to engage with an upper side of the component in front of the inlet passage. The member includes one or multiple rigid retention walls extending inside the spring clip and which are adapted to engage with a lower side of the component at distance of the base, in working position.
US10207653B1

A stowable tiered electronic device holder supports electronic devices in a variety of shapes and sizes, in at least a portrait and landscape orientation. The stowable tiered electronic device holder comprises an electronic device holder having plurality of brackets positioned along a tapering path that hold the electronic devices. A compartment receives the electronic device holder and the electronic device holder is extendable and retractable relative to the compartment.
US10207648B2

A vehicle having a cargo area includes a first cargo panel having a first recess extending into the first cargo panel, and a second cargo panel having a second recess extending into the second cargo panel. The vehicle includes a cargo floor for supporting the first and second cargo panels in an interlocked configuration in contact with the cargo floor. In the interlocked configuration, the first and second cargo panels are disposed in upright orientations and the second cargo panel is disposed orthogonally to the first cargo panel such that the first recess interfaces the second recess. The vehicle further includes a trim panel for supporting the first and second cargo panels in a coplanar configuration such that first and second cargo panels are spaced from the cargo floor.
US10207646B2

A vehicle front camera module integrated with a rearview mirror includes a windshield bracket module fixed to a central upper end of a windshield of a vehicle, a camera module fixed to the windshield bracket module and at which a pair of lenses for taking forward images of the vehicle are disposed to be laterally spaced apart from each other, and a rearview mirror coupled to the windshield bracket module through a supporter which is coupled to the windshield bracket module in front of the pair of lenses and extending downward so as not to interfere with respective angles of view of the pair of lenses. This arrangement enables the camera module to have a compact design with improved visibility for a safe driving experience.
US10207642B2

An electrical power monitoring system includes a base at an external surface of a wall of a junction box and including a stem configured to project through an opening in the wall, the base further including a monitoring circuit, a plurality of conductors extending through the stem and coupling the monitoring circuit to a plurality of conductive terminals in the junction box, and a fastener configured to mate with the stem of the base at an internal surface of the wall to fix the base to the wall, wherein the monitoring circuit is configured to monitor presence of electrical power at the plurality of conductive terminals, the monitoring circuit including a plurality of light sources at the external surface of the base.
US10207636B1

A seatbelt stowage assembly comprises a housing including an outer rim and a cover and further defining a compartment. The housing is disposed within a headliner of a vehicle and is configured to house a seatbelt in a stowed position. The seatbelt stowage assembly also includes a light source disposed within the compartment.
US10207635B1

Systems and methods for detecting distracted drivers and reducing risks posed by the distracted drivers are disclosed. According to certain aspects, an electronic device may capture and analyze image data that depicts an operator of a vehicle in various levels of distraction. The electronic device may determine, based on the analysis, whether the operator is distracted, and determine an additional vehicle that may be located in front of the vehicle. The electronic device may generate and transmit a command to an additional electronic device that, upon execution, causes brake lights of the additional vehicle to modify in intensity.
US10207630B2

The invention relates to a method for controlling a light scanner (7) in a headlight for vehicles, wherein the laser beam of at least one modulated laser light source (1) is directed in a scanning manner, by way of the light scanner, onto a light conversion means (8) so as to generate a light image (11) thereon, which is projected via an imaging system (12) as a light image (11′) onto the roadway, a micromirror (10) of the light scanner is pivoted according to defined characteristic control curves in at least one coordinate direction, the desired light image (11) is divided into a pixel set having n rows and/or m columns, the horizontal and/or vertical characteristic control curves for the micromirror (10) are adapted to at least one selected row and/or column in terms of the required optical power of the pixels, and the adapted horizontal and/or vertical characteristic control curves are used to control the micromirror.
US10207629B2

A method is provided for mounting a front-end module and at least one front headlamp on a body of a passenger car, including the steps of: holding the front headlamp in at least one pre-mounting position on the front-end module via a holding device, by which the front headlamp is held on the front-end module so as to be movable relative to the latter; arranging the front-end module on the body together with the front headlamp held thereon via the holding device so as to be movable relative to the front-end module, wherein the front-end module and therewith also the front headlamp are moved relative to the body; and fixing the front headlamp in a final mounted position.
US10207623B1

An entertainment support system is attached to a pickup truck having a plurality of receptacles in sidewalls of a truck box spaced above a truck bed. The entertainment support system includes a first mount having a first horizontal arm extending between opposing sidewalls of the truck box, and a vertical arm extending orthogonal to the first horizontal arm. The entertainment support system further includes a second mount including a second horizontal arm extending between the opposing sidewalls parallel to and spaced from the first horizontal arm.
US10207617B1

A reduced-impact-and-recoil headrest that includes a ratchet mechanism, allowing components to incrementally translate with respect to each other. The reduced-impact-and-recoil headrest includes an exterior housing surface that is deformable, providing cushioning for a vehicle occupant's head. The headrest also includes an interior compartment within the housing, with the ratchet mechanism disposed within the interior compartment. The headrest is configured to decrease the force of a collision experienced by the occupant, thereby decreasing the likelihood and severity of traumatic brain injuries resulting from the occupant's head striking a stationary headrest. Instead, the reduced-impact-and-recoil headrest is configured to incrementally move with the occupant's head, providing an incremental cushion for the occupant's head. The ratchet mechanism also prevents the reduced-impact-and-recoil headrest from automatically translating back to its pre-impact position, thereby decreasing the occupant's risk of ligament tear and whiplash.
US10207616B2

A seat assembly for a rear vehicle cabin is provided including a seat base configured to receive and support a car seat in a rear-facing configuration; a backrest; and a movable headrest component. The movable headrest component includes first and second opposing major surfaces. At least a portion of the second major surface is configured to provide a reflective surface, for example, using a mirror. A movable cover may be provided, configured to selectively conceal the reflective surface. The movable headrest component has a first orientation with the first major surface facing a forward direction with respect to the vehicle, and a second orientation with the second major surface facing a forward direction with respect to the vehicle. In the second orientation, the reflective surface provides a forward facing driver with a view of the car seat, when viewed from a center mounted rear-view mirror coupled to a vehicle windshield.
US10207615B2

A headrest includes a stay having left and right legs; a headrest main body attached to the stay and able to rotate in a front-rear direction; a pair of elongated holes made in a bottom surface of the headrest main body and a pair of closing members arranged on the bottom surface of the headrest main body, covering the elongated holes, wherein each closing member includes a main plate and a sub-plate, the main plate has an insertion hole guiding one leg of the stay and moves in the front-rear direction as the main plate is rotated, and the sub-plate is provided, overlapping the main plate, and is able to move as the main plate moves; the main plate and the sub-plate may move as the headrest main body is rotated, while covering the elongated hole made in the bottom surface of the headrest main body.
US10207612B2

A locking structure for an armrest is provided to be pivotable to a folded up or a pulled down position. The locking structure includes a locking pin disposed at a fixed position and a catch pivotably coupled to a fixing bracket in an armrest housing, and has an engaging portion formed at a side thereof so that the locking pin enters the engaging portion, and a projection and a recess are formed to be spaced apart from the engaging portion. A latch is coupled to the fixing bracket and has a protruding portion formed at one side of the latch. A knob rotates the latch and when the armrest housing rotates upward, the catch rotates while the locking pin enters the engaging portion to lock rotation of the armrest housing. When the latch is, the locking pin is withdrawn from the catch, to permit the rotation of the armrest housing.
US10207609B2

A seat assembly for a vehicle includes a seat back having a cushion surface forming a bolster along a lateral edge thereof, a recess formed in the bolster, and a retractable seatbelt. When in a stowed condition, the seatbelt extends along the bolster between a top and a bottom thereof, and a portion of the seatbelt passes over the recess to create a space between an edge of the seatbelt and the cushion surface. The recess is sized and located to enable a seat occupant to insert fingers into the space and easily grasp the seatbelt for deploying it. The recess may be a depression in the cushion surface, or may be formed by a first portion of the bolster having a first radius smaller than a second radius of a second, un-recessed portion of the bolster adjoining the first portion.
US10207598B2

Implementations of vehicle seating systems may include a movable chair including a metal frame having a seat portion and a back portion. The seat portion may have a first end and a second end and the back portion may have a first bar, a second bar, and a lock bar coupled between the first bar and the second bar. A latch pin may be configured to receive a first end of the lock bar coupled to the first bar of the seat portion when the movable chair is in a fully upright portion. The back portion may be configured to fold down and the seat portion may be configured to rotate upwardly on the seat hinge. The movable chair may be configured to lock into place in a fully upright position when the vehicle is in operation through a latching mechanism, the latch pin, and the lock bar.
US10207596B2

A vehicle includes a traction battery and a controller coupled to the traction battery and having a memory, the controller being programmed to control the traction battery based on a difference between a total resistance indicated by voltage and current at a first operating condition and a battery cell resistance associated with the first operating condition previously stored in the memory, the difference being indicative of a wiring resistance associated with electrical connectors such as wires, cables, bus bars, and the like of the battery. The battery or the vehicle may be controlled in response to the adaptively determined wiring resistance by adjusting subsequent voltage or current determinations used to determine state of charge and battery capacity and/or to control charging or discharging of the battery and selection of various vehicle operating modes.
US10207590B2

A system and method for establishing a dynamic wireless communication network with a plurality of autonomous aerial vehicles, such as drones. The drones can dynamically change the size and availability of the communication network, and work with an existing communication network, such as cellular telecommunications or internet protocol networks. The drones can therefore create and maintain a robust network in response to a variety of needs, such as emergency response areas or large sporting events. Further, the drones can establish communication hotspots for mobile devices, and can alternately be configured to create a data pipeline.
US10207580B2

A drive assembly includes a drive housing, a bearing-mounted wheel mount configured to rotate about a rotation axis with respect to the drive housing, and a shift assembly coupled between an input shaft and the wheel mount to selectably cause rotation of the wheel mount various rotational speeds. The shift assembly includes a gear set and a brake arrangement. The gear set has a first gear and a second gear, each being rotatable by the input shaft independent of the other. The brake arrangement has a first brake component and a second brake component. During rotation of the wheel mount at a first rotational speed, the first brake component brakes the first gear with respect to the drive housing. During rotation of the wheel mount at a second rotational speed, the second brake component brakes the second gear with respect to the drive housing.
US10207579B2

A fuel-mixing prevention filler neck device is provided. The fuel-mixing prevention filler neck device includes a fuel dispensing gun insertion unit that receives a fuel dispensing thereinto and a coupling unit that provides fluid communication with a bottom of the fuel dispensing gun insertion unit. The coupling unit is disposed on an exterior circumferential surface thereof with coupling protrusions for fastening with a plurality of slots formed in a filler pipe. Further, a first side of a lower portion of the coupling unit is open to form a coupling region. A misfueling prevention unit slidably moves to the coupling region to be coupled to the coupling unit. Additionally, the misfueling prevention unit is closed when a gasoline fuel dispensing gun is inserted and being opened when a diesel fuel dispensing gun is inserted.
US10207570B2

A vehicle rear portion structure that comprises: a first glass that is provided at a vehicle rear portion, and at which is formed a sunken portion that is sunken-in further toward a substantially vehicle lower side than portions adjacent thereto in a vehicle transverse direction; a connecting portion that is provided between the first glass and a second glass, and that leads drainage water, which flows from the sunken portion, to the second glass; and an additional member having a guide portion that extends toward a vehicle rear side from an upper portion of the second glass, and that guides the drainage water from the connecting portion to a position that is away, toward a vehicle rear side, from a vehicle rear side surface of the second glass.
US10207568B2

Provided is a heater for a motor vehicle including: a heat source part: a heat source part rod including a rod sidewall and a rod cover in order to receive the heat source part; a first heat radiating plate including a first heat generation region in which one side of the heat source part is disposed and a first air movement region in which at least one or more first through-holes are formed; and a second heat radiating plate including a second heat generation region in which the other side of the heat source part is disposed and a second air movement region in which at least one or more second through-holes are formed. Particularly, the heat source part is disposed between the first and second heat radiating plates, and the rod sidewall is provided integrally with the first heat radiating plate.
US10207567B2

A vehicle is disclosed that has multiple coolant paths selected by control of a three-way valve in which the position of the valve is detectable. A method for detecting the valve position during fault conditions is disclosed. The vehicle has a heating system that includes a first coolant loop with a heating source, a water pump, and a heater core. The heating system also has a second coolant loop that includes an engine and a second water pump, in addition to the elements of the first coolant loop. Temperature sensors are located in each coolant loop. A three-way valve fault is detected by monitoring the behavior of the temperature sensors in response to the position of the three-way valve and the status of the heating sources.
US10207564B2

An exterior heat exchanger is provided with paths P1-P4. The flow rate of the air being blown by an exterior blower to pass through the path P4 closer to a refrigerant outlet of the exterior heat exchanger is set to be higher than that of the air being blown by the exterior blower to pass through the path P1 closer to a refrigerant inlet of the exterior heat exchanger. An air-conditioning controller activates cooling fans during a defrosting mode of operation.
US10207561B2

Embodiments disclose systems and methods for a vehicle with an articulating suspension exploration platform with shock dampening. More specifically, embodiments include a passive articulating of forces by mirroring and chaining bar linkages.
US10207558B2

A vehicle-height adjustment system includes: a vehicle-height adjustment actuator provided so as to correspond to a wheel; and a pressure-medium supply and discharge device configured to supply and discharge a pressure medium to and from the vehicle-height adjustment actuator. The pressure-medium supply and discharge device includes a tank configured to store the pressure medium. The vehicle-height adjustment system includes a tank-pressure controller configured to control a tank pressure based on at least one of a vehicle height for the wheel and an inside temperature. The tank pressure is a pressure of the pressure medium stored in the tank, and the inside temperature is a temperature in the vehicle-height adjustment system.
US10207557B2

A robotic work tool system may include a robotic work tool. The robotic work tool may include two front wheels and a chassis. The robotic work tool is characterized in that the two front wheels are arranged on a beam axle that is pivotably arranged to the chassis.
US10207552B2

The present disclosure relates to shipping and storage containers. Specifically, the present disclosure relates to shipping and storage containers, which are traditionally stationary, converted to easily-portable containers. More specifically, the portable containers include a deployable/retractable landing/moving apparatus, a removable tow bar assembly, and leveling support systems. The portable containers can have many uses including as temporary to permanent housing, office space, and school rooms, or to house equipment for use in mobile telecommunication networks and systems, including cellular towers that can be set-up in both permanent and temporary locations.
US10207549B2

The bead wire (52) comprises several windings of wire and a basic hexagonal bead wire (56) comprising: two axially and radially external lateral rows (F1, F2) of N2 windings, two axially external and radially internal lateral rows (F3, F4) of N2 windings, where N1=N2+1 or N1=N2, two junctions (J1, J2), each formed by a winding that an axially and radially external lateral row (F1, F2) and an axially external and radially internal lateral row (F3, F4), have in common, each winding in common having no winding of wire axially on the outside of it. The bead wire (52) comprises two axially and radially external additional lateral rows (A1, A2) of N3 windings substantially parallel respectively to each axially and radially external lateral row (F1, F2).
US10207543B2

Pneumatic tire 1 for an agricultural machine, having an axis of revolution XX and comprising a tread 7, a sole 11 situated opposite the tread 7, and two sidewalls 13, 15 connecting the tread 7 to the sole 11. The tread 7, the sole 11 and the two sidewalls 13, 15 together form a casing 17 defining a chamber 19 inside the pneumatic tire 1. At least one of the sidewalls 13, 15 comprises, in this order and in succession in a direction oriented radially from the axis of revolution XX to the outside, a proximal portion 131, an intermediate portion 133 and a distal portion 135. In the unloaded state, the intermediate portion 133 projects into the chamber 19 in a direction substantially parallel to the axis of revolution XX.
US10207539B2

A vehicle spindle and a method of attaching the spindle to a portion of an axle half shaft housing. The spindle has an inner surface, an outer surface, one or more bearing journals on the outer surface of the spindle and a radially protruding portion circumferentially extending from at least a portion of the outer surface of an axially inboard end portion of the spindle. Prior to attaching the spindle to the axle half shaft housing, the one or more bearing journals are ground, a clocking angle for the radially protruding portion of the spindle is determined and the spindle is aligned to the determined clocking angle. Once the spindle is aligned to the determined clocking angle, the axially inboard end portion of the spindle is attached to an axially outboard end portion of the axle half shaft housing using one or more welds.
US10207534B2

A writing implement holder comprises an elongated hollow housing. An electric motor is fixed at one end of the housing and having an output shaft thereof aligned with a longitudinal axis of the housing. A source of electric power is coupled to the motor. A gripping member is mounted within a hollow interior of the housing and has one end thereof securely attached to the output shaft of the motor. The gripping member is configured to receive a portion of the writing implement for a rotation with the output shaft of the motor, when the writing implement is inserted through an open end of the housing. Manually operable ON/OFF switch can be also provided. The housing can be provided by a pair of complimentary members.
US10207533B2

A security element (1) for security papers, documents of value or the like, having a substrate (3) the upper face (6) of which is height-modulated, and has a multilayer structure (7) which acts as a color filter. The structure is formed on the height-modulated upper face (6) and is likewise height-modulated as a result, and includes a first layer (8), a second layer (9) of dielectric material formed thereon and a third layer (10) formed on the second layer (9), wherein the first and third layer (8,10) are each formed from a dielectric material having a higher refractive index than that of the second layer (9), or in each case from a metal or semi-metal material.
US10207524B2

An image recording apparatus includes a first motor, a feeding roller, a second motor, a first driven mechanism, a recorder, and a controller. The feeding roller is configured to rotate by receiving driving force from the first motor. The first driven mechanism is configured to be driven by receiving driving force from the second motor. The controller is configured to: perform a preparing operation in response to receiving first information that instructs starting image recording by the recorder; perform a driving operation of driving the second motor to drive the first driven mechanism, in response to completing the preparing operation and not receiving second information including a recording condition and printing data; and in response to receiving the second information, stop the second motor and drive the first motor to perform a feeding operation by the feeding roller.
US10207523B2

A receipt printer according to an embodiment includes a sheet roller that transports a sheet from a sheet roll to a receipt issuing port. A printing device prints receipt data on the sheet. A cutter configured performs full cutting so that the sheet is separated from the sheet roll and partial cutting so that the sheet remains partially connected to the sheet roll. A processor controls the cutter to perform the partial cutting after the printing device prints the receipt data on the sheet, and also controls the cutter to perform the full cutting when a predetermined condition is satisfied after the partial cutting is performed.
US10207522B2

A printing apparatus includes a base unit that can move in a moving direction and a medium support unit that supports a medium on which printing will be performed and moves in the moving direction along with the base unit by being attached to the base unit. When a position of the medium support unit with respect to the base unit during printing is defined as a base position, the medium support unit is slidable with respect to the base unit from the base position in the moving direction. By employing such a configuration, it is possible to suppress deterioration of work efficiency when setting a medium.
US10207521B2

An image reading device includes a tray unit, a recording unit disposed above the tray unit, an outer guide defining a curved path extending from the tray unit to the recording unit, a sheet feeder configured to feed a sheet from the tray unit to the curved path, and a return guide disposed between the recording unit and the tray unit. The return guide pivots about a shaft and guides the sheet having an image recorded thereon back to the curved path. The tray unit includes at least one supporting portion. The return guide includes at least one supported portion. The at least one supporting portion of the tray unit engages the at least one supported portion of the return guide such that the return guide takes a guiding position in which the return guide defines a return path extending to the curved path.
US10207520B2

The invention was made in order to provide a multi-color printing method of a plastic film wherein multi-color print can be made fast without requiring complex operations, while functions of the anchor-coating layer and the shielding are ensured sufficiently, and provides a method of multi-color printing on a plastic film, which comprises an anchor-coating process wherein an anchoring agent is applied to the plastic film by a gravure roll to form an anchor-coating layer which acts as receptive layer to multi-color inks, a multi-color printing process wherein multi-color print is provided on said anchor-coating layer by continuous ink jet printers, a shielding layer-coating process wherein a titanium white ink is applied to said multi-color print by a gravure roll to form a shielding layer, and drying processes being provided after said anchor-coating process, multi-color printing process and shielding layer-coating process, respectively, and an apparatus therefor.
US10207512B2

An image-recording apparatus includes a cartridge including a first storage chamber, a tank including a second storage chamber, a recording portion, a detected portion, a detector, and a wall portion. Liquid supplied from the first storage chamber to the second storage chamber through an inlet port is supplied from the second storage chamber to the recording portion through an outlet port. The wall portion partitions an internal space of the second storage chamber into a first region including the liquid inlet port and a second region including the detected portion. The wall portion extends upward than the liquid inlet port and the detected portion and downward than the liquid inlet port and the detected portion. Communication between the first region and the second region is allowed through upper and lower communication portions. The upper communication portion is positioned upward than the liquid inlet port and the detected portion.
US10207508B2

In some examples, a print cartridge includes a monolithic molding, and a printhead die embedded into a molding. The printhead die has a front surface exposed outside the molding to dispense fluid drops through nozzles and an opposing back surface covered by the molding except at a channel in the molding through which fluid is to pass directly to the back surface. The printhead die also has a nozzle health sensor molded into the molding to detect defective nozzles in the printhead die.
US10207506B2

There is provided an inkjet printing apparatus that can execute a recovery process appropriate for a print head according to a use condition of the inkjet printing apparatus. Therefore a recovery operation is performed based upon both an elapsed time in a non-use state where the printing is not performed and an elapsed time from the previous recovery process.
US10207501B2

An ink let recording method using an apparatus including plural aqueous inks, a recording head having a heat-generating portion to eject the inks, and ink storage portions therefor which are housings bonded to the recording head, the method including ejecting the inks from the recording head to record an image on a recording medium. The recording head has plural ejection orifice arrays corresponding to the inks and including a first and a second ejection orifice array at both sides and a third ejection orifice array at the other positions. A protective layer containing tantalum or tantalum oxide is formed on the heat-generating portion to contact with the inks. Dynamic surface tension and lightness of the ink corresponding to the third ejection orifice array are respectively smaller than maximum dynamic surface tension and larger than minimum lightness of the inks corresponding to the first and second ejection orifice arrays.
US10207496B2

A liquid jetting apparatus includes: a head unit including a first driving element, a second driving element, a first contact portion connected to the first driving element, and a second contact portion connected to the second driving element; and a wiring member including a flexible substrate, a first driving IC provided on the flexible substrate, a second driving IC provided on the flexible substrate, a first wire formed in the flexible substrate and connecting the first driving IC and the first contact portion, and a second wire formed in the flexible substrate and connecting the second driving IC and the second contact portion. A conductive part different from the first wire and the second wire is disposed in an area of the flexible substrate between the first driving IC and the second driving IC.
US10207481B2

In a transfer film including a temporary support having a thickness of 38 μm or less; and a curable transparent resin layer disposed on the temporary support in a direct-contact manner, in which a thickness of the curable transparent resin layer is 5 μm or more, the curable transparent resin layer includes a binder polymer, a polymerizable compound, and a polymerization initiator, and a melt viscosity ηc of the curable transparent resin layer measured at 100° C. is 1.0×103 Pa·s or more, the temporary support and the curable transparent resin layer are in direct contact with each other, and it is possible to prevent the incorporation of air bubbles during lamination on base materials having an elevation difference; a method for manufacturing a laminate; a laminate; an electrostatic capacitance-type input device; and an image display device.
US10207476B2

Disclosed therein is a reinforced leather. The reinforced leather includes: a leather sheet layer made of a leather-like material; a bonded layer positioned on an upper face of the leather sheet layer; a textile layer positioned on an upper face of the bonded layer and made of cotton fabrics; and a coated layer positioned on an upper face of the textile layer. The reinforced leather can remedy the shortcoming that leather-like materials produced from waste resources get torn easily, be used as leather for shoes due to its high tensile strength and shear strength, and provide a beautiful appearance.
US10207467B2

In a pultrusion method for manufacturing a fiber-reinforced composite product comprising reinforcing fibers embedded in a thermoplastic matrix material, the following is performed along a path of pultrusion: providing a preform; further downstream, inductively heating the preform to a processing temperature of the thermoplastic matrix material; and, further downstream, introducing the preform into a die and consolidating the preform by means of the die while the preform passes through the die.
US10207462B1

A material transport assembly for a printer assembly can include a toothed component; a drive for rotation of the toothed component; a material guide; and a biasing component that biases the material guide in a direction toward the toothed component.
US10207458B2

A setting welding device is set forth for setting stud-like auxiliary joining parts in a plurality of layers of material and subjecting them to a mechanical-thermoforming process on a second layer of material and connecting them to said second layer by way of a welding operation. For this purpose, the punch is used to apply to the welding auxiliary joining part mechanical and thermal loads that follow prescribed characteristic force and current curves. Furthermore, a corresponding connecting method that can be realized with the aid of the setting welding device is also disclosed.
US10207437B2

Closed cell foam articles, such as sports balls, and related manufacturing methods are disclosed herein. The article includes a main body made of closed-cell elastomeric resin foam having a density ranging between about 0.050 sg and about 0.800 sg after curing. Some articles are assembled by inserting a cured core into a main body so that the core is secured in the main body via an interference fit, and the core has one or more portions extending to the exterior surface of the main body such that the an exposed surface of the one or more exposed portions of the core blend substantially with the exterior surface of the main body.
US10207433B2

The invention relates to a rotary tablet press comprising: a rotatingly drivable rotor, having a die plate comprising die holes and assigned to the die holes upper and lower punches, rotating synchronously with the die plate, whose axial movement is controlled by upper and lower control cams, having at least one filling station comprising at least one filling device for filling the die holes with material to be pressed, having at least one compression station disposed downstream of the filling station in the rotational direction of the rotor, comprising at least one pressing device which presses the upper and/or lower punches into the die holes when passing through the compression station in order to press the filled material in the die holes, and having at least one ejector station, disposed downstream of the compression station in the rotational direction of the rotor, comprising an ejector device for ejecting the pressed tablets in the die holes, characterized in that at least one vibration generator is provided in the circumferential direction of the upper and lower punches between the filling station and the ejector station that at least temporarily vibrates the upper and/or lower punches at least at the compression station and/or at the filling station and/or at least at an upper control cam and/or at least at a lower control cam.
US10207431B2

A component-removal tool assembly is configured to remove a component from a mandrel assembly, and may include a main frame, and a plurality of rotational input devices extending from the main frame. Each rotational input device may be operatively coupled to a respective plunger that is configured to be actuated against a portion of the mandrel assembly. A synchronizing link synchronously couples the rotational input devices together. The synchronizing link operates to synchronize movement of the plurality of rotational input devices. Movement of one or more of the rotational input devices causes the plungers coupled thereto to exert a uniform and consistent disconnecting force against the mandrel assembly.
US10207430B2

An ultraviolet curing device is proposed, which includes a light source assembly, and a first reflection plate and a second reflection plate connected to the light source assembly and disposed at two sides of the light source assembly, respectively. Both of the first reflection plate and the second reflection plate are scalable along lengthwise directions to make the distance between the light source assembly and the to-be-cured display panel adjustable and make all the ultraviolet rays from the light source assembly be able to be used to cure the to-be-cured display panel.
US10207424B2

The invention relates to mixing elements that have a larger number of basic geometric periods per section and an improved dispersing effect for multi-shaft screw extruders comprising screw shafts that co-rotate in pairs. The invention further relates to the use of the mixing elements in multi-shaft screw extruders, a corresponding screw extruder comprising the mixing elements, and a method for extruding kneadable materials.
US10207423B2

A dispersive mixing element for co-rotating twin screw extruder is disclosed. The element for co-rotating twin screw extruder comprises of a continuous flight helically formed thereon having a lead ‘L’, wherein either the flight transforms at least once from an integer lobe flight into a non-integer lobe flight in a fraction of the lead ‘L’ and transforms back to an integer lobe flight in a fraction of the lead ‘L’ or the flight transforms at least once from a non-integer lobe flight into an integer lobe flight in a fraction of the lead ‘L’ and transforms back to a non-integer lobe flight in a fraction of the lead ‘L’.
US10207417B2

A cutting assembly for cutting an extruded edible material includes an extrusion assembly having a food extrusion port that extrudes an edible material in an extrusion direction. A cutter frame having a cutting edge is positioned proximate the food extrusion port. The cutting edge moves through a cutting region proximate the extrusion port in a cutting motion. First and second servo motors are operably coupled to the cutter frame, wherein the first servo motor operates the cutting edge to define a first component of the cutting motion perpendicular to the extrusion direction. The second servo motor operates the cutting edge to define a second component of the cutting motion generally parallel with the extrusion direction. The first and second servo motors combine the first and second components to define a cutting path and a return path of the cutting edge through the cutting region.
US10207415B2

Provided are multifunctional folding knives for quick access to the blade and conveniently tool-securing accessory thereto. The knife comprises a blade and a handle pivotally connected to the blade. A cutout is disposed on a spine of the blade. Two or more holes are disposed in opposite relation around the cutout. A tool-securing accessory is removably secured on a spine of the blade. The tool-securing accessory comprises a base plate. A magnet is disposed in the base plate. A flange is disposed along a distal edge of an upper surface of the base plate and forming a concave opening. A semi-collar comprising a pair of arms is pivotally secured on the flange configured to switch between a locked position and an unlocked position. Two or more posts are perpendicularly disposed on the base plate to removably engage the two or more holes on the spine of the blade.
US10207408B1

A method for minimizing the rate of collision of a mobile robotic device. A mobile robotic device selects controls comprised of sets of actions to navigate through a workspace. Controls resulting in non-collisions cause the system to earn a positive reward. Controls resulting in collisions cause the system to earn a negative reward. Cumulative rewards over the course of a work session are compared to the cumulative rewards of other work sessions. A policy is defined based on outcomes of prior work sessions to minimize the expected number of collisions.
US10207406B2

An operation instruction list including starting points and ending points of trajectories of a plurality of robot arms is generated (a trajectory definition data generation process). Order of generation of trajectories is determined in accordance with the operation instruction list (a generation order determination process). A trajectory of a specific robot arm included in the operation instruction list is generated in accordance with a starting point and an ending point such that the trajectory avoids obstacle spaces registered in the obstacle memory when trajectories of other robot arms are generated (a trajectory generation process). A sweeping space in which a structure of the arm sweeps when the robot arm is operated along the generated trajectory is added to the obstacle memory as an obstacle space to be avoided by the other robot arm (an obstacle registration process).
US10207404B2

Generating a robot control policy that regulates both motion control and interaction with an environment and/or includes a learned potential function and/or dissipative field. Some implementations relate to resampling temporally distributed data points to generate spatially distributed data points, and generating the control policy using the spatially distributed data points. Some implementations additionally or alternatively relate to automatically determining a potential gradient for data points, and generating the control policy using the automatically determined potential gradient. Some implementations additionally or alternatively relate to determining and assigning a prior weight to each of the data points of multiple groups, and generating the control policy using the weights. Some implementations additionally or alternatively relate to defining and using non-uniform smoothness parameters at each data point, defining and using d parameters for stiffness and/or damping at each data point, and/or obviating the need to utilize virtual data points in generating the control policy.
US10207401B1

A magnet tool bit wallet includes a fabric body formed from first and second overlying panels, and having a magnetic support portion, a bit retainer portion, and a closeable pocket portion. The magnetic support portion encloses a pair of elongate magnet assemblies between the panels, each magnet assembly including a row of disc magnets disposed between a pair of ferromagnetic strips. The rows of disc magnets have opposite polarity to adjacent magnets, and opposite polarity to corresponding magnets in the other magnet assembly. The bit retainer portion includes at least one block configured to retain tool bits. In a folded configuration the magnet assemblies overlie each other, and a flap on the magnetic portion overlies the pocket portion to retain the wallet in the folded configuration.
US10207400B2

An adjustable tool handle for holding a tool during use provides an improved handling of tools during use of tools that are difficult to use on their own, specifically L-shaped hexagonal wrenches. The adjustable tool handle includes a tool handle body with a handle and an adjustable opening for receiving a tool. In order to place a tool within the tool handle, a user opens the tool handle. When the tool handle is open, one leg of the tool handle is inserted into one of a plurality of openings on the back of the body and the other leg is placed within the adjustable opening. After the tool is placed within the tool handle, the tool is held in place by a securing mechanism. With the tool coupled to the tool handle, a user is able to tighten and loosen work pieces of different sizes and different types.
US10207398B2

A tool assembly includes a first tool and a second tool. The first tool includes a first tool body, a ratchet mechanism defining a first hole, and a receiving space. The ratchet mechanism includes a ratchet having a plurality of teeth and a pair of pawls, and a first end of each of the pawls is received between two adjacent teeth. The second tool includes a first inner hexagonal wrench and a first outer hexagonal opener. The first outer hexagonal opener may be received in the first hole. When the first tool rotates relative to the ratchet mechanism along a first direction, the pawls rotates with the first tool and drives the ratchet together with the second tool rotates along the first direction; when the first tool rotates along a second direction opposite to the first direction, the ratchet together with the second tool is in a static state.
US10207396B2

A multi-functional TPMS sensor fastener torque tool includes a torque driver and a user interface which allows a user to identify the TPMS sensor to be serviced, obtain a recommended fastener torque from a reference torque value database, measure the torque applied to the sensor fastener and alert the user when the reference torque has been reached or exceeded. In one example, the reference TPMS fastener torque values are stored in a memory device in the torque tool which are accessible through a plurality of graphic user interface menus on a display device.
US10207395B2

A vehicle body manufacturing apparatus includes: side jig frames disposed respectively on the right and left sides of a vehicle body; an upper jig frame installed between the side jig frames, the upper jig frames including a pair of front and rear frame members insertable into the inside of the vehicle body through front and rear openings of the vehicle body, respectively; a connection mechanism that removably connects insertion ends of the pair of frame members; and a clamping mechanism that is held on the upper jig frame and that positions the vehicle body.
US10207393B2

A locking pliers includes a fixed handle. A fixed jaw is connected to the fixed handle. A movable jaw cooperates with the fixed jaw and includes movable and fixed pivoting regions. A movable handle is pivotally connected to the movable pivoting region. A movable pivot unit includes a pivot pin engaging with the fixed handle and the fixed pivoting region, and a pivot hole is disposed in one of the fixed handle and the fixed pivoting region and configured and dimensioned to loosely receive the pivot pin. The pivot hole has a first diametrical size and the pivot pin has a second diametrical size not greater than 0.8 times the first diametrical size. A biasing member engages with the fixed handle and the movable jaw.
US10207391B2

Apparatus for treating parts to remove imperfections in the parts includes: a chamber; a rotatable basket within the chamber; a source of liquified cold fluid; a source of dry ice particles; a programmed controller to control rotation of the basket, activation of the liquified cold fluid, cycle times and activation of the dry ice particles. The controller is programmed to activate rotation of the rotatable basket, activate the source of liquified cold fluid and activate the dry ice particles to treat parts in the rotatable basket.
US10207388B2

The present invention provides a chemical mechanical (CMP) polishing pad for polishing, for example, a semiconductor substrate, having one or more endpoint detection windows (windows) which at a thickness of 2 mm would have a UV cut-off at a wavelength of 325 nm or lower which are the product of a reaction mixture of (A) from 30 to 56 wt. % of one or more cycloaliphatic diisocyanates or polyisocyanates with (B) from 43 to 69.9999 a polyol mixture of (i) a polymeric diol having an average molecular weight of from 500 to 1,500, such as a polycarbonate diol for hard windows and a polyether polyol for soft windows and (ii) a triol having an average molecular weight of from 120 to 320 in a weight ratio of (B)(i) polymeric diol to (B)(ii) triol ranging from 1.6:1 to 5.2:1, and a catalyst, preferably a secondary or tertiary amine, all weight percent's based on the total solids weight of the reaction mixture.
US10207386B2

A method of controlling polishing includes polishing a substrate at a first polishing station, monitoring the substrate with a first eddy current monitoring system to generate a first signal, determining an ending value of the first signal for an end of polishing of the substrate at the first polishing station, determining a first temperature at the first polishing station, polishing the substrate at a second polishing station, monitoring the substrate with a second eddy current monitoring system to generate a second signal, determining a starting value of the second signal for a start of polishing of the substrate at the second polishing station, determining a gain for the second polishing station based on the ending value, the starting value and the first temperature, and calculating a third signal based on the second signal and the gain.
US10207385B2

An accessory for use with an oscillating power tool includes an attachment plate and a raised annular rim extending from the attachment plate. The raised annular rim has a central recess and a keyed sidewall with a star shape configured to be engaged by a first mating geometry of an oscillating power tool. The raised annular rim may further include a receiving portion formed thereon configured to be engaged by a second mating geometry of an oscillating power tool.
US10207383B2

A finishing device has a pressing arm and a pressing tool for pressing a finishing tool against a workpiece, and method for setting up the device, the device being provided with a first connecting device for connecting a base support to the pressing arm, a second connecting device for connecting the base support to the pressing tool and a setting device for setting the orientation and/or position of the base support on the pressing arm.
US10207381B2

A machine tool for machining workpieces, wherein the machine tool has a first spindle assembly and at least one second spindle assembly each having at least two working spindles which are arranged in a common spindle housing and on which in each case a machining tool for workpiece machining is arrangeable, wherein the machine tool has a workpiece holding device for holding workpieces for the purpose of workpiece machining by way of the machining tools, wherein the machine tool has a guide arrangement for the relative positioning of the workpiece holding device holding the workpieces and the first and the at least one second spindle assembly for workpiece machining.
US10207368B2

A laser cutting apparatus that cuts a workpiece by radiating a laser beam thereon. The laser cutting apparatus is provided with a laser entrance portion to which an optical fiber that transmits the laser beam is fixed and an optical system through which the laser beam radiated from the optical fiber fixed by the laser entrance portion passes. The laser entrance portion includes a moving portion that moves or tilts the optical fiber with respect to the optical system and a fixing portion that fixes the moved or tilted optical fiber with respect to the optical system.
US10207364B2

A method for determining a laser welding condition of the present disclosure includes a first step, a second step, and a third step. In the first step, workpiece information indicating characteristics of a workpiece is input. In the second step, laser information indicating characteristics of laser light is input. In the third step, a first welding condition is calculated based on the workpiece information and the laser information, and then displayed. The first welding condition is any one of a recommended laser power of the laser light, a recommended welding speed, a recommended welding pattern, an estimated strength of a welded portion, and an estimated weld depth of the welded portion. Furthermore, the workpiece information includes a joint shape of the workpiece. Thus, an optimum weld condition can be set while considering a shape of a joint in welding.
US10207361B2

The disclosure relates to methods and systems for piercing, drilling, or cutting metal workpieces in a laser processing operation. The methods include focusing a pulsed laser beam onto a processing location on a workpiece; detecting process radiation emitted from the processing location; determining an intensity of the process radiation at a plurality of temporally sequential times during pulse pauses; determining an intensity gradient of the process radiation; comparing the intensity gradient with a gradient threshold value; and detecting a spontaneous material removal on the workpiece when the number of times the gradient threshold value has been exceeded is above a predetermined limit value. When a spontaneous material removal is detected, the system changes one or both of a laser parameter and a processing parameter of the laser processing operation. The disclosure also relates to processing machines for carrying out the methods.
US10207360B2

Implementations of the present disclosure include methods, systems, and computer-readable storage mediums for determining a deviation between an actual position and a desired position of a laser machining head of a laser machining machine. Implementations include actions of selecting at least two different machining positions of the laser machining head, in which a laser beam emitted by the laser machining head is directed onto a desired position of a workpiece, moving the laser machining head into a first selected machining position and forming a through-opening into the workpiece at or around the desired position by operation of the laser beam, moving the laser machining head into a second selected machining position and detecting radiation generated by an interaction between the laser beam and the workpiece, and determining whether there is a deviation between an actual position of the laser machining head and the desired position based on the detected radiation.
US10207357B2

A friction stir welding device includes a pair of workpiece surface plates between which a gap extending along a welding line between workpieces is formed; a welding device body including a rotatable friction stir welding tool protruding upward from the gap; and a linear guide mechanism and a moving device for the welding device body. The moving device has a configuration in which a pair of pin racks extending in a direction along the gap are disposed at symmetrical positions on both sides in a width direction with a position immediately below a tool movement path of the friction stir welding tool as a symmetrical axis, and pin gears that individually mesh therewith are provided in the welding device body so as to be rotatably driven. Respective sets of a pin rack and a pin gear are alternately brought into a strong meshing state during the movement of the welding device body by causing the locations of pins and teeth thereof to deviate from each other by a half pitch.
US10207355B2

The present disclosure provides a welding electrode and methods of manufacturing the same. The welding electrode can include a composite body having a tip portion and an end portion. The composite body can include a shell defining a cavity through the end portion, the shell comprising a first metal that includes one or more of the following: a precipitation hardened copper alloy, copper alloy, and carbon steel. The composite body can also include a core within the shell, the core extending through the shell from the tip portion to the cavity, the core comprising a second metal that includes dispersion strengthened copper. The core and the shell have a metallurgical bond formed from co-extrusion.
US10207351B2

A method and apparatus for providing welding type power is disclosed. A welding type power supply includes an input circuit, a controller and an output circuit. The input circuit receives an input power signal and provides an intermediate power signal. The output circuit receives the intermediate power signal and provides a welding type power output. The output circuit has an inverter with at least two inverter switches, and a clamp circuit that limits the voltage across the inverter. The clamp circuit captures and buffers the excess energy, and returns the excess energy to an input of the inverter over a plurality of switching cycles. The controller has control outputs connected to the input circuit and the output circuit, to control them.
US10207350B2

The invention described herein generally pertains to a system and method for a welding device and, in particular, a hybrid welding device, that leverages a renewable energy source for a source of electrical current. The welding device can include one or more renewable energy kits that harvest renewable energy sources for performing a welding operation or a powering at least one of a device or component external to the welding device. The welding device includes renewable energy component that collects an input to convert to an electrical current that can be used as a replacement current, a supplemental current, or a complimentary current.
US10207347B2

In one embodiment, a reciprocating tool includes a reciprocating plunger, the plunger including an inner wall defining a chamber portion within the plunger, a motor operably connected to the plunger, and a bushing located at least partially within the chamber and contacting the inner wall.
US10207343B2

A tool assembly configured for location on a section of a pipe is operable to both isolate a section of the pipe and perform an intervention into the pipe while maintaining pressure integrity. The tool assembly includes a clamp, a cutting tool and an isolation tool. In use, the clamp sealingly secures the tool assembly to the pipe, the cutting tool performs an intervention operation on the pipe, and the isolation tool isolates the section of pipe in order that repair or replacement of equipment can be effected.
US10207337B2

A front-loaded, side-activated modular drill includes a shank and a replaceable cutting insert installed on and engaging the tool shank. The shank has a pocket for supporting the cutting insert when the cutting insert is installed within the pocket. The pocket includes a first centering wall having an aperture with internal threads formed with a first pitch and a second centering wall having an aperture with a first portion with internal threads formed with a second, different pitch. A first member is threaded into the aperture of the first centering wall, and a second member is threaded into the second centering wall. The first member is threaded into the second member. The cutting insert has an opening in a trailing end for allowing the first member to pass therethrough. Rotation of the first member causes the centering walls to elastically deform and move relative to each other.
US10207330B2

Tool-holding device (11) for a machining tool, comprising: a tool-holder body (13); a receiving part (15) defined in the tool-holder body (13); a retaining element (17) provided with a pair of mutually cooperating jaws (17a,17b); a female seat (19) between the jaws for an engaging male portion (21) of a machining tip (23), the jaws (17a,17b) being capable of taking a locking configuration, in which the engaging portion (21) of the tool (23) is firmly locked within the seat (19) of the retaining element (17), and a disengaged configuration in which the engaging portion (21) of the tip (23) can be detached from the retaining element (17); a moveable component (25) which bear the main load of holding the retaining element (17) in the receiving part (15) when the retaining element (17) is in the configuration in which it engages the tool (23).
US10207324B2

This invention provides a method for manufacturing parts with a built-in channel. Two kinds of materials with different melting points are used, the material with the lower melting point is a molding element with an arbitrary shape, the material with the higher melting point is powdered, and the material with the low melting point is wrapped and positioned in the powder with the high melting point. When the preparation is completed, the low-temperature material is melted down, and the channel with the random shape is formed after sintering. In the application that the metal parts need supply water, air, or oil, instead of the channel acquired by mechanical splicing or the channel molded by 3D printing technology, this method in the invention is with a wide application range, the lower cost, and the simple and controllable technology, and is suitable for mass production and with very broad market prospects.
US10207323B2

A composite magnetic material includes a plurality of soft-magnetic metal powders, a first oxide that covers a surface of each of the plurality of soft-magnetic metal powders, and a second oxide that covers a surface of the first oxide and is interposed among the plurality of soft-magnetic metal powders each coated with the first oxide. The first oxide has a first recess in a surface, and the second oxide is provided in the first recess. With this configuration, peeling between the first oxide and the second oxide can be prevented, so that the composite magnetic material having high mechanical strength can be provided.
US10207317B2

Apparatus, systems, and methods that ultrasonically agitate a semisolid metal slurry to prevent dendrite formation that can lead to clogging of a nozzle during direct metal writing.
US10207315B2

Certain exemplary embodiments can provide a composition, system, machine, device, manufacture, circuit, and/or user interface adapted for, and/or a method and/or machine-readable medium comprising machine-implementable instructions for, activities that can comprise, after removing a cast device from a stack-lamination-derived mold, said cast device formed from a molding composition, applying a desired shape to said cast device to form a shaped cast device, said molding composition comprising: a ceramic composition comprising silica; an cycloaliphatic epoxy binder composition, said cycloaliphatic epoxy binder composition present in said molding composition in an amount up to 30% by weight of said molding composition; a silicone composition comprising a siloxane resin, said silicone composition present in said molding composition in an amount up to 30% by weight of said molding composition; and a solvent composition adapted to dissolve said cycloaliphatic epoxy binder composition and said silicone composition.
US10207300B2

A system for clearing precipitation from a window comprises one or more transducers (1-8) fixed to the window. The transducers are driven by a generator (13) to produce surface acoustic waves that propagate through the window. The window may be a laminated window such as a windscreen (10) for a vehicle. A sensing system (122) may be used for detecting the presence of precipitation to actuate the clearing system.
US10207295B2

A sorting device and a method for sorting bulk material. In order to be able to load a sorting facility of the sorting device with just one feeding facility with bulk material such that the sorting facility can be operated with a high throughput, provision is made for the sorting facility and the feeding facility to be arranged so as to run in parallel with one another in a transfer area. In the transfer area, bulk material is transferred from the feeding facility to the sorting facility.
US10207288B2

A tool for applying a corrosion-protection substance to a rail for securing seats in an aircraft. The tool includes a component of elongate overall shape, with a base configured to slide along the rail, and a rollers support connected to the base. The tool also has an axle incorporated in the rollers support, which extends transversally with respect to the longitudinal direction of the component on each side of the rollers support, and rollers for applying the substance mounted on the transverse axle, one on each side of the component. The tool allows the substance to be applied effectively to the flange parts of the rail that is to be protected.
US10207284B2

Disclosed is a coating machine. The coating machine includes: a movable component, a plurality of nozzles and a pump, the plurality of nozzles are sequentially arranged along the length direction of the movable component, the pump is configured for pumping coating agents into the nozzles, the movable component can drive the nozzles to move, and coating agents are coated on substrates by the nozzles with the movement of the nozzles.
US10207271B2

Complete nucleic acid library preparation devices are provided. Aspects of the devices include: a thermal chip module comprising multiple CLC reaction wells; one or more plate locations; a robotically controlled liquid handler configured to transfer liquid between the one or more plate locations and the thermal chip module; and a bulk reagent dispenser configured to access each CLC reaction well of the thermal chip module.
US10207270B2

A method for coding and identification of biological samples for in vitro fertilization comprises the steps of applying to receptacles intended for unfertilized eggs and sperm, respectively, an identification code characteristic of the patient; placing unfertilized eggs and sperm, respectively, in the receptacles; storing, transporting and admixing the respective samples in receptacles which each carry the same code; and implanting the resulting embryo in the patient. The identification code may based on RFID technology, in which sample vessels (12) are codified by the application of an RFID tag (13).
US10207268B2

A sample plate comprising a sample well is disclosed. The sample well can comprise one or more bead retaining chambers. A method of using the sample plate and a kit comprising the sample plate is also disclosed.
US10207265B2

A microfluidic device molded in a single step provides a seamless fluid communication path from fluid input features to microfluidic channels. The device comprises a molded material which is formed around thread for forming high aspect ratio microfluidic channels. An associated method for the manufacture of the device is also provided.
US10207262B2

The invention relates to oligomerization of olefins, such as ethylene, to higher olefins, such as a mixture of 1-hexene and 1-octene, using a catalyst system that comprises a) a source of chromium b) one or more activators and c) a phosphacycle-containing ligating compound. Additionally, the invention relates to a phosphacycle-containing ligating compound and a process for making said compound.
US10207260B2

Carbonylation process for producing methyl acetate, by contacting dimethyl ether and carbon monoxide under carbonylation conditions in the presence of a catalyst having a zeolite of micropore volume of 0.01 ml/g. The zeolite is an as-synthesized organic structure directing agent-containing zeolite and contains at least one channel which is defined by an 8-member ring.
US10207256B2

The present invention provides a photocatalytic concrete material sprayed with titanium dioxide/activated zeolite composite material and preparation method thereof, and the photocatalytic concrete material sprayed with titanium dioxide/activated zeolite composite material comprises following raw materials in parts by weight titanium dioxide 0.1-20 parts, activated zeolite molecular sieve 0.1-20 parts, dispersant 0.1-5 parts, emulsifier 0.05-2 parts, coupling agent 0.05-2 parts, cement 40-90 parts, fine sand 40-90 parts and water. In the present invention, the activated zeolite molecular sieve can load titanium dioxide photocatalytic material as a carrier, and can easily adsorb gaseous pollutant of automobile exhaust with huge specific surface area (280.1 m2/g), thereby increasing photocatalytic degradation efficiency and the efficiency can reach 92%, besides, the present invention has advantages of simple preparation technology, cheap raw materials and low preparation cost, so the present invention is suitable for industrial production.
US10207252B2

The present disclosure relates to the use of pristine and surface functionalized cellulose nanocrystal (CNC) incorporated hydrogel beads as adsorbent materials for water treatment applications. Here the hydrogel beads were prepared by ionic crosslinking of biopolymer sodium alginate using calcium chloride.
US10207251B2

A process is disclosed for limiting the emissions of gases from a porous material in the form of particles comprising a porous inorganic support and at least 0.1% by weight of one or more compounds chosen from organic compounds, halogen compounds, boron compounds and phosphorus compounds. The particles are placed in motion within a hot gas stream traversing them, and a liquid composition containing one or more film-forming polymer(s) is sprayed over the moving particles by means of a twin-fluid atomization nozzle, in which the liquid composition is mixed with a pressurized gas, with a relative atomization pressure of greater than or equal to 0.7×1005 Pa, until a protective layer containing the film-forming polymer(s) and exhibiting a mean thickness of less than or equal to 20 μm is obtained on the surface of the said particles. A material resulting from this process is also disclosed.
US10207242B2

This disclosure relates to weldments useful as heat transfer tubes in refinery processes dealing with gas phase hydrocarbon process streams at high temperatures. This disclosure also relates to tubes that are useful in refinery processes dealing with gas phase hydrocarbon process streams at high temperatures. The weldments include a tubular member and at least one mixing element. The tubular member comprises an aluminum-containing alloy. The mixing element comprises an aluminum-containing alloy. The mixing element's aluminum-containing alloy can be the same as or different from the tubular member's aluminum-containing alloy. Other aspects of the disclosure relate to refinery processes dealing with gas phase hydrocarbon process streams at high temperatures which include such weldments.
US10207241B2

The current document is directed to an efficient multi-channel chemical reactor having a multichannel core containing a plurality of parallel channels, with conductive walls, having a varying composition along their lengths. The channels are heated by a frequency-addressing different regions within the reactor with an inductive coil, driven by an agile frequency or spread spectrum emission controller.
US10207239B2

A fluid distribution cap (301) for a fluidized bed reactor, comprising a tunnel shaped structure having two opposing walls for attaching to a fluid distribution plate (103), and at least one opening at an end of the tunnel shaped structure. The tunnel shaped structure has an inner surface (302) and an outer surface (303), wherein the inner surface (302) has a curved cross section, and wherein the outer surface (303) has a substantially V-shaped cross section. A fluid distribution plate (103) for a fluidized bed reactor, comprising a plate having a plurality of fluid vent holes (113), a plurality of fluid distribution caps (301), wherein for each fluid vent hole (113) a fluid distribution cap (301) is mounted over said hole (113). At least two mutually neighboring fluid distribution caps (301) are positioned with an opening of a first of the two neighboring fluid distribution caps facing a side of the second of the two neighboring fluid distribution caps. A fluidized bed reactor having a fluid distribution plate (103) and a fluid distribution cap (301).
US10207235B2

A furnace and a process for temperature control of a material stream, wherein the furnace has a first combustion chamber, at least one reactor tube for receiving the material stream to be heated, and at least one second combustion chamber. The at least one reactor tube extends through the first combustion chamber and through the at least one second combustion chamber. The furnace is designed to establish a first temperature in the first combustion chamber and a second temperature in the at least one second combustion chamber, wherein the first temperature and the second temperature are separately adjustable.
US10207230B2

A porous composite membrane includes a porous support layer of a poly(phenylene ether) or poly(phenylene ether) copolymer; and an amphiphilic copolymer having a hydrophobic block and a hydrophilic block or graft, wherein the hydrophobic block includes a polystyrene block, a poly(phenylene ether) block, or a poly(phenylene ether) copolymer block; and an ultrathin, cross-linked, water permeable layer, which is the reaction product of an electrophilic monomer and a nucleophilic monomer, in contact with a side of the porous support layer. The reaction product can be a polyamide that is the interfacial condensation product of: an aromatic, polyfunctional acyl halide comprising of 3 to 6 acyl halide groups per aromatic ring and an aromatic polyamine comprising at least two primary amine groups and a maximum number of primary amine groups that is less than or equal to the number of acyl halide groups on the polyfunctional acyl halide.
US10207226B2

A cartridge type hollow fiber membrane module including a housing, a hollow-fiber membrane bundle having a plurality of hollow fiber membranes, a first potting part that bonds the hollow fiber membranes at at least one end of the bundle of the plurality of hollow fiber membranes such that the hollow fiber membranes are open, and a sealing material that fixes the first potting part to the housing liquid-tightly, wherein the first potting part comprises an inner potting part and an outer potting part, wherein the inner potting part and the outer potting part are both formed of a potting material, wherein the sealing material is in contact with the outer potting part, and wherein both the inner potting part and the outer potting part are formed in a sealing direction of the sealing material.The cartridge type hollow fiber membrane module is free of leakage and contamination due to separation of a potting material even when steam sterilization is performed.
US10207222B2

An assembly for treating gaseous emissions includes a substrate body having cells for the passages of emissions gas. Lengths of metal wire are located in selected ones of the cells and an induction heating coil is mounted adjacent the substrate body for generating a varying electromagnetic field. In this way the metal wires are heated, resulting in heating of the substrate body and heating of exhaust gas flowing in the cells. Individual lengths of wire or wire lengths that are joined together are configured as loop conductors.
US10207221B2

The present invention relates to a new strategy for capturing NOx using a two-step process.
US10207217B2

A process for removing hydrogen sulfide and carbon dioxide from a fluid stream comprises a) an absorption step in which the fluid stream is contacted with an absorbent comprising an aqueous solution (i) of an amine of the general formula (I) in which R1, R2 and R3 are each independently selected from C1-4-alkyl and C1-4-hydroxyalkyl; each R4 is independently selected from hydrogen, C1-4-alkyl and C1-4-hydroxyalkyl; each R5 is independently selected from hydrogen, C1-4-alkyl and C1-4-hydroxyalkyl; X is OH or NH(CR1R2R3); m is 2, 3, 4 or 5; n is 2, 3, 4 or 5; and o is 0 or 1; and optionally (ii) at least one tertiary amine, where the molar ratio of (i) to (ii) is greater than 0.05; wherein at least 90% of the hydrogen sulfide is removed from the fluid stream and selectivity for hydrogen sulfide over carbon dioxide is not greater than 8, wherein a CO2- and H2S-laden absorbent is obtained; b) a regeneration step in which at least a substream of the CO2- and H2S-laden absorbent is regenerated and a regenerated absorbent is obtained; and c) a recycling step in which at least a substream of the regenerated absorbent is recycled into the absorption step a). The process allows a high level of hydrogen sulfide removal with a simultaneously high coabsorption of carbon dioxide.
US10207216B2

Disclosed is a method for the removal of urea dust from the off-gas of a finishing section (1) of a urea production plant, the method comprises subjecting the off-gas to quenching with water (06) so as to produce quenched off-gas, and subjecting the quenched off-gas to scrubbing using at least one venturi scrubber (11). As a result, a lower pressure drop over the scrubber is attained, and a more efficient growth of urea particles, facilitating the removal thereof.
US10207210B2

A filter device is configured to filter a liquid. The filter device includes a drum sized to receive the liquid and a plurality of filter panels coupled to the drum to define a plurality of discs. The liquid passes through at least a portion of one of the discs. Each filter panel includes a perimeter frame that defines a panel normal flow area and a filter media coupled to the perimeter frame. The filter media may be adapted to include a plurality of pleats.
US10207201B2

The present invention relates to a process for separating a phase (A) from a phase (B), phase (A) having a higher viscosity than phase (B), by inverting the direction of dispersion from phase (B) in phase (A) to phase (A) in phase (B) by recycling a stream comprising phase (B) in excess.
US10207192B2

A game system and method that uses an instrument as an input encourages a user to play along with the game's soundtrack on an instrument (e.g. guitar, bass, etc.). The game cues the player to play notes and/or chords on the instrument at an appropriate time and then data is collected from the instrument via a connection between the instrument and the apparatus running the game. The game then scores the user based on note/chord and timing information it receives.
US10207186B2

In an embodiment there is provided a computer implemented method of providing a game, the method comprising the following implemented by at least one processor and at least one memory of a device retrieving from at least one memory information associated with a plurality of first objects and one or more characteristics of said first objects and causing said objects with said one or more characteristics to be displayed on a display in an arrangement, executing at least one algorithm which: responsive to detected user input rearranges said first objects to provide a sequence of at least three adjacent first objects sharing at least one same characteristic, determines an upgrade level of each of said at least three adjacent first objects, and in response to said determination selecting one of said at least three adjacent first objects for upgrading, and causes an updated arrangement to be displayed with said selected one of the said at least three adjacent first objects being upgraded and having said same characteristic and other of said three adjacent first objects being replaced with further first objects. A device and program are also provided.
US10207185B2

Methods and systems for assigning a data center to service a request from a user account include receiving a login request to a cloud gaming server. The login request is examined to identify a user account. A use history of the cloud gaming server is examined to identify a data center. The user account is assigned to the data center to start a session of streaming game play at a server within the data center. The data center is identified without performing a connection testing operation.
US10207181B2

A system that incorporates teachings of the present disclosure may include, for example, an accessory having a plurality of tactile-sensitive buttons, a plurality of light sources, wherein each light source emits a controllable spectrum of light through a corresponding one of the plurality of tactile-sensitive buttons, and a controller coupled to the plurality of tactile-sensitive buttons, and the plurality of light sources. The controller can be operable to detect tactile contact of each of the plurality of tactile-sensitive buttons, receive status information associated with a video game, and adjust the spectrum of light emitted by at least a portion of the plurality of light sources according to the status information to indicate one or more aspects of the video game. Additional embodiments are disclosed.
US10207180B2

Systems, apparatuses and methods may provide for determining a state of a multi-player game and identifying a user communication associated with the multi-player game. Additionally, an outbound communication may be generated based on the user communication and the state of the multi-player game. In one example, generating the outbound communication includes conducting a weighted selection of one or more of a recipient, a content or an audio effect of the outbound communication based on the state.
US10207178B2

A method of calibration a video game system can include removing an optical filter that filters out visible light from a field of view of a camera to allow the camera to view visible light. The method can also include displaying a calibration image on a display screen located within the field of view of the camera, processing the video output feed from the camera with a computer processor to identify the calibration image, and calculating with the processor coordinates that represent corners of the display screen in the field of view of the camera once the calibration image is identified.
US10207177B2

Embodiments of the present invention provide a method, system and computer program product for game incentivized resource utilization optimization in a multiplayer gaming environment. In an embodiment of the invention, a method for game incentivized resource utilization optimization in a multiplayer gaming environment is provided. The method includes hosting a multiplayer gaming environment providing a game amongst a selection of servers in a cluster and detecting overutilization of a resource in one of the servers. A remedial action likely to reduce the overutilization can be identified as can an incentive of the game likely to provoke the identified remedial action. Thereafter, the identified game incentive can be provided to a player in the multiplayer gaming environment.
US10207176B2

There is provided a home-use crane game machine whose operation of a rotation transmission mechanism can be restored with ease that includes a plurality of motors 91, 92, 93 having a drive shaft to which a gear is fitted, rotation transmission mechanisms having a plurality of gears which are rotated by the plurality of motors 91, 92, 93, a catcher 65 for grabbing a prize 6 which is moved up and down by the rotation transmission mechanisms, a crane main body 54 having the motors 91, 92, 93 and the rotation transmission mechanisms internally, and rollers 68, 69, 70 connected to the rotation transmission mechanisms via input gear mechanisms.
US10207171B2

An integrated golf club comprising standard golf club shaft and an integrated electronics system golf club head apparatus for directly measuring physical parameters of the golf club head motional acceleration swing forces and golf club head face and golf ball impact forces and further processing those measurements and transmitting the measurement data wirelessly to a user interface device. The integrated electronics system golf club head comprises several optimized assemblies that support electronic measurement, processing and wireless communication functions that are integrated with a customized golf club head shell and club face to provide a golf club head with physical properties that are substantially similar to that of a regulation play golf club head of same type. The user interface device that receives wirelessly transmitted data further processes the data and provides the golfer with useful golf swing and impact metrics in multiple different user selectable formats.
US10207170B2

A system for aiding the selection of a golf shot by a golfer on a hole of a golf course, comprising means for retrieving statistics indicative of past performances by the golfer for each of a plurality of golf club types, means for retrieving data regarding the hole of the golf course, means for analyzing the retrieved statistics in concert with the data regarding the hole of the golf course, means for selecting one of the golf club types as the statistically preferred golf club type for the golf shot, and means for displaying the selected golf club type to the golfer.
US10207155B2

An object of the present invention is to provide a golf ball showing a low spin rate on driver shots and a high spin rate on approach shots. The present invention provides a golf ball comprising a spherical center, at least two envelope layers covering the spherical center, and a cover covering the envelope layers, wherein an envelope layer (Es1) formed from a material having a lowest material hardness among a center constituent material and envelope layers constituent materials, is disposed in a region located at a distance from 36.0% to 65.0% of a golf ball radius from a center point of the golf ball.
US10207143B2

A manually operated treadmill a deck and a tread belt encircling the deck to provide a movable, continuous running surface during operation of the treadmill. Further, the treadmill includes a transmission connecting a flywheel to the tread belt and a resistance unit disposed to adjustably apply a resistance force to the inertial motion of the flywheel.
US10207139B2

A fitness training apparatus is described that can include at least one pole, at least one set of one or more adjustable members, and at least one elastic member. The at least one pole can be configured to extend from at least one vicinity of at least one shoulder of a user to another at least one vicinity of a waist of the user. The at least one set of one or more adjustable members can be adjustably coupled to the at least one pole. The at least one elastic member can be configured to be adjustably coupled to the at least one set of one or more adjustable members. Related methods, techniques, articles, systems, and apparatuses are also described.
US10207138B2

A resistance device applied to relative rotations between a flywheel and an axis includes an inner stator, an outer rotor, a conductive wire and a magneto-rheological fluid. The inner stator is fixedly joined with the axis and includes an accommodating space surrounding the axis at a position away from the axis. The outer rotor, fixedly joined with the flywheel, encloses and rotates relative to the inner stator. An accommodating gap is formed between the outer rotor and the inner stator at a position away from the axis. The conductive wire is wound in the accommodating space, and generates a magnetic line passing the accommodating gap when applied by an electric current. The magneto-rheological fluid is filled in the accommodating gap. Thus, the outer rotor is disposed at the outer most region of the resistance device to increase the braking torque, and the magneto-rheological fluid is away from the axis to increase the braking moment.
US10207137B2

Embodiments of the invention provide a safety system for coupling a rider to an amusement attraction with a track assembly including a junction box, and a plurality of control surfaces. The plurality of control surfaces includes slideable and rollable control surfaces. The safety system includes a carriage system for coupling the rider to the track assembly including a main support assembly, and a rolling safety mechanism including a rotatable element. The rotatable element includes a track engagement surface including rolling and sliding surfaces. In some embodiments, the rolling safety mechanism includes a plurality of pucks. Some embodiments include a rolling safety mechanism with a partially truncated ellipsoidal member rotatably mounted to a control support. In other embodiments, the rolling safety mechanism includes two partially truncated ellipsoidal members each positioned at substantially opposite ends of a support frame that includes at least one lanyard support.
US10207134B2

At least one embodiment comprises a testing system for a fire suppression system which can comprise at least one fluid conduit having a first end and a second end with an isolating valve and at least one pressure regulating valve coupled to the conduit. A tap is coupled to the fluid conduit, and is positioned between the first end and the second end and be for selectively allowing fluid to flow out from the fluid conduit to allow fluid to flow past the pressure regulating valve. The process for testing a fire suppression system can comprise the following steps: connecting at least one first valve to a fluid conduit, disconnecting sprinkler heads from the fluid conduit, flowing water through the pressure regulating valve determining the flow rate through the pressure regulating valve, and determining the pressure downstream of the pressure regulating valve, stopping testing, and then reporting the results.
US10207123B2

A skull-implantable magnet assembly for delivering a static magnetic field to a patient's brain, comprising a rod-shaped magnet housed within a skull screw, removably attached to a casing housing at least one flat magnet, is described. Details of the exterior construction are discussed, as well as magnet arrangements and methods of treating a brain tumor or neurological ailment of a patient.
US10207120B2

An electronic medical system is described. The system comprises an external RF power transmitter configured to emit a first power signal via an electromagnetic coupling, said RF power transmitter being configured to emit said first energy signal with a power no greater than 1 W. The system further comprises an implantable medical device comprising: at least one receiver antenna configured to receive said first energy signal via an electromagnetic coupling; an RF power receiver module configured to extract a second energy signal having a power of at least 1 mW and to be powered by said second energy signal; a power actuator module, operatively connected to the RF power receiver module, powered by said second energy signal. The power actuator module is configured to deliver a medical treatment to at least a target tissue of a patient on the basis of a control signal generated by the RF power receiver module.
US10207116B2

An intracardiac ventricular pacemaker is configured to operate in in a selected one of an atrial-tracking ventricular pacing mode and a non-atrial tracking ventricular pacing mode. A control circuit of the pacemaker determines at least one motion signal metric from the motion signal, compares the at least one motion signal metric to pacing mode switching criteria; and responsive to the pacing mode switching criteria being satisfied, switches from the selected one of the non-atrial tracking pacing mode and the atrial tracking pacing mode to the other one of the non-atrial tracking pacing mode and the atrial tracking pacing mode for controlling ventricular pacing pulses delivered by the pacemaker.
US10207115B2

The present invention relies on a controller-transmitter device to deliver ultrasound energy into cardiac tissue in order to directly improve cardiac function and/or to energize one or more implanted receiver-stimulator devices that transduce the ultrasound energy to electrical energy to perform excitatory and/or non-excitatory treatments for heart failure. The acoustic energy can be applied as a single burst or as multiple bursts.
US10207102B2

Methods and devices are provided for activating brown adipose tissue (BAT) using electrical energy. In general, the methods and devices can facilitate activation of BAT to increase thermogenesis. The BAT can be activated by applying an electrical signal thereto that can be configured to target sympathetic nerves that can directly innervate the BAT. The electrical signal can be configured to target the sympathetic nerves using fiber diameter selectivity. In other words, the electrical signal can be configured to activate nerve fibers having a first diameter without activating nerve fibers having diameters different than the first diameter. Sympathetic nerves include postganglionic unmyelinated, small diameter fibers, while parasympathetic nerves that can directly innervate BAT include preganglionic myelinated, larger diameter fibers. The electrical signal can be configured to target and activate the postganglionic unmyelinated, small diameter fibers without activating the preganglionic myelinated, larger diameter fibers.
US10207100B2

The present invention is an injection port with an articulated stopcock allowing a syringe to be connected to an IV line and, depending upon the orientation of the stopcock, allow (1) bidirectional flow of fluid through the stopcock into the IV line, (2) no flow or (3) unidirectional flow of fluid through the stopcock and into or out of the IV line. The invention is particularly useful for using a syringe for aspirating an IV line and then injecting a medicine from the syringe into the IV line. Once a syringe is connected, the invention allows one-handed manipulation of the articulated stopcock into the three orientations by simply moving the connected syringe into one of the three orientations, thereby eliminating the need for using two hands—one to operate the syringe and the other to operate the handle.
US10207097B2

Embodiments of a tamper-proof adapter can be configured to provide interconnection of medical tubing or other devices with varying fitting or coupling types. In one embodiment, the adapter can permanently couple a first male Luer fitting to a second male ISO 80639-6 compliant fitting.
US10207093B2

The present invention discloses multiple approaches to preventing the capsule walls and other material from interfering with the performance of an electronic device once the device is activated by surrounding fluid. In accordance with the teachings of the present invention, a miniature ingestible device (MID) may be created using excipients and films. The MID, in accordance with various aspects of the present invention, will have a coating or laminating surrounding an electronic device and separating and isolating the device from the pharmaceutical product or drug within the capsule once the capsule is ingested as well as from the capsule itself as the capsule walls begin to collapse during the disintegration process.
US10207092B2

A device, for atraumatically elevating the Schneiderian membrane during a sinus lift procedure with positive, real-time indication of the amount of lift occurring, may include: a first conduit; a first balloon coupled to a first end of the first conduit and in fluid communication therewith; a second conduit; a second balloon coupled to a first end of the second conduit and in fluid communication therewith; and means for infusing a fluid into the first and second conduits to cause inflation of the balloons. The balloons may be constructed the same, or may be individually tailored. The first balloon is configured to be received within the implant socket and apply pressure to the membrane. The second balloon, expanding against atmospheric pressure only, is configured of a different material and wall thickness. An integral scale behind the second balloon provides indication of the inflation and lift provided by the first balloon.
US10207089B2

A device that can be placed within or near the cranial vault that fluctuates in size in response to changes in CSF pressure is disclosed. The device diminishes in size when CSF pressures rise and increases in size as CSF pressures diminish. The device has the effect of reducing the flow of CSF occurring in the foramen magnum and provides an alternative to craniovertebral decompression in Chiari I patients. The device may have applications in other neurologic illnesses associated with abnormal CSF flow, such as Idiopathic Syringomyelia, Normal Pressure Hydrocephalus, and CSF dural leaks.
US10207087B2

The present invention is thus directed to methods and apparatus for decreasing pressure in a first portion of a vessel of the cardiac structure of a patient by implanting a shunt communicating with an area outside said first portion, whereby a volume of blood sufficient to reduce pressure in said first portion is released.
US10207084B2

Devices and methods for balloon delivery of rapamycin and other hydrophobic compounds to the wall of blood vessels. Balloon catheters, such as those used for balloon angioplasty, are modified with the addition of a reservoir of dry micelles. The micelle preparation is reconstituted and the micelles are mobilized when the aqueous solution used to inflate the balloons is injected into the catheter. The micelles are infused into tissue surrounding the balloon when pressurized fluid within the balloon leaks through the wall of the balloon.
US10207063B2

The present invention relates to a nebulizer, such as a spray can, for the topical application of a liquid and/or solid to a surface. The nebulizer is characterized by a valve comprising a mixing chamber designed for forming a colloidal mixture comprising a dispersed phase consisting of a liquid and/or a solid substance and a continuous phase consisting of a propellant gas before delivering the colloidal mixture to the nozzle. The invention also relates to a method for the topical cooling of the skin of a person or animal. In addition, the invention relates to various other uses of the device.
US10207060B2

A therapy appliance, in particular for use for administering medicaments by nasal inhalation, includes a ventilation tube, on the input side of which is attached an aerosol generator connected to a medicament container, which aerosol generator is connected to a control unit. The ventilation tube is attached at the end to a nasal applicator.
US10207045B2

A surgical handpiece has a connecting body with a distal end and a work tip with a hub at a proximal end. The hub is detachably connected to the connecting body by a threaded connector. The work tip has an open operating end at a distal end. This opening leads an axial channel extending through the work tip from the operating end to the hub. A radial channel extends from the axial channel in the hub to the external surface of the hub. A sleeve surrounds and is spaced from the hub. This sleeve extends to the vicinity of the operating end of the work tip, and has a first external connector in the region of the radial channel of the hub. The sleeve also has a second external connector. A seal is provided for establishing a fluid connection between the radial channel of the hub and the second external connector of the sleeve. The first external connector of the sleeve is in fluid connection with an irrigation channel between the inner surface of the sleeve and the external surface of the work tip. This irrigation channel extends to the vicinity of the operating end of the work tip for delivery of irrigation fluid to that area. The irrigation channel is generally concentric with the axial channel in the hub. Aspiration fluid is withdrawn from the open operating end of the work tip, through the axial and radial channels of the hub, the seal and the second external connector of the sleeve to an aspiration pump.
US10207040B2

A dialysis machine comprising: a microphone; an alert module for producing an audible alert related to an operating condition of the dialysis machine; and a processing module configured for: receiving, from the microphone, information related to measured noise; determining, based on the information related to measured noise, an audible alert that will not be masked by the measured noise when the audible alert is produced by the alert module; and providing, to the alert module, instructions for producing the audible alert.
US10207027B2

Provided are synthetic bone graft substitutes that include bioactive glass and a carrier. Synthetic bone graft substitutes may include bioactive glass, glycerol and polyethylene glycol. Also provided are bone graft substitutes that include collagen and bioactive glass particles. Example bone graft substitutes may include collagen and bioactive glass particles. Other example embodiments may include Type I Bovine Collagen, an angiogenic agent, such as hyaluronic acid, and bioactive glass. Further provided are methods that include administering the present bone graft substitutes to a mammal, e.g., by surgical insertion of the bone graft substitute into the mammal, either alone or in conjunction with one or more implant devices. Further provided are kits that include the present bone grafts.
US10207022B2

A tissue dressing material for being applied in contact with a tissue of a patient. The tissue dressing material's main component is deacetylated native chitosan. Moreover, a liquid tissue dressing material for being applied in contact with a tissue of a patient, the tissue dressing material being an aqueous mixture. The main component of the constituent(s) of the mixture other than water is deacetylated native chitosan.
US10207015B2

Provided is a decontamination apparatus for decontaminating an enclosed room. The decontamination apparatus includes a source including a UVC bulb and a reflective shield arranged adjacent to the UVC bulb and configured to reflect UVC light emitted by the UVC bulb toward a region of the enclosed room to be decontaminated. A mounting system that is adjustable secures the source at a desired location within the enclosed room. A controller is operatively-connected to the source to terminate operation of the UVC bulb in response to a determination that an occupant is present within the enclosed room.
US10207014B2

An imaging nanoparticle comprising a plant virus particle having an interior surface and an exterior surface, an imaging agent that is linked to the interior and/or exterior surface, and a layer of biocompatible mineral such as silica coated over the exterior surface, is described. The imaging nanoparticle can be used in method of generating an image of a tissue region of a subject, by administering to the subject a diagnostically effective amount of an imaging nanoparticle and generating an image of the tissue region of the subject to which the imaging nanoparticle has been distributed.
US10207007B2

This document relates to conjugates of TNF inhibitors or derivatives thereof and functionalized (e.g., mono- or bi-functional) polymers (e.g., polyethylene glycol and related polymers) as well as methods and materials for making and using such conjugates.
US10206991B2

This invention provides an immunogenic composition including the supernatant of a Mycoplasma hyopneumoniae (M.hyo) culture, wherein the supernatant of the M.hyo culture has been separated from insoluble cellular material by centrifugation, filtration, or precipitation and is substantially free of both (i) IgG and (ii) immunocomplexes comprised of antigen bound to immunoglobulin.
US10206986B2

This disclosure describes polypeptides fragments of annexin II, variants thereof, compositions that includes such fragments and/or variants, and methods of using such frag and/or variants.
US10206979B2

Disclosed is a method of treatment for anti-Alzheimer's disease based on an action mechanism associated with amyloid β protein, which action mechanism is different from conventional action mechanisms. The treatment Alzheimer's disease uses a therapeutic agent for cognitive impairment induced by amyloid β protein, which therapeutic agent comprises a peptide having the amino acid sequence represented by SEQ ID NO:1 or a peptide similar to this peptide, especially a peptide containing the amino acid sequence represented by SEQ ID NO:2, which is a partial sequence of SEQ ID NO:1. VLSSQQFLHRGHQPPPEMAGHSLASSHRNSMIPSAAT (SEQ ID NO:1) HRGHQPPPEMA (SEQ ID NO:2).
US10206959B2

The present disclosure provides methods of using probiotic arginolytic oral compositions including isolated arginolytic bacterial strains to increase arginolytic activity in the oral cavity, increase ammonia-producing bacteria in the oral cavity, and/or to treat and/or prevent oral disorders, such as caries.
US10206958B2

Disclosed herein are compositions that have substantially purified Christensenellaceae bacteria, and uses of these compositions to alter the microbiome of an individual. The addition of Christensenellaceae bacteria, such as Christensenella, to the microbiome of an individual can treat or prevent weight gain, reduce body weight, inhibit fat accumulation, reduce excess adiposity, and reduce a high body mass index (BMI), and can also treat or prevent conditions correlating with excess weight and fat and a high BMI, such as insulin sensitivity, metabolic syndrome, excess adiposity, and diabetes.
US10206948B2

Methods are provided to make clinoptilolite into a water-soluble hydrolyzed form suitable for various administration routes, including oral administration. Absorption of water-soluble hydrolyzed clinoptilolite fragments can aid in detoxification by binding heavy metals and environmental toxins, can reduce reactive oxygen species and inflammation related to heavy metals and other/environmental toxins, resulting in an increase in energy, and/or in an increase in one or more of focus, concentration, and memory. Water-soluble hydrolyzed clinoptilolite fragments can be combined with one or more dietary supplements, including various vitamins and sleep aids.
US10206942B2

The present disclosure provides pharmaceutical compositions comprising nucleic acids capable of targeting IGF-1R expression in M2 cells. The present disclosure also provides methods for the selective reduction of M2 cells by targeting expression of IGF-1R in these cells. The present disclosure further provides methods for treating cancer and enhancing therapeutic by targeting expression of IGF-1R in M2 cells in patients. The pharmaceutical composition of the present invention is effective when administered systemically to subjects in need thereof. The ease of administration of the pharmaceutical composition facilitates treatment and enhances patient compliance.
US10206939B2

Methods and compositions for safe and effective treatment of papulopustular rosacea in a subject are described. The methods involve topically applying to an affected skin area a topical composition containing ivermectin and a pharmaceutically acceptable carrier. Treatment with ivermectin represents an innovative therapy that is more robust and effective than the conventional treatments.
US10206938B2

Described herein are compositions comprising shortened fibers of poly-N-acetylglucosamine and/or a derivative thereof (“sNAG nanofibers”) and anti-bacterial applications of such compositions. The sNAG nanofibers may be formulated into compositions for the prevention and/or treatment of bacterial infections and diseases associated with such infections. Regimens employing such compositions are also described.
US10206934B2

Methods for treating inflammation-mediated conditions of the eye are described, comprising: implanting into the vitreous of the eye of an individual a bioerodible implant comprising a steroidal anti-inflammatory agent and a bioerodible polymer, wherein the implant delivers the agent to the vitreous in an amount sufficient to reach a concentration equivalent to at least about 0.05 μg/ml dexamethasone within about 48 hours and maintains a concentration equivalent to at least about 0.03 μg/ml dexamethasone for at least about three weeks.
US10206926B2

Described herein are compounds of Formula (I) and tautomers and pharmaceutical salts thereof, compositions and formulations containing such compounds, and methods of using and making such compounds.
US10206917B2

An aqueous drug that contains the compound represented by formula (1) or a salt thereof and in which the precipitation and the chemical dissolution of the compound of formula (1) or of a salt thereof is inhibited. An aqueous drug containing: the compound represented by formula (1) or a salt thereof; and a magnesium compound. The aqueous drug has a pH of 5.8-6.9. The concentration of the compound represented by formula (1) is 3 mg/mL or more.
US10206911B2

The present invention encompasses the recognition that an F876L mutation of the androgen receptor (AR) gene confers resistance to the antiandrogens enzalutamide (MDV3100) and ARN-509 and is associated with incidence and/or risk of castration resistant prostate cancer (CRPC). The present invention also provides other AR polypeptide sequences associated with increased incidence and/or risk of CRPC. The present invention also provides screening methods for identification and/or characterization of novel AR polypeptide sequences associated with increased incidence and/or risk of CRPC via exposure to antiandrogens and for identification and/or characterization of agents to treat and/or reduce risk of CRPC by virtue of their effect on AR transcriptional activation.
US10206905B2

The present invention relates to the use of a composition for preparing a medicament for the treatment of amyotrophic lateral sclerosis and associated disorders. The composition comprises 3-methyl-1-phenyl-2-pyrazoline-5-one or pharmaceutically acceptable salts thereof and borneol. The medicament is a drug used for delaying the occurrence time of amyotrophic lateral sclerosis and extending the survival time, and for improving memory function defect of amyotrophic lateral sclerosis.
US10206893B2

Compounds that modulate the oxidoreductase enzyme indoleamine 2,3-dioxygenase, and compositions containing the compounds, are described herein. The use of such compounds and compositions for the treatment and/or prevention of a diverse array of diseases, disorders and conditions, including cancer- and immune-related disorders, that are mediated by indoleamine 2,3-dioxygenase is also provided.
US10206890B2

A composition of matter comprising in combination as component (a) at least one 3-(3-dimethylamino-1-ethyl-2-methyl-propyl)phenol compound, and as component (b) at least one antiepileptic, a pharmaceutical formulation and a dosage form comprising said composition of matter, and a method of treating pain, e.g. neuropathic pain, in which components (a) and (b) are administered simultaneously or sequentially to a mammal, whereby component (a) may be administered before or after component (b) and whereby components (a) or (b) are administered to the mammal either via the same or a different pathway of administration.
US10206883B2

Abuse-resistant oral dosage forms suitable for administration of pharmacologically active agents are provided.
US10206881B2

Disclosed in certain embodiments is a controlled release oral dosage form comprising a therapeutically effective amount of a drug susceptible to abuse together with one or more pharmaceutically acceptable excipients; the dosage form further including a gelling agent in an effective amount to impart a viscosity unsuitable for administration selected from the group consisting of parenteral and nasal administration to a solubilized mixture formed when the dosage form is crushed and mixed with from about 0.5 to about 10 ml of an aqueous liquid; the dosage form providing a therapeutic effect for at least about 12 hours when orally administered to a human patient.
US10206879B2

The invention relates to solid medicinal forms containing at least one active ingredient and at least one pharmaceutically compatible, water soluble drying agent which is selected from the group consisting of trimagnesium dicitrate and/or calcium chloride, the solid medicinal form having a drying loss of at most 6% and a relative equilibrium moisture content of 25% or less. The invention also relates to solid medicinal forms containing a moisture-sensitive active ingredient and trimagnesium dicitrate.
US10206877B2

The present invention features compositions comprising a plurality of therapeutic agents wherein the presence of one therapeutic agent enhances the properties of at least one other therapeutic agent. In one embodiment, the therapeutic agents are cystic fibrosis transmembrane conductance regulators (CFTR) such as a CFTR corrector or CFTR potentiator for the treatment of CFTR mediated diseases such as cystic fibrosis. Methods and kits thereof are also disclosed.
US10206860B2

Biguanide-preserved precipitated calcium carbonate oral care compositions and methods of manufacture thereof are disclosed.
US10206841B2

An actuation system having a table, a lifting column for raising and lowering the table, first and second actuators pivotally mounted to a top section of the lifting column. The first and second actuators are coupled to a first end of the table. A guide plate having a top portion and at least one track is provided. The at least one track is slidingly engaged with at least one guide, the at least one guide is vertically mounted to a third side of the lifting column. The top portion of the guide plate is vertically driven by the third actuator and is universally coupled to a second end of the table. A controller for controls the movement of the lifting column in the vertical plane, and of the table in the longitudinal and lateral planes by varying the position of the three actuators relative to each other.
US10206835B2

A bed for maintaining the patient in horizontal position includes a patient support, undercarriage provided with casters and a system for propelling the bed which includes a controller and a control panel both connected to a processor unit. The controller includes a touch sensor connected to the processing unit. An activation member is also connected to processor unit. The activation member is a part of the control panel and it serves to activate the system and to initialize the calibration process of the touch sensor. An essential condition for propelling the bed is activated touch sensor and concurrently any of the function buttons being pressed. The touch sensor is being recalibrated before every system initialization hence the control of the system for propelling the bed is safe for the patient and the propelling of the bed is comfortable and simple for the personnel.
US10206834B2

Systems and methods for detecting a pinch event or obstruction to a movable component of a patient support. In some embodiments, the patient support apparatus may include a control system capable of controlling one or more actuator systems coupled to one or more movable components of the patient support apparatus. The control system may operate according to one or more modes of operation in controlling the actuator system to move a component from a first position to a second position. In one embodiment, the control system may receive sensor feedback indicative of one or more operating characteristics of an actuator system, and analyze the sensor feedback differently in one mode than in another. In one embodiment, the controller may receive sensor feedback indicative of both a speed of a component coupled to the movable component and a current of power supplied to an electric motor of the actuator system.
US10206830B2

An apparatus is configured for use with a chair having a supporting surface, and includes a cushioning member adapted to be placed above the supporting surface, a bottom sheet connected to the cushioning member and having an engagement surface opposite the cushioning member, a top sheet having a bottom surface positioned in confronting relation to the engagement surface and a top surface opposite the bottom surface, and a selective gliding assembly positioned between the top and bottom sheets. The top sheet has at least one end connected to the bottom sheet, and the top sheet further has a slip resistant material positioned on the top surface. The selective gliding assembly includes engagement members positioned on the engagement surface and on the bottom surface of the top sheet, and the engagement members engage each other to resist forward sliding of the top sheet and to permit rearward sliding of the top sheet.
US10206820B2

A percutaneous implant for reducing the risk of post-implant infection by reducing the likelihood of epidermal down-growth between the dermis of the skin and the implant. In one example, the implant comprises a barrier member between the epidermis and the dermis about the implant. In another example, a barrier is provided by removing a portion of the epidermis from the dermis about the implant.
US10206817B2

Laser assisted cataract surgery methods and devices utilizing one or more treatment laser beams to create a shaped opening in the anterior lens capsule of the eye when performing a capsulorrhexis procedure. A light absorbing agent may optionally be added onto or into the lens capsule tissue, and the treatment laser wavelength selected to be strongly absorbed by the light absorbing agent. Alternatively, the treatment laser wavelength may be selected to be absorbed or strongly absorbed by the tissue itself, in which case no additional light absorbing agent need be used. Visualization patterns produced with one or more target laser beams may be projected onto the lens capsule tissue to aid in the procedure. The devices may be attached to or integrated with microscopes.
US10206816B2

A surgical device and procedure for accessing tissue to perform microsurgery, including a capsulotomy of a lens capsule of an eye. The device includes a handpiece with a tip for insertion into an incision. A sliding element is disposed within the handpiece and a suction cup is mounted to the sliding element. The sliding element can be translated to move the suction cup into and out of the handpiece. A compression mechanism associated with the suction cup and the handpiece compresses the suction cup for deployment through the tip of the handpiece. The suction cup can expand inside the anterior chamber into a cutting position. A cutting element mounted to the suction cup is used to cut a portion and to remove the portion. The cutting element may be mounted to a cutting element support structure in a way that prevents heating of the device.
US10206812B2

A thermal pack (10) for therapeutic treatment of a mammal that includes a bladder (12, 4) and a separator element insert (22). The bladder (12, 14) is formed of a pair of superposed sheets (12, 14) of flexible, heat conductive liquid impermeable polyurethane material and includes an inlet (18) and an outlet (20). The sheets (12, 14) are welded together at a central spine (17) and along a series of branches (16) so as to provide a turning, tortuous fluid passageway therein. The separator element insert (22) is received within the fluid passageway and provides a fluid conveying track that extends throughout the fluid passageway from the inlet (18) to the outlet (19) to maintain the sheets (12, 14) in spaced apart relationship to mitigate restrictions in fluid flow when the pack (10) is flexed out of the plane of the sheets (12, 14). The separator element insert (22) includes a series of deflector ribs (36, 38, 40, 42, 44) along the fluid conveying track that deflect fluid flow away from the separator element insert (22) and into the fluid passage way along at each turn of the fluid passageway.
US10206808B1

An at least partly implantable system for injecting a substance into a patient's body. The system comprises an infusion device for injecting a substance into a part of the body of the patient, the infusion device being adapted for implantation inside the patient's body. The system further comprises at least one reservoir comprising at least one compartment which accommodates and preserves or is adapted to accommodate and preserve the substance to be injected, the reservoir being adapted for implantation inside the patient's body in fluid connection with the infusion device to supply to the infusion device the substance to be injected into the patient's body. The system further comprises an active cooling device adapted for implantation inside the patient's body and adapted to cool the reservoir and thereby keep the substance within said at least one compartment of the reservoir at a temperature below 37° C.
US10206806B2

Some embodiments of the present disclosure include a traction device for relieving lower back pain and stiffness and reducing lumbar spine intervertebral disc displacement. The device may include a sliding spine assembly attached to a head rest pad, a torso pad, and a hip pad, an adjustable length vector bar extending outwardly from the spine assembly, wherein the vector bar is rotatably attached to the sliding spine assembly such that the vector bar is configured to move in a plurality of vectors, a cross bar foot brace tube attached to the vector bar; a foot rest positioned on the foot brace tube, a belt positioned proximate to the torso pad, and a strap assembly attached to the foot brace tube or the distal end of the vector bar, the strap assembly configured to attach to the belt and apply traction to a user's back.
US10206803B2

A wrist brace device has a splint member including an arm portion for support along an inner forearm of a user, and a palm portion for supporting a palm on a palm supporting surface of the palm portion which is oriented generally in the direction of the arm portion to prevent overextension of the hand of the user relative to the forearm. A tool receiving surface is provided on the palm portion opposite from the palm supporting surface for engaging a handle of a tool thereon such that impacts from a tool head of the tool are directed substantially perpendicularly to the upper palm supporting surface and the arm portion of the user.
US10206802B2

A wearable apparatus for the treatment or prevention of osteopenia or osteoporosis, stimulating bone growth, preserving or improving bone mineral density, and inhibiting adipogenesis is disclosed where the apparatus may generally comprise one or more vibrating elements configured for imparting repeated mechanical loads to the hip, femur, and/or spine of an individual at a frequency and acceleration sufficient for therapeutic effect. These vibrating elements may be secured to the upper body of an individual via one or more respective securing mechanisms, where the securing mechanisms are configured to position the one or more vibrating elements in a direction lateral to the individual, and the position, tension, and efficacy of these vibrating elements may be monitored and/or regulated by one or more accelerometers.
US10206799B2

Methods and devices for increasing flow in the left atrial appendage (LAA) include a conduit directing blood flow from a pulmonary artery into the LAA and/or a conduit drawing blood from the LAA by a Bernoulli effect. In one embodiment, a method comprises implanting a conduit in a pulmonary vein, expanding an inlet portion such that the conduit becomes anchored within the vein and directs blood through an outlet portion of the conduit into or toward the left atrial appendage.
US10206783B2

A prosthetic device, adapted to be implanted in the human body and adapted to prevent and/or treat an infection that can arise and/or which has arisen at a bone site or at an articular site, wherein the prosthetic device has a prosthetic body provided with at least one surface for coupling, during use, with the bone or articular site and with at least one cavity placed along the coupling surface, wherein the at least one cavity is adapted to include, contain or house at least one pharmaceutical or medical substance.
US10206781B2

The present invention relates to a polymer scaffold design and method for treating segmental long bone defects without amputation that permits permanent regrowth of bone in the area of the segmental defect, without external fixation or other problems inherent in current systems. The polymer scaffold is preferably made from a poly(ester urea) polymer and includes an outer shell, sized to fit over a segmental defect in a bone, and a collagen containing material. In some embodiments, the collagen containing material is placed in a polymer insert sized to fit within the segmental bone defect and within said outer shell. In some embodiments, the outer shell may contain struts running longitudinal struts along the inside surface of the outer shell. In some of these embodiments, the insert will have a corresponding set of grooves sized to receive the struts.
US10206777B2

A prosthetic heart valve includes a stent having a collapsed condition and an expanded condition. The stent has a proximal end, a distal end and a plurality of cells, each cell being formed by a plurality of struts. A valve assembly is secured to the stent and includes a cuff and a plurality of leaflets. The plurality of leaflets are attached to the cuff adjacent an underwire that extends about the perimeter of the cuff.
US10206771B2

Surgical articles, implants and components suitable for female pelvic health procedures are described.
US10206770B2

Load Plan Generator (LPG) is a BIAPPS utility for generating ODI load plans based on desired subset of fact tables for loading BIAPPS Data Warehouse. The tool simplifies the configurations process by minimizing the manual steps and configurations and provides a guided list of configurations steps and checklists. The load plan components are basically different sets of load plans that will be stitched together by the load plan generator to create one load plan for loading chosen fact groups in the warehouse sourcing from different transaction systems.
US10206759B2

A method for monitoring the patient's teeth positioning, including the following steps: a) less than three months after the start of an orthodontic treatment, producing an initial reference model of the patient's arches, and, for each tooth, defining, from initial reference model, a tooth model; b) acquiring at least one updated image of the arches, under actual acquisition conditions; c) analyzing each updated image and producing an updated map relative to a piece of discriminating information; d) optionally determining rough virtual acquisition conditions that approximate the actual acquisition conditions; e) searching each updated image for a final reference model corresponding to the teeth's position during the updated image's acquisition, and; f) for each tooth model, comparing the tooth model's positions in the initial reference model and in reference model obtained at the end of the preceding steps, in order to determine movement of the teeth between steps a) and b).
US10206758B2

A disposable prophy angle with an accessible and replaceable internal collapsible prophylaxis bladder and a push button and plunger/paddle combination to force a metered amount of prophylaxis medium into the prophy angle while providing audible and/or tactile feedback.
US10206751B2

A robotic system comprises a joint position controller and a manipulator having coupled together housings. The manipulator is adapted to hold and manipulate a device. Motors for actuating corresponding degrees of freedom of the device and sensor processing units for sensing and converting states of the motors into digitally transmittable information are housed in one or more of the housings. A remote current controller is housed in a different housing than the one or more housings for space and/or heat considerations. The remote current controller generates drive signals provided over individual signal lines to the motors by using motor commands provided by the joint position controller and by using the digitally transmittable information received from the sensor processing units.
US10206750B2

A surgical system for positioning a prosthetic component includes a robotic arm and a surgical tool having an end effector configured to be coupled to the robotic arm. The system further includes a controller programmed to generate control signals, based on a planned pose of the prosthetic component, that cause the robotic arm to allow movement of the surgical tool in at least one degree of freedom and to constrain movement of the surgical tool in other degrees of freedom, wherein the controller is programmed to generate control signals that cause the robotic arm to maintain the constraint as the prosthetic component is implanted on the anatomy.
US10206746B2

A system may include a controller configured to determine a user interface status, wherein the user interface status includes user interaction of a user interface. The controller may also be configured to determine a drive mechanism location relative to a first limit and a second limit and select a clutching location based on the user interface status and drive mechanism location.
US10206742B2

Some implementations provide an apparatus for percutaneous delivery of laser energy, the apparatus including two or more hollow spikes, each having an insertion end and a coupling end, each including an optical fiber embedded as a permanent fixture therein, each optical fiber capable of emitting laser from the insertion end of the corresponding hollow spike; and\a hub coupled to the two or more hollow spikes at the respective coupling ends of each hollow spike, the hub including a connector for coupling the apparatus to a laser generator.
US10206739B2

A method and apparatus are disclosed for delivering energy substantially distal to an electrosurgical device. Embodiments of a device of the present invention may comprise an elongate member having one or more electrically insulated portions and a distal face comprising one or more electrically exposed conductive portions for delivering energy substantially distal to the elongate member. At least one of the one or more electrically insulated portions may extend from a proximal region of the elongate member to a distal end of the elongate member. In addition, a method is provided for creating a lesion at a target site within a body of a human or animal using an electrosurgical device. The method may comprise the steps of: inserting the electrosurgical device into the body such that the electrosurgical device is generally upstanding relative to the target site; and delivering energy from an energy source through a distal face of the electrosurgical device such that the energy is directed substantially distal to the distal face towards the target site.
US10206733B2

Body tissue ablation is carried out by inserting a probe into a body of a living subject, urging the probe into contact with a tissue in the body, generating energy at a power output level, and transmitting the generated energy into the tissue via the probe. While transmitting the generated energy the ablation is further carried out by determining a measured temperature of the tissue and a measured power level of the transmitted energy, and controlling the power output level responsively to a function of the measured temperature and the measured power level. Related apparatus for carrying out the ablation is also described.
US10206731B2

Various torque-limiting screwdrivers, systems, and methods are disclosed. The screwdriver can include a body supporting a motor configured to rotate a screw engaged with the screwdriver. The screwdriver can include a controller configured to implement torque-limiting functionality, such as by monitoring the amount of torque applied to the screw and reducing or stopping rotation of the screw when certain torque-limiting criteria are met. Some embodiments include a threshold point, after which the torque-limiting functionality can be engaged. Some embodiments include a slowdown point, after which the rotational speed of the screw is reduced.
US10206723B2

A spinal rod insertion instrument includes a hollow, monolithic body having a proximal end and a distal end. The body defines a passageway that extends along a first axis between the proximal and distal ends. The distal end includes first and second arms defining a slot therebetween. The first and second arms are configured to releasably retain a spinal rod therebetween. Also provided is a method of securing a spinal rod to a coupling element attached with a pedicle screw.
US10206716B2

Open implant closure structures include a helically wound guide and advancement flange form having pivot-splay accommodating and splay control surfaces with opposing load flanks in initial non-parallel relation.
US10206715B2

Devices, methods and systems for stabilizing at least a portion of the spinal column are provided. Devices include anchors and coupling members for engaging an elongate member. Systems include an elongate member sized to span a distance between at least two vertebral bodies and being at least partially formed of a flexible material. A number of anchors and coupling members are used to secure the elongate member to each of the vertebral bodies. The anchors can be compressed towards one another and the elongate member secured thereto and/or the elongate member can be tensioned to provide corrective forces to the spine.
US10206697B2

A method of preparing a knee joint for a prosthesis in a patient includes mating a patient-specific three-dimensional curved inner surface of a femoral alignment guide onto a corresponding three-dimensional femoral joint surface of the patient. The patient-specific three-dimensional curved inner surface is preoperatively configured from medical scans of the knee joint of the patient. First and second holes are drilled into an anterior portion of the femoral joint surface through corresponding first and second guiding apertures of the femoral alignment guide.
US10206696B2

Devices, kits, and methods that may be used to establish a distal femoral resection position or a proximal tibial resection position and a prosthetic gap in a total knee arthroplasty procedure are provided. Devices for establishing a distal femoral resection position or a proximal tibial resection position may comprise a support that attaches to and references a proximal resected tibia or distal resected femur and supports and establishes the position of a resection guide. A kit may comprise a device for establishing a distal femoral resection position or proximal tibial resection position and additional components that complement the device or facilitate application of the device during a total knee arthroplasty procedure. Methods for establishing a distal femoral resection position or a proximal tibial resection position are also provided.
US10206695B2

An orthopedic device for correcting a femoral bone abnormality includes a patient-specific three-dimensional shell and a patient-specific guiding feature. The shell has an outer surface and an inner bone engagement surface customized in a pre-operating planning stage by computer imaging to closely mate and conform to and substantially cover a femoral head of a patient in only one position. The guiding feature is pre-operatively planned relative to the shell such that when the shell is fitted over the femoral head, the guiding feature can guide a removal tool for removing an abnormality portion of the proximal femur of the patient.
US10206691B2

Disclosed is an assembly for holding a tool. The assembly may selectively reduce and/or eliminate vibrations received and felt by a user. Reducing vibrations may reduce or eliminate chatter at a working end of a tool.
US10206683B2

A vascular compression apparatus and method for applying pressure onto an area of a patient generally including a blood vessel and a wound site, such as a blood vessel puncture, after a cannulated procedure for the purpose of controlling bleeding and achieving hemostasis. The vascular compression apparatus includes a handle, a shaft and a pad. The shaft extends generally downward from the center of the bottom side of the handle. The pad is connected generally off-center of its top side to the bottom end of the shaft. The bottom side of the pad is convex to allow the vascular compression device to be rocked back and forth. In use, the pad is generally placed proximal to the catheter insertion site and over the blood vessel containing the catheter. The device is rocked proximally to control blood flow while removing the catheter. After the catheter is removed from the puncture site, the device is rocked distally to the puncture site, where pressure is applied until hemostasis is achieved.
US10206678B2

A surgical stapling instrument is disclosed. In at least one form, the instrument comprises an end effector, an elongate shaft, and an articulation joint configured to facilitate selective articulation of the end effector in directions transverse to a longitudinal axis. The instrument further comprises a longitudinally-reciprocating firing assembly comprising a firing bar and a knife. The instrument further comprises a firing assembly lockout arrangement on one of a first jaw and a second jaw and is configured to prevent distal advancement of the knife from a starting to an ending position unless an unfired surgical staple cartridge is operably supported in the one of the first and second jaws. The instrument further comprises means for applying a firing motion to the longitudinally-reciprocating firing assembly to drive the knife from the starting to the ending position and return the knife from the ending position to the starting position.
US10206673B2

Apparatus is provided that includes a casing, shaped to define a cavity, and one or more openings in the casing, in which openings one or more sutures are disposable; and a core, disposed in the cavity, and shaped to define a lumen in which the sutures are disposable. The apparatus has an unlocked configuration in which the sutures are disposable within and slidable through the openings and the lumen, and a locking configuration in which the sutures are inhibited from sliding through the openings and the lumen. The apparatus is movable from the unlocked configuration to the locking configuration, and is configured such that, when the sutures are disposed within the openings and the lumen, and the apparatus moves from the unlocked configuration to the locking configuration, the apparatus cuts the sutures at a cutting site, and becomes coupled to the sutures at a coupling site.
US10206672B2

An arthroscopic bone channel forming and suturing method including forming a first generally straight channel in a bone, forming a second generally straight channel in the bone, the second generally straight channel not intersecting the first generally straight channel, inserting a curved needle into the first generally straight channel, inserting a suture through the second generally straight channel in the bone to a suture pick-up location, manipulating the curved needle to form a curved junction between the first generally straight channel and the second generally straight channel; and pulling the suture by the curved needle from the suture pick-up location through the junction and though the first generally straight channel.
US10206650B2

Among other things, one or more techniques and/or systems for calibration of a radiation system to compute a gain correction(s) are provided. A calibration procedure is performed during which a portion of the detector array is shadowed by an object, causing the detector array to be non-uniformly exposed to radiation. A portion of a projection generated from the calibration procedure and indicative of radiation that did not traverse the object is separated from a portion of the projection indicative of radiation that did traverse the object, and a gain correction(s) is computed from the portion of the projection indicative of radiation that did not traverse the object (e.g., and is thus indicative of radiation that merely traversed air).
US10206649B2

A receiving antenna for wirelessly receiving data between a stator of a computed tomography (CT) imaging modality and a rotor of the CT imaging modality is provided. The rotor rotates about a rotational axis. The receiving antenna includes a dielectric portion and a conductive portion coupled to the dielectric portion. A second surface of the conductive portion extends between a first end and a second end along a conductive axis that is substantially perpendicular to the rotational axis. The second surface of the conductive portion has a first length at a first length location along a first length axis that is substantially parallel to the conductive axis. The second surface of the conductive portion has a second length at a second length location along a second length axis that is substantially parallel to the conductive axis. The first length is different than the second length.
US10206646B2

A method and apparatus for extracting centerline representations of vascular structures in medical images is disclosed. A vessel orientation tensor for each of a plurality of voxels associated with the target vessel, such as a coronary artery, in a medical image, such as a coronary tomography angiography (CTA) image, using a trained vessel orientation tensor classifier. A flow field is estimated for the plurality of voxels associated with the target vessel in the medical image based on the vessel orientation tensor estimated for each of the plurality of voxels. A centerline of the target vessel is extracted based on the estimated flow field for the plurality of vessels associated with the target vessel in the medical image by detecting a path that carries maximum flow.
US10206645B2

A method for imaging a target region in a subject is presented. The method includes selecting one or more tomographic angle sequences, acquiring one or more image sequences corresponding to the one or more tomographic angle sequences, where each image sequence has a corresponding tomographic angle sequence, deriving geometric information corresponding to one or more structures of interest in at least one of the image sequences, identifying visualization information, generating one or more displacement maps based on the geometric information, the visualization information, at least a subset of at least one of the one or more tomographic angle sequences, or combinations thereof, transforming at least a subset of images in the one or more image sequences based on corresponding displacement maps to create one or more transformed/stabilized image sequences, and visualizing on a display the one or more transformed/stabilized image sequences to provide a stabilized presentation of the target region.
US10206642B2

An imaging information processing apparatus including a communication circuit configured to communicate with an X-ray imaging apparatus including an X-ray sensor configured to obtain an X-ray image and an X-ray irradiation detection unit configured to detect irradiation of X-rays on the basis of an output of the X-ray sensor, causes, in response to receipt of a signal indicating a state of the X-ray sensor, a display unit to display a first indication for permitting irradiation of X-rays and causes, upon receipt of image data obtained in response to detection by the X-ray irradiation detection unit before receipt of the signal, the display unit to display a second indication corresponding to the image data.
US10206636B2

According to one embodiment, an X-ray diagnostic apparatus includes a first apparatus, a second apparatus, movement instruction input circuitry and control circuitry. In accordance with a movement instruction, the control circuitry is configured to control the first and second apparatuses so that the first apparatus can be moved to the target position. The control circuitry is configured to perform a retraction operation and a restoration operation. The retraction operation is an operation in which the first apparatus starts moving toward the target position and continues to move toward the target position, with the second apparatus retracted. The restoration operation is an operation in which the second apparatus is returned to the original position while avoiding the collision with the first apparatus.
US10206635B2

According to one embodiment, an X-ray computed tomography apparatus includes a gantry for imaging a subject by X-ray CT and a console communicably connected to the gantry. The gantry includes a gantry body and a column unit. The gantry body has a bore into which the subject is inserted when the subject is imaged by X-ray CT. The column unit includes a first column which supports the gantry body slidably in a direction perpendicular to a floor surface and a second column which supports the first column slidably in a vertical direction.
US10206632B2

A method for cardiovascular-dynamics correlated imaging includes receiving a time series of images of at least a portion of a patient, receiving a time series of cardiovascular data for the patient, evaluating correlation between the time series of images and the time series of cardiovascular data, and determining a property of the at least a portion of a patient, based upon the correlation. A system for cardiovascular-dynamics correlated imaging includes a processing device having: a processor, a memory communicatively coupled therewith, and a correlation module including machine-readable instructions stored in the memory that, when executed by the processor, perform the function of correlating a time series of images of at least a portion of a patient with a time series of cardiovascular data of the patient to determine a property of the at least a portion of a patient.
US10206614B2

A pre-sterilized fluid sampling syringe is provided which includes a locking vacuum syringe, 3-way valve, check valve and thermoplastic inlet tubing capable of both aseptic welding and direct connections. The syringe is assembled with components and rendered sterile in its packaging. The packaging permits manipulation of the syringe by the user such that at time of use a vacuum can be generated in the syringe barrel by pulling and locking the plunger into a fully withdrawn position. By using the check valve and vacuum feature of the sampling system the user of the device has a means of aseptically flushing and obtaining fluid samples from a desired system, typically a bioreactor or other process used in biotechnology and/or pharmaceutical laboratories and manufacturing operations.
US10206610B2

A sensing system includes a first radar sensing assembly and an analysis system. The first radar sensing assembly measures plural distances to a first target location at different times using radar. The analysis system receives the plural distances from the first radar sensing assembly and quantifies movements of a target object at the first target location at the different times by calculating differences in the plural distances measured by the first radar sensing assembly. The analysis system generates one or more first quantified activity level values indicative of the movements of the target object at the first target location using the differences in the plural distances that are calculated.
US10206589B2

An illumination source may be configured to illuminate the skin of the user. An illumination detector may detect electromagnetic radiation reflected of the skin of the user. A compensation module may be configured to determine the position of the skin of the user relative to the illumination detector. A processor may be configured to determine a heart rate of the user by analyzing information corresponding to an amount of the electromagnetic radiation detected by the illumination detector. The processor may also determine the heart rate of the user by compensating for the position of the skin of the user as determined by the compensation module.
US10206588B2

Devices and a system for detection of blood within in-vivo fluids are provided. A device comprises a housing that includes a gap. The gap has at least one opening through which in-vivo fluids may enter and/or exit the gap. The device further comprises an illumination source for illuminating the in-vivo fluids in the gap, a light detector for detecting light which passes through the in-vivo fluids in the gap, and flexible fins disposed on the housing in the vicinity of the gap's opening for covering the opening when the fins are folded and for pumping fluids into and out of the opening by repeated closure and opening of the opening by the fins, due to repeated peristaltic waves. This pumping effect may lead to continuous flow of fluids into and out of the opening and thus into and out of the gap of the device.
US10206587B2

An image processing apparatus according to an embodiment includes a processing circuitry. The processing circuitry is configured to obtain images in a time series including images of a blood vessel of a subject and correlation information indicating a correlational relationship between physical indices of the blood vessel and function indices of the blood vessel related to vascular hemodynamics, calculate blood vessel morphology indices in a time series indicating morphology of the blood vessel of the subject, on a basis of the images in the time series, and identify a function index of the blood vessel of the subject, by using a physical index of the blood vessel of the subject obtained from the blood vessel morphology indices, on a basis of the correlation information.
US10206579B2

Methods for performing orthopedic surgical procedures including generating scan data from the intra-operatives scans and comparing the scan data to a surgical plan are disclosed. The scan data and other feedback data are used to validate the position and orientation of orthopedic prosthetic component implanted in a body of the patient.
US10206578B1

A transillumination device having a yellow-orange light source, with LEDs having a wavelength in the range of 585-595 nm, preferably 590 nm, an amber light source with LEDs having a wavelength of light in the range of approximately 600-610 nm, preferably 605 nm, and a lime green LEDs light source having a wavelength in the range of approximately 535-545 nm, preferably 540 nm. Yellow-orange LED light sources have been found to be beneficial for transillumination of superficial veins, amber light sources have been found to be beneficial for transillumination of deeper veins and lime green light sources have been found to be beneficial for transillumination of arteries.
US10206574B2

Disclosed are an apparatus and method for imaging electrical properties of brain tissues including conductivity and permittivity using magnetic resonance imaging (MRI) signals. Electrical properties images for conductivity and permittivity of brain tissues may be obtained with high spatial resolution and high accuracy, without using a derivative which significantly amplifies noise in an MRI image, by calculating water content based on a ratio of MRI signals, calculating electrical properties from the calculated water content, and acquiring an electrical properties image for the calculated electrical properties.
US10206572B1

Systems and methods for monitoring of biometric and contextual variables to assist in screening for, quantification of, and prediction of smoking behavior, and for assisting in smoking cessation are described.
US10206571B2

Apparatus, systems, and methods are provided for treating obstructive sleep apnea. A CPAP system with an integrated oximeter sensor is disclosed wherein the sensor communicates with an oximeter processor that controls the blower. A nasal air flow sensor may also be incorporated that provides more data to the processor. A unique lightweight, flexible and stretchable hose for CPAP systems is also disclosed. The hose may have a magnetic connection with the blower.
US10206570B2

Systems, methods, and devices for obtaining physiological measurements of a patient using an adaptive body network are provided. In one example, a wireless medical sensor may include physiological sensor circuitry, wireless transceiver circuitry, and control circuitry. The physiological sensor circuitry may be capable of obtaining a physiological measurement of a patient. The wireless transceiver circuitry may be capable of joining a wireless web that includes at least one other wireless medical sensor, through which the wireless transceiver circuitry may communicate the physiological measurement to an external device. The control circuitry may be capable of determining a data update rate at which to operate the physiological sensor or the wireless transceiver circuitry, or a combination thereof, based at least in part on a status of the patient.
US10206568B2

A head mountable device for measuring eye movement includes: a camera system comprising a first camera, wherein the camera system is configured to obtain a first set of images of a first eye of a user with a first frame rate and a first resolution; a processing unit configured to process the obtained first set of images and provide a processing unit output based on the first set of images; and an interface connected to the processing unit, for providing a device output based on the processing unit output; wherein the first frame rate is sufficient to allow the processing unit to detect eye saccades of the first eye.
US10206567B2

An optical coherence tomography (OCT) system combining multiple wavelengths is generally described. In an example, the OCT system includes multiple wavelength swept light sources. The system further includes an interferometer into which light from the light sources is directed and a detector configured to produce an imaging sample signal based on light received from the interferometer. The system also includes a splitter configured to split light from at least one of light sources before the light reaches the interferometer. The system also includes a wavelength reference filter having an equal interval frequency comb and a signal processing circuit. The wavelength reference filter is configured to produce a sequential clock waveform from light received from the splitter, and the signal processing circuit is configured to resample the imaging sample signal based on the sequential clock waveform.
US10206564B2

A dental instrument system has an optical component with a mirror for the dental practitioner to view a patient's mouth. A light source and an airflow source have a plurality of output levels that are controlled by a user input on the handle, such as a single button. The output levels of the light and airflow are controlled by a single or double click, wherein a single click increases the output level of the airflow and a double click increases the output level of the light, for example. The light source illuminates the mirror and the airflow source produces airflow over the mirror to remove debris and bodily fluid. A clearing flow of air may be initiated by holding the single button down on the handle and release of the button may return the airflow to the previous level.
US10206551B2

Systems and methods for identifying relay contact position within an appliance. In one embodiment, an appliance includes a first motor, a second motor, and a relay. The relay can be configured to be adjusted between at least a first position associated with a first circuit of the first motor and a second position associated with a second circuit of the second motor. The appliance can also include one or more control device(s) configured to identify the position of the relay within the appliance. For instance, the control device(s) can provide a test signal to the relay and detect an output signal that is based at least in part on the input signal. The output signal can be associated with the second circuit. The control device(s) can determine whether the relay is in the first position or the second position based at least in part on the output signal.
US10206541B2

The apparatuses and methods of making and using the same are directed to bathing apparatus to support an object while bathing the object with a fluid. The bathing apparatus may comprise a support assembly constituting a support structure of the apparatus; a support surface to support the object, the support surface supported by the support portion; and a fluid catch disposed on at least three sides of the support surface, the fluid catch serving as a basin for the fluid in such manner to contain the fluid separate from the support surface. The bathing apparatus may be used in combination with a support wall that includes a plurality of channels to hold household items.
US10206538B2

The invention relates to an electrical kitchen appliance for processing food by means of at least one processing function, which can be set by a user, as well as to a corresponding method. The electrical kitchen appliance (1) is provided with a setting device (6) for the user-side setting of at least one parameter of the processing function, wherein the setting device (6) is embodied as rotary knob. According to the invention, provision is made for an operating mode, in which the parameter is changed by a first amount for each angle of rotation by rotating the rotary knob in one direction and in which the parameter is changed by a second amount for each angle of rotation by rotating the rotary knob in the opposite direction, wherein the first amount differs from the second amount. This solves the object of specifying an electrical kitchen appliance, by means of which a parameter of a processing function can be input on the user-side in a simple, quick and reliable manner.
US10206531B2

A bowl assembly is described having a bowl and lid and a masher. The lid has an embedded suction cup that is adapted to secure the bottom of the bowl when the lid is placed inverted on a flat surface. The bowl has interior ridges which serve to help mash up food when the masher is pressed down. The masher is ring-shaped and has a wider handle and food contacting surface.
US10206530B2

A tree trunk system for an artificial decorative tree includes a first trunk body defining a first central axis extending from a distal end to a proximal end, the distal end having an insertable portion defining a plurality of channels, and a second trunk body having a proximal end configured to receive the insertable portion of the first trunk body and having a protuberance extending radially inward. When the trunk bodies are coupled, thereby preventing rotation of the first trunk body relative the second trunk body, about the common central axis.
US10206521B2

Anti-sweep devices which are operable to contain a plurality of packages disposed on a base within a cover or housing, and dispense packages one at a time. A door for accessing a product such as a package is disposed at a front portion of the device. The base includes a pusher axially aligned with the long axis of the base. A sled, lift plate, product retention tab, a sled biasing element and a means for retarding a biasing force imparted by the sled biasing element are positioned below the base. The sled is slidably oriented along the longitudinal axis of the base and has a door contacting end and sled biasing element couple to the opposite end. The sled is engageable to the means for retarding a biasing force imparted by the sled biasing element. In use, opening the door to remove a product or package pushes the sled against the resistance of the sled biasing element, compressing it, and the lift plate and product retention tab are urged upward via the lift plate and through an aperture formed in the base to stop the next product or package from advancing toward the door.
US10206516B2

A mattress protector includes a unitary flat sheet for covering a surface of a mattress and providing a liquiphobic barrier for the surface. The flat sheet has four corners with cuts in the sheet proximal to and following a contour of each corner (or alternatively following the contour of each corner and laterally from corner to corner) to form corner attachment members for extending from the surface and under the mattress, thereby securing the sheet to the mattress.
US10206511B2

A universal chair leveler provides chair leveling for outdoor concert, event or other use. The universal chair leveler comprises a body having an angled bottom and a support for receive a chair leg at its top. A support may have one or more distinct cavities to receive various types of chair legs. A telescopic support provides height adjustment to permit use on a variety of sloped or other non-uniform surfaces.
US10206510B2

A folding chair includes a chair frame. The frame includes left and right side stands, front and rear cross supporting rod assemblies, seat rods, backrest rods and left and right side upright poles. Each side stand includes a front leg that leans backward and a rear leg that is coupled to the front leg and supports the front leg. The front or rear cross supporting rod assembly includes two front cross supporting rods. The seat rods are connected to the front legs, rear legs and upright poles. The backrest rods are connected to the rear legs. The upright poles are movably connected to the front legs.
US10206508B2

The invention relates to a chair, in particular a conference or visitor chair, which allows a coupled movement of a seat (3) and a backrest. The seat in this case is mounted in sliding bearings (4) comprising oblique guide surfaces (6) and is displaced and raised in the sliding bearings through a mounting end (5) of the backrest. According to the invention, two separate backrest bars (11) are provided, which are connected to the mounting ends (5), wherein the backrest bars can be moved independently of each other. In this way, different seat positions can be realized. Besides an upright standard position, an inclined high position, and an asymmetrical position, in which a one-sided load of a backrest bar (11) can be realized with a corresponding displacement and rotation of the seat (3).
US10206499B2

A multipurpose with an integrated computer system uses a desk and a drawer computer to provide a user with enhanced safety for themselves and their data. The desk has a support structure, a tabletop, an antiballistic shell, a concealment cavity, a computer enclosure, and a storage compartment. The support structure is a rigid frame onto which the tabletop is mounted. The antiballistic shell is a protective layer of material that wraps around the lateral surface of the support structure so that bullets and flying debris cannot harm the user or the drawer computer. The concealment enclosure is a cavity within the desk that functions as a personal bunker into which the user can crawl. The drawer computer is a personal computing device that is mounted within the computer enclosure. Finally, the storage compartment is a drawer or cabinet that can be used for storing personal items.
US10206498B1

A system and method for controlling a height adjustable workstation that includes a worktop supported by a frame, a processor, and a vertical displacement drive mechanism controllable by the processor to change the elevation of the worktop to different worktop elevation positions, the method comprising the steps of sensing the presence of a workstation user within a space associated with the workstation, tracking the duration of time that the worktop is in at least a first position while a user is within the space associated with the workstation and providing the user with a reminder to change the current position of the worktop to another position when the tracked duration of time reaches a threshold level by driving the worktop through at least one vertical displacement that is perceptible to the workstation user.
US10206496B1

A table and bench assembly that is configurable between a first position and a second position. In the first position the table and bench assembly is configured to provide a seating arrangement for a user. In the second position the table and bench assembly is configured to provide a combined seating and table arrangement for the user. A seating support member and tabletop support member are provided. A frame is further included wherein the frame further includes a pair of first leg members and a pair of second leg members. A seat brace member is provided and provides support for the seating support member. A seat member leg assembly includes a first portion and a second portion and is pivotally coupled to the seat brace member. The tabletop support member includes a plurality of longitudinal support members that further include at least one notch operable to engage a clamping member.
US10206488B2

The invention relates to a carrier frame for a load in the form of a rucksack or equivalent comprising a hip frame which is more rigid in the vertical direction than in the horizontal direction and a pair of chest frames. The hip frame is designed to be applied around the user's hips in order to transfer loads to the carrier's hip region. The chest frames extend from the hip frame upwards in front of the user's body and are fully or partially in contact with the user's chest area, below the user's collar bone but above the user's waist. The chest frames are each provided with a chest plate in order to distribute the pressure over a greater area when applied to the user's chest area and to reduce the pressure per unit area on the user's chest.
US10206486B2

A fan base and mirror apparatus for use in cooling a user's neck and torso while the user is positioned adjacent the apparatus includes a base member having upper and lower portions. A fan member is pivotally coupled to the base member and selectively movable between upward and downward directed configurations. An upstanding support member is coupled to the upper portion of the base member and extends upwardly therefrom. A mirror is operatively coupled to an upper end of the support member such that the mirror is vertically displaced from the fan member, the mirror being movable between straight and tilted configurations. The apparatus includes a light coupled to the mirror and electrically connected to a power source, the light configured to illuminate the mirror when energized.
US10206483B2

A cosmetic case according to the present invention for selectively receiving miniature cosmetic items includes a lower case portion having a bottom wall and a continuous side wall extending upwardly from a perimeter edge of the bottom wall, the lower case having an open top and defining an interior area. The cosmetic case includes an upper case portion pivotally coupled to a rear section of the side wall of the lower case portion and being selectively movable between open and closed configurations. A front section of the side wall defines a plurality of apertures configured to selectively receive the tubular cosmetic items into the interior area. The cosmetic case includes a spring loaded assembly configured to naturally urge the cosmetic items out of the interior area. A magnetic shelf in the lower case portion configured to support magnetic cosmetic receptacles.
US10206474B2

A case a portable listening device. The case includes a housing having an interior space to receive the portable listening device; a lid attached to the housing; a rechargeable battery and first and second wireless power receiving elements configured to receive electric charge from a wireless power transmitter during a charging event. The case further includes switching circuitry that is configured to disable one of the first or second wireless power receiving elements during a charging event when the disabled element is receiving power less efficiently than the other element.
US10206466B2

An umbrella shaft assembly is provided for securing an umbrella to a chair or table. The umbrella shaft assembly includes an elongated shaft having a first end and a second end. A plurality of hinged finger projections are located on the elongated shaft. The finger projections are configured to extend outward and retract inward toward the elongated shaft. Further, an aperture is located on the elongated shaft, wherein a cord extends therethrough. The umbrella shaft assembly can be secured to a chair via securing the cord to a chair frame. Similarly, the umbrella shaft assembly can be secured to a table by extending the finger projections such that the umbrella cannot be hoisted through an umbrella receiving opening of the table. The umbrella shaft assembly further includes a conventional umbrella assembly construction that is large enough to shield a person or persons from the elements encountered outdoors.
US10206463B2

This application relates generally to various embodiments of a magnetic wristband. More specifically the application describes a design for a magnetic wristband having a number of configurations. In one configuration the wristband is magnetically coupled around a user's wrist. In another configuration the magnetic wristband can be magnetically coupled around an electronic device to which it is attached. In this second described configuration the magnetic wristband acts as a protective cover for the electronic device to which the wristband is attached. In this way a user can reduce the likelihood of damage being inflicted upon the electronic device while it is not being worn.
US10206462B2

A tool is provided that includes a plurality of links including at least three links movably interconnected to one another to form at least a portion of a wearable accessory, such as a bracelet. The plurality of links are articulatable so as to alternately assume a first configuration in which the plurality of links extend linearly, a second configuration in which the plurality of links are curved about an axis in a first direction and a third configuration in which the plurality of links are curved about the axis in a second direction, opposite the first direction. The plurality of links are configured to permit limited motion in a direction parallel to the axis prior to becoming structurally rigid. At least one link includes at least one tool function. A clasp and a receiver are also provided to facilitate the functionality and versatility of the resulting wearable accessory.
US10206459B2

A closure device for a sports footwear s provided. The device facilitates insertion of the user's foot into the footwear and extraction of the same from the footwear. The closure device can switch from a closed position, in which the user's foot is immobilized within the footwear, to an open position in which the user's foot can be inserted into the footwear or extracted therefrom, and the device can be locked in a fixed position both when it is in its closed position and when it is in its open position. In particular, when it is in its open position, the closure device is locked in a position in which it does not hinder the operations of inserting the user's foot into the footwear and of extracting the user's foot from the footwear.
US10206457B2

A one-piece, triangular shoe insert for use in pointed-toe shoes where the toe box extends beyond the tips of the toes. The insert is small enough to fit into a toe box of a pointed toe shoe and not cram the toes. The insert is large enough so that the insert remains in place within a pointed toe box due to friction. The insert is made of a dense but resilient material, so that it also remains in place within a toe box due to expansion of the material against the surface of the interior, curved underside of the toe box. The insert may remain in a shoe for the life of a shoe, or it may be removed by wedging one's index finger or a blunt object such as a flat-edge screwdriver underneath the insert and pulling it out. Upon removal from a shoe, the resilient material from which the one-piece insert is made springs back to its original shape, and the one-piece insert may be reused.
US10206452B2

Embodiments are related to systems and methods that utilize shoes with an attachment member to couple with weights, wherein the attachment member may allow the weights to have a free range of motion when coupled with the shoes. Responsive to coupling the weights with the attachment member, a user may utilize the shoes to target specific muscle groups of the user's lower body.
US10206450B1

A customizable flip flop includes a colored sole: a quick release fastener; a “thong” formed as a post having a bottom portion fixedly secured to the sole, and an upper portion formed with a receptacle to releasably secure the fastener thereto; and first and second straps. A first end of each strap is secured to a respective side at the rear of the sole. A second end of each strap comprises a ring that is received upon the shaft of the fastener, to releasably secure the straps' second ends to the post. Between each of its ends, the straps may be formed as a tube. Prior to securing the rings of each strap to the post, a plurality of colored plastic loops or rubber bands are received on each strap/tube, to customize coloring of the straps as desired, and to provide added comfort to the top of the wearer's foot.
US10206443B2

A camouflage system includes a camouflage surface having a plurality of segments. The camouflage surface includes a first pattern disposed on a first segment of the plurality of segments, the first pattern including a depiction of a first microterrain of a natural environment, a second pattern disposed on a second segment of the plurality of segments, the second pattern including a depiction of a second microterrain of the natural environment, and a third pattern disposed on a third segment of the plurality of segments, the third pattern including a depiction of a third microterrain of the natural environment. The first microterrain differs from the second microterrain and the second microterrain differs from the third microterrain.
US10206439B2

An elbow joint supporter includes a first anchor section formed by wrapping one end of a tubular knitted fabric around the wearer's upper arm, a second anchor section formed by wrapping the other end of the fabric around the wearer's forearm, and a substantially X-shaped knitted supporting section intersecting at the wearer's cubital fossa. Two ends of the X-shaped knitted fabric are joined to the first anchor section and the other two ends of the X-shaped knitted fabric are joined to the second anchor section so as to support the wearer's elbow joint. In the circumferential direction of the fabric, the stretch resistances of the first anchor part and the second anchor part are larger than that of a base fabric section. In the length direction of the fabric, the stretch resistance of the supporting section is larger than that of the base fabric section.
US10206425B2

An exothermal vaporizer is provided. The exothermal vaporizer has a body including an air and vapor mix port, a fluid inlet port in communication with a reservoir, an air inlet, and a wicking material. A mouthpiece is coupled to the body and a temperature indicating cap is removable from the body. A counter flow design exothermal vaporizer, a modular exothermal vaporizer, and a vaporizer which is adjustable to modulate and/or regulate the flow ratio of dilution air and produced vapor are also disclosed.
US10206422B2

Systems, techniques and methods for estimating the metabolic state or flux, e.g., the body energy state (“BES”) of a patient, are disclosed. The BES provides a deep insight into the nutritional needs of the patient, thus allowing for a sort of exquisite glycemic control with regard to the patient. The invention discloses systems and methods for estimating fractional gluconeogenesis. The invention also discloses systems and methods for estimating and targeting patient blood lactate concentration, both as a target itself and as an intermediate step to estimating and targeting patient fractional gluconeogenesis glucose production. Nutritional support methods and formulations are also disclosed. The invention is suitable for any sort of patient, including those who are injured, such as with traumatic brain injury, ill, or have other conditions that stress the metabolic system.
US10206418B1

The current document is directed to methods and systems for manufacturing frozen-sushi food products that remain texturally and compositionally stable while frozen and refrigerated for extended periods of time. A variety of different processing steps and ingredients are employed to prevent retrogradation of gelatinized starch in cooked sushi rice, including quick cooking of the rice, employing non-nutritive sweeteners in place of sugar, controlling the amount of salt in the sushi rice, and use of β amylase and gellan gum.
US10206410B2

A composition and method for a high solids yogurt with reduced water activity. The high solids yogurt can be formed, for example, by culturing a high solids milk. Lactose present in the high solids milk can be hydrolyzed to glucose and galactose. Water activity of the yogurt can be further reduced by applying a vacuum-dehydration process to the high solids yogurt. The water activity of the yogurt can also be reduced by adding solutes to the yogurt. The composition can be used in food products, either in isolation or in combination with other components, for example, grain-based components.
US10206408B2

The present invention relates to a food-forming-apparatus with: a rotating drum (5) which comprises product cavities in which a food product is formed from a food mass and a food mass feed member (23), which comprises a housing with an infeed channel (24) and at least one upstream sealing area (25) and/or a downstream sealing area (26) and a flexible pressure plate (7) which is pressed against the outer surface of the drum and thereby provides a seal between the food mass member and the drum. The drum has at its outer surface a multitude of rows of cavities.
US10206394B2

The present invention relates to a compound of formula (I) wherein R1, R2, R3, R4, R5, R6, R7, R8, R9, R10, R11 and G are as defined herein; and wherein the compound of formula (I) is optionally present as an agrochemically acceptable salt thereof. These compounds are suitable for use as herbicides. The invention therefore also relates to a method of controlling weeds, especially grassy monocotyledonous weeds, in crops of useful plants, comprising applying a compound of formula (I), or a herbicidal composition comprising such a compound, to the plants or to the locus thereof.
US10206391B2

The present disclosure describes a formulation including a nanoparticle including a polymer-associated strobilurin compound with an average diameter of between about 1 nm and about 500 nm; wherein the polymer is a polyelectrolyte, and a dispersant or a wetting agent. The disclosure describes various formulations and formulating agents that can be included in the formulations. Additionally, the disclosures describes application to various plants and fungi as well as advantages of the disclosed formulations.
US10206386B2

An easily attachable and detachable equine shoe that is made up of a solid member with fabric straps extending from at least two sides that can be secured to an equine hoof. The straps may be folded upward in a plane perpendicular to the top face of the solid member to attach to an equine hoof.
US10206385B2

A limb line fishing device having a length of fishing line and an indicator. The indicator slidably receives the fishing line. The indicator tube can be used to determine at a distance whether a fish has been caught. The fishing device is capable of securing a reusable line and a hook when the device is not in use.
US10206379B2

Genetically modified non-human animals and methods and compositions for making and using the same are provided, wherein the genetic modification comprises a humanization of an endogenous signal-regulatory protein gene, in particular a humanization of a SIRPα gene. Genetically modified mice are described, including mice that express a human or humanized SIRPα protein from an endogenous SIRPα locus.
US10206372B2

A system for automatically detecting the presence of a cage or tray for containing laboratory animals in a specific position of a facility shelf and a method for managing the data relating to the cage, implemented by the system, particularly advantageous for the laboratory technician. In particular, the system is composed of a shelf comprising a plurality of devices designed to detect the position in the facility and the ID of a cage, a central control unit designed to process, through software, the information received in order to offer the operator the possibility of tracking and managing, by means of a database, the whole facility. Numerous other functions of the system are included, such as the function designed to detect and notify, visually or through the software, the correct positioning of a cage in the shelf.
US10206360B1

A novel maize variety designated PH41VG and seed, plants and plant parts thereof are provided. Methods for producing a maize plant comprise crossing maize variety PH41VG with another maize plant are provided. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH41VG through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby are provided. Hybrid maize seed, plants or plant parts are produced by crossing the variety PH41VG or a locus conversion of PH41VG with another maize variety.
US10206358B1

A novel maize variety designated PH42JS and seed, plants and plant parts thereof are provided. Methods for producing a maize plant comprise crossing maize variety PH42JS with another maize plant are provided. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into PH42JS through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby are provided. Hybrid maize seed, plants or plant parts are produced by crossing the variety PH42JS or a locus conversion of PH42JS with another maize variety.
US10206357B1

A novel maize variety designated X08M591 and seed, plants and plant parts thereof are produced by crossing inbred maize varieties. Methods for producing a maize plant by crossing hybrid maize variety X08M591 with another maize plant are disclosed. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into X08M591 through backcrossing or genetic transformation, and to the maize seed, plant and plant part produced thereby are described. Maize variety X08M591, the seed, the plant produced from the seed, and variants, mutants, and minor modifications of maize variety X08M591 are provided. Methods for producing maize varieties derived from maize variety X08M591 and methods of using maize variety X08M591 are disclosed.
US10206347B1

A novel maize variety designated X90K666 and seed, plants and plant parts thereof are produced by crossing inbred maize varieties. Methods for producing a maize plant by crossing hybrid maize variety X90K666 with another maize plant are disclosed. Methods for producing a maize plant containing in its genetic material one or more traits introgressed into X90K666 through backcross conversion and/or transformation, and to the maize seed, plant and plant part produced thereby. This invention relates to the maize variety X90K666, the seed, the plant produced from the seed, and variants, mutants, and minor modifications of maize variety X90K666. This invention further relates to methods for producing maize varieties derived from maize variety X90K666.
US10206340B2

In one example, a continuous track transport system for an irrigation system is provided that includes a continuous track with multiple track plates arranged so that adjacent plates are directly connected to each other, and also includes a gear train connected with the continuous track and operable to transmit an input torque to the continuous track to effect movement of the continuous track. The gear train includes a drive gear having an interface that is connectible to a gearbox of an irrigation system chassis, first and second driven sprocket-gears engaged with the continuous track, each of first and second driven sprocket-gears including a respective driven gear engaged with the drive gear, and a frame to which one or more gears of the gear train are rotatably mounted. Any one or more of the drive gear, sprocket-gear, and frame may comprise, or consist of, molded, glass-filled nylon.
US10206328B2

A spreading apparatus (10) for spreading granular and/or pulverulent material such as grain, salt, fertiliser and the like is disclosed. The apparatus (10) includes a hopper (11) having a discharge aperture (12), a vibration unit (17) arranged for agitating material within the hopper (11), circuitry (22) arranged for supplying power from a power source to one or more material handling components of the spreading apparatus (11), monitoring the power drawn by the one or more material handling components and controlling operation of the vibration unit (17) in dependence upon said power. In various embodiments, the material handling components may include one or more of: a spreading disk (15) arranged for distributing material received from the discharge aperture (12); an auger (18) extending through the discharge aperture (12); and/or a conveyer belt arranged for conveying material from the discharge aperture to the spreading disk (15). A method for spreading granular and/or pulverulent material is also disclosed.
US10206322B2

A towed vehicle hitch tongue includes movably connected front and rear tongue members, and a fully exposed master cylinder connected at opposite ends thereof to the tongue members such that a rearward force urging the front tongue member toward the rear tongue member forces pressurized braking fluid out of a port thereof into a braking circuit configured to exert a braking force. The braking circuit prevents braking until the rearward force warrants braking, provides dampening of the brake action, allows the towed vehicle to reverse, and can provide emergency stopping and dampening of movement of the hitch tongue. Instead of using movable front and rear tongue members, sensors can detect what the towed vehicle is doing, and apply appropriate braking force in response.
US10206321B2

An aerator with variable delay of the coring head includes a lift/lower control on an aerator control panel that raises and lowers a coring head and starts or discontinues rotation of a coring head crankshaft that reciprocates a plurality of coring tines. A delay timer provides a variable time period between starting to raise or lower the coring head and the rotation of the crankshaft. A switch is provided on the control panel to preset the time period.
US10212863B1

An electromagnetic interference (EMI) shielding gasket is disclosed, the gasket having a series of slots thereon. The gasket may include an electrically-conductive outer layer adhered to a resiliently compressible core, and may further include a pressure sensitive adhesive thereon for adhering the gasket to a substrate. Each slot is a portion of the gasket that has been removed from the gasket by, for example, cutting a portion of the outer layer and core and removing a substantial majority of the core and all but the base of the gasket, thereby leaving a strip of electrically-conductive outer layer in each slot.
US10212858B2

Apparatuses, methods, and systems directed to efficient cooling of data centers. Some embodiments of the invention allow encapsulation of cold rows through an enclosure and allow server fans to draw cold air from the cold row encapsulation structure to cool servers installed on the server racks. In other particular embodiments, the systems disclosed can be used to mix outside cool air into the cold row encapsulation structure to cool the servers. In some embodiments, the present invention involves utilizing a raised sub-floor design of a data center room.
US10212854B2

Described herein is a first system that includes sleds each having sidewalls, a mounting plate, and a first cover. The first cover is movable relative to the sidewalls between a closed position and an open position. The first cover includes at least one first opening. The system additionally includes at least one data storage device fixed to each mounting plate. A first air gap is defined between the at least one data storage device and the mounting plate, and a second air gap is defined between the at least one data storage device and the at least one first opening of the first cover. The sleds are stacked together such that the first covers of adjacent sleds are directly adjacent each other, and the at least one first opening of the first cover of one sled at least partially overlaps the at least one first opening of an adjacent sled.
US10212847B1

An air guiding duct and casing providing easy access for fan maintenance and electronic devices using the air guiding duct are disclosed. The air guiding duct includes a first guiding plate and a second guiding plate. The first guiding plate includes a first pivoting portion and first extension panels. The second guiding plate includes a second pivoting portion and second extension panels. The first guiding plate is rotatably connected to the second guiding plate, and can be in a first position to align with the second guiding plate and join each first extension panel with a second extension panel, to define air guiding channels for heat dissipation, and a second position, where the first guiding plate is tilted with a predetermined angle relative to the second guiding plate.
US10212839B2

An apparatus includes an enclosure, a power switch, a cable actuator, a power converter and a manual switch. The enclosure may be mechanically attachable to an external side of an industrial control panel. The power switch may be configured to switch electrical power. The cable actuator may be configured to control the power switch and may have an end connectable to a power disconnect handle of the industrial control panel. The power switch may be open while the power disconnect handle is in an off position and closed while the power disconnect handle is in an on position. The power converter may be configured to generate low-voltage power from the electrical power. The manual switch may be configured to switch the electrical power from a line side of the power switch to the power converter. A wire may transfer the low-voltage power through at least one aperture.
US10212832B2

Provided is an electro-optical panel including a first area in which a circuit is formed and a first terminal area and a second terminal area that are arranged side-by-side in a Y direction when viewed from the first area. The first terminal area and the second terminal area are each provided with a terminal group including a plurality of terminals arranged in an X direction different from the Y direction, and at least one of wires from the first terminal area to the first area and from the second terminal area to the first area extends from between the first terminal area and the second terminal area and reaches the first area through an area outside of the first terminal area when viewed from a central axis of the electro-optical panel extending in the Y direction.
US10212826B2

After a reel of a Moisture Sensitive Device is dispatched from a component keeping area and setup to a tape feeder is performed in an external setup area, exposure time for which the Moisture Sensitive Device is in an atmospheric exposure state is timed in a reel unit, and the exposure time is compared with exposure limit time set for the Moisture Sensitive Device and stored in a storage part. An electronic component mounting apparatus equipped with the reel of the Moisture Sensitive Device whose exposure time exceeds the exposure limit time is specified, and work by the apparatus is stopped.
US10212825B2

A method of forming a polysiloxane film on a substrate comprises polymerizing a siloxane monomer in a reaction chamber containing the substrate. The polymerization is catalyzed by a 30-60 W radio frequency plasma, the pressure in the reaction chamber during the polymerization is 100-400 mTorr, the residence time of the siloxane monomer in the reaction chamber is 5-120 minutes, the siloxane monomer is heated to 30-200° C. before entering the reaction chamber, and the polymerization is carried out at a temperature of 30-100° C.
US10212824B2

A gold-plating etching process for 5G high-frequency signal boards is carried out according to the following steps: the outer dry film, the plug gold-plating, the film removing, and the alkaline etching. The alkaline etching solution comprises 100 to 150 g/L of cupric chloride, 90 to 120 g/L of ammonium chloride, and ammonia. The pH value is 9.6 to 9.8. The ratio of the ammonia and the alkaline etching solution is (550-800):1000. The present invention provides a gold-plating etching process of 5G high-frequency signal boards. The alkaline etching procedure is performed right after gold-plating, eliminating the outer etching process after gold-plating. Costs of the outer film pressing, the exposure, and the development can be saved. The flow rate is improved. Requirements of 5G communication circuit boards are satisfied. That is, the transmission speed of 5G communication high-frequency signal boards of the present invention is fast.
US10212823B2

To form wiring on circuit board and conductor body, metal ink containing metal particles is dispensed by inkjet head straddling the circuit board and the conductor body. Then, a laser is applied by laser emitting device to the dispensed metal ink. The metal ink to which the laser is applied is baked and wiring is formed. A laser corresponding to the laser emission amount per unit of area based on the material of the circuit board, which is resin, is applied to the metal ink on the circuit board, and a laser corresponding to the laser emission amount per unit of area based on the conductor body is applied to the metal ink on the conductor body. The metal ink on the circuit board and the metal ink on the conductor body is baked appropriately, and wiring is formed appropriately straddling the circuit board and the conductor body.
US10212820B2

The present specification describes a reverse offset printing apparatus and a method.
US10212819B2

A flexible circuit board and display device including the same are disclosed. In one aspect, the flexible circuit board includes a base film including a bending area and a plurality of signal wires formed over the bending area of the base film. At least one through-hole is defined in the base film.
US10212808B2

Disclosed is a printed circuit hoard. The printed circuit board includes a plurality of insulation layers and a plurality of pattern layers alternately stacked. The printed circuit board includes a plurality of device areas on which semiconductor packages are mounted and a peripheral area adjacent the device areas. An electrostatic discharge pattern is in a respective pattern layer among the plurality of pattern layers and is disposed at a boundary region between a respective device area of the plurality of device areas and the peripheral area.
US10212800B2

A linear accelerator head for use in a medical radiation therapy system can include a housing, an electron generator configured to emit electrons along a beam path, and a microwave generation assembly. The linear accelerator head may include a waveguide that is configured to contain a standing or travelling microwave. The waveguide can include a plurality of cells that are disposed adjacent one another, wherein each of the plurality of cells may define an aperture configured to receive electrons therethrough. The linear accelerator head can further include a converter and a primary collimator.
US10212798B2

A torch for use in inductively coupled plasma is described. In the torch, a torch tube has an angular accelerator where a flow of gas experiences an increase in angular velocity. The torch tube also has a conical end where the increased angular velocity of the gas is encouraged to accelerate into a cavity that can support the plasma. In various examples, the conical end of the torch tube comprising a conical gap that accelerates the axial velocity component of the gas flow.
US10212797B2

A method of maintaining a supply of power to a load comprising operating a power generator connected to a mains voltage in a rated operating mode, generating a power signal by the power generator, feeding the power signal to the load, monitoring the mains voltage or a variable derived therefrom for an occurrence of a first specified event, and operating the power generator in a first predefined operating mode based on the occurrence of the first specified event, wherein the first predefined operating mode differs from the rated operating mode.
US10212787B2

A controlling of a lighting network based on traffic monitoring comprises steps of determining plurality of coverage areas of set of luminaires, where each luminaire comprises at least one light source. Information related to a presence of users in said coverage areas is received. This may relate both outdoor or indoor areas and activity. A status of at least certain luminaire is then changed to a reserve status, when a last detected user exits the coverage area. Each coverage area or luminaire is providing with an expected value for the time of when the next user is expected to arrive in the coverage area of said luminaire, A set of luminaires [R] of said luminaires with the reserve status to be controlled, such as dimmed, is then defined and information related to demand response requests [D1, . . . , Dn] of an electric power grid is received. In addition controlling, such as dimming, at least one of said defined set of luminaires in said reserve is performed in order to fulfill said demand response requests at least partially.
US10212780B2

A light source device is provided with: a plurality of surface light sources that have different wavelength bands; a multiplexing unit that multiplexes light beams emitted from the surface light sources; and an adjustment unit that adjusts, when an endoscope that serves as a reference endoscope is connected, the light amounts of light beams emitted from the surface light sources such that illumination light emitted from the reference endoscope has a predetermined color balance and that corrects, when an arbitrary endoscope is connected, the color balance on the basis of the ratio of the color balance of illumination light emitted from the connected endoscope and the color balance of illumination light emitted from the reference endoscope.
US10212767B2

A constant current driver circuit is provided for a vehicle light assembly having a plurality of light strings arranged in parallel with each other. Each light string in the plurality of light strings includes at least one light emitting diode (LED) electrically coupled in series with an LED driver. The driver circuit includes a bias circuit, a voltage regulator circuit and a sense circuit. The bias circuit is electrically coupled to each LED driver at a common node and, in absence of a trigger signal, operates to supply a bias voltage to each LED driver. The voltage regulator circuit is electrically coupled to the common node and regulates the bias voltage supplied by the bias circuit. The sense circuit is configured to detect on/off state of the voltage regulator and, in response to detecting an off state for the voltage regulator, provides a trigger signal to the bias circuit.
US10212751B2

The present invention provides a method of configuring transmission data streams and a wireless communication system. A first wireless device of the wireless communication system determines a number of data streams for a second wireless device, under a condition that the first wireless device operates in a noncontiguous operation mode. Radio frequency (RF) units of the wireless devices are fully exploited, and the data rate between the first wireless device and the second wireless device is enhanced.
US10212748B2

This relates to wireless communication on-board aircraft. More particularly, the present disclosure relates to a method for controlling an on-board aircraft network cell to be used in an on-board aircraft wireless communication network, to such an on-board aircraft network cell configured to be used in an on-board aircraft wireless communication network, to an on-board aircraft wireless communication network comprising at least one such on-board aircraft network cell, and to an aircraft comprising such on-board aircraft wireless communication network. An embodiment of the on-board aircraft network cell comprises at least one Wireless Module unit, at least two Wireless Data Concentrator units, and at least two independent wireless links, each wireless link being established between the at least one Wireless Module unit and one of the at least two Wireless Data Concentrator units.
US10212745B2

A mobile terminal (communication apparatus) selects a data item that needs to be obtained from an MFP (information processing apparatus) according to a user instruction given via an operation screen. Upon establishment of NFC communication between the mobile terminal and an NFC tag of the MFP as a result of the mobile terminal being brought closer to the NFC tag by the user, the mobile terminal reads, from the NFC tag, connection information for connecting to the MFP by using the Wi-Fi Direct. The mobile terminal connects to the MFP by using the Wi-Fi Direct based on the obtained connection information, and obtains data corresponding to the selected data item from the MFP through the Wi-Fi Direct communication.
US10212740B2

Disclosed are examples of lighting devices and other devices that are equipped with a cellular transceiver that is configured to communicate using cellular radio frequency spectrum in both a small-scale cellular network and a large-scale cellular communication network. By utilizing a short-range, low-power cellular transceiver setting, a lighting device facilitates communication, within the space in which the lighting device is installed, of messages between the lighting device and other types of user devices. Such an equipped lighting device may be configured to participate in the generation and delivery of different types of messages, such as data, emergency broadcast information, news and other information. Such a lighting device also may be configured to extend the reach of devices within the space in which the equipped lighting devices are located.
US10212732B2

The present specification relates to a method for transmitting medium access control protocol data unit (MAC PDU) in a wireless communication system. The method, which is performed by a terminal, comprises the steps of: transmitting a control signal through a physical uplink channel to a base station; and transmitting the MAC PDU including terminal identifier information for identifying the terminal to the base station using contention resources within contention-based PUSCH zone (CP zone).
US10212727B2

Control signaling in multiple access communication systems, including apparatus and methods, is disclosed. Multiple access to a wireless communication link is based on power modulation division. Modulation information, capacity information, resource scheduling information, and resource assignment information is determined by a base station. Information is transmitted to user equipment devices in a common control channel in accordance with the determined modulation information, capacity information and resource scheduling information. Information is also transmitted to supporting user equipment, which supports the power modulation division multiple access, in a user equipment-specific control channel in accordance with the determined resource assignment information.
US10212726B2

Disclosed herein is a method for transmitting, by a terminal, an uplink signal using a first cell type representing a cell using a licensed band frequency and a second cell type representing a cell using an unlicensed band frequency. The terminal configures at least one first radio bearer (RB) being able to use a radio resource for the first cell type and a radio resource for the second cell type for an uplink transmission. The terminal configures at least one second RB being able to use a radio resource for the first cell type for an uplink transmission. The terminal includes at least one first logical channel corresponding to the at least one first RB in a first logical channel group, and the terminal includes at least one second logical channel corresponding to the at least one second RB in a second logical channel group.
US10212725B1

Systems and methods are described for coordinating transmissions from a multiple access nodes in a communication network. A relay-capable status of wireless devices connected to an access node may be determined. Relay capable wireless devices are dynamically selected from the connected wireless devices for assignment of coordinated transmissions from an access node. Scheduling between the selected relay capable wireless devices and the access node is conducted.
US10212724B2

Systems, methods, apparatuses, and computer program products for enhanced link adaptation are provided. One method includes receiving, by a network node, channel state information (CSI) feedback from at least one user equipment (UE), scheduling the same UEs in one rank or more than one rank in the same subframe, and scheduling multiple UEs on at least one same time-frequency resource.
US10212723B2

Embodiments of the present invention disclose a user pairing method, a device and a system for realizing user scheduling. The method comprises: determining a first user of a time-frequency resource according to a preset resource allocation criterion; searching a preset pairing table according to a downlink channel state quantization code of the first user; and obtaining a paired downlink channel state quantization code which is paired with the downlink channel state quantization code of the first user, wherein the preset pairing table includes a pairing relationship among the downlink channel state quantization codes obtained by pre-calculating; identifying a paired user of the first user from users to be paired, wherein a downlink channel state quantization code of the paired user is the same as the paired downlink channel state quantization code. Through adopting of the present invention, complexity of real-time calculation of pairing during user scheduling can be lowered.
US10212720B2

A scheduling method, including: listening to, by a station, a first beacon frame containing a DTIM message used for indicating a beacon interval allocated for each group of stations within a current scheduling period; determining the beacon interval allocated for the station within the current scheduling period according to the DTIM message contained in the first beacon frame; listening to, by the station, within the beacon interval allocated for the station, a second beacon frame containing scheduling information of the current beacon interval used for indicating a time period allocated to each group of stations for data transmission within the current beacon interval; when data transmission is required, transmitting, by the station, data within the time period allocated to the group of the station according to indication of the scheduling information. The present invention improves utilization of time periods, saves time resources and enhances transmission efficiency.
US10212718B2

Provided is a communication apparatus that includes a communication unit configured to receive frames including first information from a plurality of other communication apparatuses and transmit first frames including information indicating a first transmission time period to the plurality of other communication apparatuses. The communication appratus further includes a control unit configured to determine the first transmission time period on the basis of the plurality of pieces of first information and a processing unit configured to generate the first frames.
US10212717B2

A data transmission method and a communications device resolve an existing problem that use of an unlicensed spectrum is interfered with between LTE devices when a padding is sent. The method includes: performing, by a communications device, CCA on an unlicensed spectrum; and when determining that the unlicensed spectrum is in an idle state, sending, by the communications device on a preset band resource in the unlicensed spectrum, a signal indicating that the communications device uses the unlicensed spectrum, where the preset band resource is a partial band resource in the unlicensed spectrum. Mutual interference between communications devices when the unlicensed spectrum is used is eliminated.
US10212715B2

Radio network node and method therein, for channel estimation of a channel used for wireless signal communication with a UE. The radio network node comprises a multiple antenna array configured for beamforming, spatial multiplexing and MIMO transmission. The radio network node also comprises a receiver, configured for receiving a first pilot signal from the UE, and a wireless signal from an interferer; and also configured for receiving a second pilot signal from the UE at a determined AoA, filtered by a receiver pre-filter; and a processor configured for spatial analyzing the received signals; and selecting the UE pilot signals; and configured for determining AoA for the selected pilot signals; and furthermore configured for designing a receiver pre-filter, for isolating signals from the AoA; and also further configured for estimating the channel, based on the received second pilot signal.
US10212709B2

Embodiments of the present disclosure provide a radio base station, a mobile station and a method for determining a transmitting power. A radio base station, according to an embodiment of the present disclosure, is connected with a plurality of mobile stations, wherein a first mobile station in the plurality of mobile stations can form at least one mobile station pair with other mobile stations. The radio base station comprises: a processing unit, configured to determine an initial value of a power factor of each mobile station pair according to state data of respective mobile stations in the mobile station pair, and determine an adjustment value of the power factor for the first mobile station according to state data of the first mobile station; and a transmitting unit, configured to transmit the initial value of the at least one mobile station pair and the adjustment value to the first mobile station.
US10212700B2

The present invention discloses methods for receiving and sending a control channel, user equipment, and a base station. The method for receiving a control channel includes: obtaining time-frequency resource information and first information of the control channel; determining a search space of the control channel according to the time-frequency resource information and the first information; and receiving the control channel in the search space. By using the methods, the user equipment and the base station according to embodiments of the present invention, the search space of the control channel can be determined according to the time-frequency resource information and the first information of the control channel, so that receiving and sending of the control channel can be implemented and a capacity of the control channel can be expanded, thereby improving system scheduling efficiency and flexibility and further improving user experience.
US10212698B2

[Object] To enable a frequency band shared between wireless communication of a cellular system and wireless communication conforming to a wireless LAN standard to be more appropriately used in the cellular system.[Solution] There is provided a device including an acquisition unit configured to acquire information indicating a terminal device which is a device candidate for performing wireless communication of a cellular system using a frequency band shared between the wireless communication of the cellular system and wireless communication conforming to a wireless local area network (LAN) standard, and a control unit configured to notify the terminal device that the terminal device is the device candidate.
US10212696B2

A first user terminal supporting D2D (Device-to-Device) communication comprises a processor and a memory coupled to the processor. The processor is configured to perform processes of: receiving, D2D resource information from a base station, determining data radio resources and control radio resources on the basis of the D2D resource information, from among D2D radio resources available for the D2D communication, transmitting, D2D communication control information by using the determined control radio resources to a second user terminal, the D2D communication control information indicating locations of the determined data radio resources, and transmitting and retransmitting, D2D communication data by using the determined data radio resources to the second user terminal.
US10212686B2

Systems and methods provide for an increase in hearability by a user equipment (UE, 116). This increase in hearability can be used to improve positioning results. Two different types of positioning subframes can be transmitted by cells in a radio access network (RAN) to improve hearability: measurement subframes and low-interference subframes. The selection of which type of positioning subframe to transmit can be determined algorithmically by the transmitting entity.
US10212684B2

A method, apparatus, and device for managing binding information on the network side are provided. The method includes the following steps: an entity on a network side sends a Binding Revocation Indication (BRI) message to an entity which stores binding relations of mobile nodes (MNs), where the binding relation includes a mapping between a home of address (HoA) of an MN and plurality of care of addresses (CoAs) of the MN and the BRI message includes at least one CoA ID; and the entity which stores the binding relations of MNs deletes the corresponding binding relation of at least one CoA ID in the BRI message after receiving the BRI message from the entity on the network side. Thus, with the present invention, the network side can delete the binding relation between a specified CoA and an HoA in the case of plurality of CoAs, which makes it easier to maintain corresponding binding relations.
US10212683B2

A system may be provided and may include a trusted DECT device; and a DECT base station; wherein the trusted DECT device is arranged to send, to the DECT base station, registration allowable DECT device credentials; wherein the DECT base station is arranged to: receive from a requesting DECT device a request for registration of the requesting DECT device to the DECT base station; wherein the request comprises requesting DECT device credentials; register the requesting DECT device to the DECT base station if the requesting DECT device credentials match the registration allowable DECT device credentials; and prevent a registration of the requesting DECT device to the DECT base station if the requesting DECT device credentials differ from the registration allowable DECT device credentials.
US10212679B1

The propagation channel in a wireless communication system may be characterized as a multipath fading model wherein the multiple delayed and attenuated versions of the transmitted signal are received. In the receiver's processing chain, the impairments introduced by this propagation channel may be equalized using the channel estimates. The channel estimation is mainly performed using the known reference signals by conventional methods. The estimation of delay spread profile may be crucial for high performance channel estimation. The conventional methods may be appropriate for high operating channel bandwidths. In the case of low channel bandwidth, limited number of reference signals may be available which may not be adequate for accurate delay spread estimation. A method and apparatus are disclosed that improve the delay spread estimation for low channel bandwidth scenarios.
US10212674B2

The present invention relates to a wireless communication system. More specifically, the present invention relates to power headroom reporting (PHR) in terms of multiple TDD UL/DL subframe configurations. According to one aspect of the present invention, the UE receives information informing the UE of multiple time division duplex (TDD) uplink/downlink (UL/DL) subframe configurations, and transmits a power headroom reporting (PHR) to the network. Here, the PHR comprises an identifier informing the network that the PHR is for a specific TDD UL/DL subframe configuration with regards to the multiple TDD UL/DL subframe configurations.
US10212667B1

Proximity sensors are used in many user devices to detect a user's proximity to it. The proximity detection may be used to control the transmit power of a user device to ensure that the transmit power is in the allowed power range. There are other uses of proximity detection. A proximity sensor, like many other electronic devices, needs power supply for its normal operation. Many user devices are battery operated and therefore reducing power consumption of a user device is essential. A method and apparatus are disclosed that may enable reduced power consumption for a proximity sensor. The disclosed method may be applied to any user device that employs a proximity sensor.
US10212663B2

Systems and methods for power management systems are disclosed. One embodiment of the invention includes a power management system for a vehicle locating unit, the vehicle locating unit having a receiver for receiving at an assigned message frame an intermittent transmission from a communications source, wherein each intermittent transmission includes at least one assignable message frame, the power management system including a processing device for controlling wake and sleep modes of the receiver and a memory for storing a plurality of memory bit patterns for comparison with a pattern of bits contained in some portion of an assigned message frame, wherein the processing device is configured to perform the following steps: index to the receiver's assigned message frame in the intermittent transmission, re-enter wake mode after indexing, and subject the receiver to a constant average current draw.
US10212637B2

Provided is a method for reporting mobility information by means of a terminal in a wireless communication system. The method includes generating mobility information and reporting the mobility information via a network. The mobility information includes mobility state information indicating the estimated mobility state of the terminal, and mobility history information relating to the mobility history of the terminal.
US10212632B2

A mobility management apparatus reselection method and a mobility management apparatus are provided. The method includes: receiving an access request message sent from user equipment (UE), where the access request message carries identity information of the UE; determining, according to the identity information of the UE, a type of a mobility management apparatus that the UE needs to access; reselecting a second mobility management apparatus according to the type of the mobility management apparatus that the UE needs to access; and forwarding the access request message to the second mobility management apparatus, so that the second mobility management apparatus executes an access request procedure of the UE. The embodiments of the present invention is applicable to the field of communications technologies.
US10212623B2

Some demonstrative embodiments include apparatuses, systems, devices and/or methods of packet coalescing. For example, an apparatus may include circuitry and logic configured to cause a first wireless station to process a notification from a second wireless station including transmit (Tx) packet coalescing information, the Tx packet coalescing information including packet type information to define one or more packet types for packet coalescing at the first wireless station, and a coalescing threshold indicator to indicate a coalescing threshold to limit the packet coalescing at the first wireless station; to coalesce a plurality of packets for the second wireless station by buffering the plurality of packets at the first wireless station, the plurality of packets having at least one of the one or more packet types; and, based at least on the coalescing threshold, to process one or more buffered packets of the plurality of packets for transmission to the second wireless station.
US10212621B2

The disclosure provides an apparatus and method for configuring DNS of a mobile device, and a storage medium. The apparatus includes: one or more processors; and a memory, wherein: the memory stores therein one or more computer readable program codes configured to be executed by the one or more processors to perform the operations of: functioning, by the mobile device, as a Wi-Fi relay to be connected with both a wireless access point and an electronic device; determining state information of communication between the wireless access point and the electronic device, forwarded by the relaying mobile device; determining whether communication is abnormal, according to the state information; and if so, then detecting a network service provider serving the mobile device; if the network service provider serving the mobile device is detected, then configuring a DNS list adapted to the network service provider; and configuring a DNS service of the mobile device according to the DNS list.
US10212607B2

Embodiments of the present invention provide a method for transmitting a data frame and a device. The method includes: determining, by a first device, a transmission pattern of the first device, where the transmission pattern includes a quantity and positions of occupied data frames and a quantity and positions of idle data frames in one transmission period; and occupying, by the first device, an unlicensed carrier according to the transmission pattern of the first device, to transmit a data frame of the first device. According to the embodiments of the present invention, fairness of occupying an unlicensed carrier by multiple devices can be ensured.
US10212604B2

A spectrum management apparatus and method, and an apparatus and method for wireless communication. The spectrum management apparatus includes: a determining unit, configured to determine an exclusive indicator of a high priority communications system that exists in a management range of the spectrum management apparatus, the exclusive indicator represents a range of the high priority communications system in space and/or frequency domains that is isolated from other communications systems; and an adjustment unit, configured to adjust the exclusive indicator when there are multiple exclusive indicators.
US10212601B2

In embodiments of hardware verification with RFID-stored build information, a mobile device includes hardware components and a radio-frequency identification (RFID) tag to store build information for hardware verification of the hardware components in the mobile device. A bootloader can interrogate the RFID tag to obtain the build information and compare the build information to current information of the hardware components in the mobile device. The bootloader can then determine whether the current information matches the build information. If the current information does not match the build information, then a message can be displayed on the mobile device indicating that unauthorized hardware is installed in the mobile device.
US10212593B2

In one arrangement, a first device presents a display that is based on context data, derived from one or more of its sensors. This display is imaged by a camera in a second device. The second device uses context data from its own sensors to assess the information in the captured imagery, and makes a determination about the first device. In another arrangement, social network friend requests are automatically issued, or accepted, based on contextual similarity. In yet another arrangement, delivery of a message is triggered by a contextual circumstance other than (or in addition to) location. In still another arrangement, two or more devices automatically establish an ad hoc network (e.g., Bluetooth pairing) based on contextual parallels. In still another arrangement, historical context information is archived and used in transactions with other devices, e.g., in challenge-response authentication. A great number of other features and arrangements—many involving head-mounted displays—are also detailed.
US10212592B2

Systems and methods for keyword- and location-based user authentication are disclosed. An example method includes, detecting a user request by a first user to complete a gaming task; detecting a user acceptance by a second user to accept the gaming task; tracking a first plurality of locations of the first user; tracking a second plurality of locations of the second user; obtaining a first keyword through a first user device associated with the first user; obtaining a second keyword through a second user device associated with the second user; authenticating the first user in accordance with the second keyword and the first plurality of locations; authenticating the second user in accordance with the first keyword and the second plurality of locations; and deeming the gaming task completed in accordance with authenticating the first user and authenticating the second user.
US10212591B1

Methods, systems, and apparatus, including computer programs encoded on a computer storage medium, for performing multi-factor authentication. In one aspect, a method includes determining that a user has successfully completed an authentication factor, determining whether a mobile device associated with the user is proximate to a computer; and authenticating the user based on determining that the user has successfully completed the authentication factor, and that the mobile device is proximate to the computer.
US10212582B2

A communication apparatus includes a transmission unit that, when providing communication parameters for communication in a wireless network, transmits an authentication request message for requesting authentication by unicast in a case where a transmission destination of the authentication request message is identified and transmits the authentication request message by broadcast in a case where a transmission destination of the authentication request message is not identified, a reception unit that receives a response message responding to the authentication request message from another communication apparatus, and a provision unit that provides the another communication apparatus with the communication parameters upon receipt of the response message.
US10212581B2

The disclosed embodiments relate to provisioning of a service, such as a financial service, to a device, such as a mobile device operative to access the service wirelessly or otherwise, in a manner which efficiently provides a consistent user experience which meets a user's expectations as to the functionality and quality of the service, including the user interface therefore and service delivery, which leverages the available capacities of the devices through which the service is provided so as to maximize the functionality and quality of the provided service without diminishing the experience, i.e. without substantially reducing the quality or functionality.
US10212578B2

Technology for provisioning categories of applications on a user equipment (UE) is disclosed. A registration update message may be received at a wireless network element from the UE over non-access stratum (NAS) signaling. Application Specific Congestion Control for Data Communications (ACDC)/Application and Service Access Control (ASAC) information may be communicated from the wireless network element to the UE in response to receiving the registration update message. The ACDC/ASAC may be activated at a selected prioritization level, at the wireless network element, while a wireless network channel condition of a wireless network exceeds a capacity threshold, the ACDC/ASAC enabling only application categories to operate at the UE that are contained in the ACDC/ASAC information.
US10212567B2

A method of utilizing an audio signal to transmit data for conducting electronic transactions includes in a user device, converting user identification data into a first audio signal and transmitting the first audio signal to a base device; in the base device, converting the first audio signal into the user identification data; in the base device, transmitting the user identification data and transaction content to a server device; and in the server device, obtaining authorization of a validation entity by utilizing the user identification data and the transaction content, for obtaining a transaction number and transmitting the transaction number to the base device.
US10212560B2

A method and apparatus are provided for sending a first terminal a message including a command adapted to trigger automatic sending by the first terminal of a request to set up a call between the first terminal and a second terminal.
US10212555B1

Environmental signals are used to determine when to prompt a user to enable location sharing on their computer devices. These environmental signals may include the current location of the user being an unusual location for the user or a location that is tagged as a known social location such as a concert venue, stadium, or park. The environmental signals may also include one or more friends of the user being near the user. If the user chooses to enable location sharing in response to the prompt, the location of the user may be shared with some or all of their friends, or just the friends that have been determined to be near the user. After some amount of time has passed, or the environmental signals have changed, the location sharing may be automatically disabled for the user.
US10212550B2

Embodiments of the present disclosure support improving determination of a location of a driver device that performs bandwidth constrained communication with a server, based on sensor data acquired by the driver device. The driver device reduces dimensionality of the acquired sensor data before transmitting the sensor data to the server over a communication network. The server receives GPS data and compressed sensor data from the driver device, and determines a quality metric related to the GPS data. Based on the quality metric, the server increases dimensionality of the compressed sensor data to reconstruct original sensor data acquired by the driver device. The server than augments the GPS data with the reconstructed sensor data, and determines location information of the driver device based on the augmented data.
US10212547B1

The invention provides a mobile QSL confirmation method that allows users to receive and confirm their incoming QSLs using a mobile device. This is achieved by gathering certain information from the mobile device, like GPS coordinates and/or carrier network information, in order to authenticate the user exact position. Once the account credentials and global position are verified, the system will provide the received QSL ID code in order to confirm.
US10212546B2

Embodiments of the present disclosure provide a collaborative positioning method and a wireless terminal, includes: generating, by a wireless terminal, positioning request information, where the positioning request information includes a positioning precision parameter; selecting a wireless communications technology according to the positioning precision parameter, where the selected wireless communications technology is a communications manner used by the wireless terminal to perform collaborative positioning; obtaining, by using the selected wireless communications technology, first collaborative positioning information sent by a neighboring terminal, where the first collaborative positioning information includes location information of the neighboring terminal; and calculating, by the wireless terminal, a current location of the wireless terminal according to the location information of the neighboring terminal. The embodiments of the present disclosure resolve a problem that a requirement on hardware of two collaboration parties is relatively strict.
US10212541B1

Systems, devices, media, and methods are presented for selective location-based identity communication. The systems and methods identify a current location of a mobile computing device and detect a selection of a user interface element associated with the current location. The systems and methods cause presentation of a set of display elements corresponding to the current location and detect selection of a display element of the set of display elements. The systems and methods modify a display characteristic for the current location of the mobile computing device within a set of mobile computing devices based on the selection of the display element.
US10212532B1

Aspects of the subject disclosure may include, for example, a method, comprising: receiving, by a media processor including a processor, spherical audiovisual media content from a content delivery network; rendering, by the media processor, video for a point of view in the spherical audiovisual media content at a display device coupled to the media processor; receiving, from a remote control device coupled to the media processor, a control signal panning the point of view, resulting in a new field of view; and generating, by the media processor, audio signals from the spherical audiovisual media content corresponding to the new field of view, wherein the audio signals are adapted to audio reproduction equipment coupled to the media processor. Other embodiments are disclosed.
US10212530B2

A method for dynamically changing the master audio playback device of a set that includes at least two audio playback devices, wherein one audio playback device of the set is a set master audio playback device that controls the play of audio data by at least one other slave audio playback device of the set. A first slave audio playback device receives its selection as a new recipient of audio data and, in response, the first slave audio playback device is designated as a new set master audio playback device and the set master audio playback device is designated as a new slave audio playback device. The new set master audio playback device controls the play of audio by the new slave audio playback device.
US10212529B1

A method, system, and computer product for providing a visual indication of sound capture capability of a microphone includes receiving data corresponding to a polar pattern and a sound capture range of the microphone from a memory, generating a projection signal based on the data corresponding to the polar pattern and the sound capture range provided from the memory, generating a virtual image based on the projection signal, and projecting the generated virtual image near a sound source. The virtual image provides a visual indication of capability of the microphone to capture a sound generated by the sound source.
US10212528B2

An acquisition system includes a processor, one or more sensors operatively coupled to the processor where the one or more sensors acquire at the ear, on the ear or within an ear canal, one or more of acceleration, blood oxygen saturation, blood pressure or heart-rate, and the one or more sensors configured to monitor a biological state or a physical motion or both for an event. The event can be a detection of a discrepancy when compared with a set of reference data by the one or more sensors or the biological state or the event can be one of a detection of an abrupt movement of a headset operatively coupled to the processor, a change in location of an earpiece operatively coupled the processor, a touching of the headset, a recognizing of a voice command, a starting or ending of a phone call, or a scheduled time.
US10212527B2

Embodiments include a system comprising a pipe that includes a first end and a second end. The pipe includes a plurality of sections coupled together. The system includes a loudspeaker that is a mouth simulator loudspeaker. The system includes an adapter that connects the loudspeaker to the first end. The system includes a receptacle positioned in the pipe a first distance from the first end and a second distance from the second end. The receptacle secures a plurality of microphones a third distance inside an inside surface of the pipe.
US10212514B2

A predictive brownout prevention system may be configured to prevent brownout of an audio output signal. Particularly, the brownout prevention system may be configured to receive information indicative of adaptive estimates of power supply conditions, wherein the information indicative of adaptive estimates of the power supply conditions comprises information regarding a voltage component and a resistive component received from an adaptive battery model of a battery for providing electrical energy to a power supply for generating the power supply voltage and adapt the adaptive battery model based on a monitored battery voltage output by the battery and loading events of the signal path and excluding loading events of components other than the signal path which are powered from the battery.
US10212513B2

An integrated circuit for digital signal routing. The integrated circuit has analog and digital inputs and outputs, including digital interfaces for connection to other integrated circuits. Inputs, including the digital interfaces, act as data sources. Outputs, including the digital interfaces, act as data destinations. The integrated circuit also includes signal processing blocks, which can act as data sources and data destinations. Signal routing is achieved by means of a multiply-accumulate block, which takes data from one or more data source and, after any required scaling, generates output data for a data destination. Data from a data source is buffered for an entire period of a data sample clock so that the multiply-accumulate block can retrieve the data at any point in the period, and output data of the multiply-accumulate block is buffered for an entire period of the data sample clock so that the data destination can retrieve the data at any point in the period. Multiple signal paths can be defined by configuration data supplied to the device, either by a user, or by software. The multiply-accumulate block operates on a time division multiplexed basis, so that multiple signal paths can be processed within one period of the sample clock. Each signal path has a respective sample clock rate, and paths with different sample clock rates can be routed through the multiply-accumulate block on a time division multiplexed basis independently of each other. Thus, speech signals at 8 kHz or 16 kHz can be processed concurrently with audio data at 44.1 kHz or 48 kHz.
US10212511B2

Disclosed herein are apparatus, method, and computer program product whereby a device receives an acoustic signal. In response to the received acoustic signal, the device outputs electrical signals from a first input audio transducer and a second input audio transducer. The second input audio transducer is less sensitive than the first input audio transducer.
US10212510B2

Disclosed is a loudspeaker module, comprising a shell, wherein a vibrating system and a magnetic circuit system are accommodated in the shell, the vibrating system comprises a vibrating diaphragm and a voice coil which are combined together; a whole inner cavity of the module is divided by the vibrating diaphragm into two cavities, i.e. a front voice cavity and a rear voice cavity; an edge portion of the vibrating diaphragm is fixed on the shell by using an annular supporting member, a plurality of cavity expansion portions formed by incomplete filling are distributed on the supporting member at intervals, and each of the cavity expansion portions is communicated with the rear voice cavity. The loudspeaker module of the present disclosure solves the technical problem of F0 rising due to the narrow rear voice cavity of the loudspeaker module in the prior art.
US10212503B1

A acoustic device includes a supra-aural ear cup, a pinna replica at least partially enclosed by the supra-aural ear cup, wherein an inner surface of the pinna replica faces the exterior so that exterior sounds are received by the pinna replica and a microphone unit for collecting said exterior sounds, said microphone unit being configured to emit a first electric signal comprising information on the collected exterior sounds.
US10212499B1

The fetal communication system comprises a belt unit and a headset. The headset comprises a microphone that picks up audible sounds and transmits them to the belt unit. By way of example and not of limitation, the audible sounds may be a pregnant woman speaking to her unborn child, music, or educational programs. The belt unit holds a sound transducer in place over the pregnant woman's abdomen via a belt strap that passed around her midsection. A circuit in the belt unit receives the wireless signal sent by the headset, amplifies the audio portion of the signal, and passes the audio signal to the sound transducer. The audible sounds played by the sound transducer may pass through the abdomen to the fetus.
US10212488B2

A channel-based method and system for relaying contents are disclosed. The content relaying method generates a channel on the basis of a user terminal or a specific group adjacent to a display device and can relay, to the display device, a screen for executing the contents displayed on the user terminal when the user terminal accesses the generated channel.
US10212485B2

Various embodiments are directed to one or more transcoder devices in communication with an input device such as a remote control device and multiple destination devices in which the transcoder device(s) facilitate communication between the remote control and the various destination devices in the vicinity. The transcoder device(s) can also provide the user with an environmental awareness of conditions and events surrounding the user. Other embodiments are described and claimed.
US10212479B1

In one embodiment, a method receives interest indications for entities, entitlements, and location information that are indexed by user profiles in databases. The interest indications for the entities, the entitlements, and the location information are transformed from being indexed by the user profiles to indexing the entities and indexing entitlement and location information as availability pairs in an index and associating user profiles in the user profiles as entries for the index. The method receives a notification of a live programming event before the event starts and uses the notification to determine an entity of a media program and an availability pair. A second database is queried using the entity and the availability pair to determine a set of user profiles associated with the entity and the availability pair. Then, an action is performed for at least a portion of the set of user profiles before the live programming event occurs.
US10212475B2

The present disclosure relates to a live video processing method and device. The method includes: determining whether a terminal is rotated when the terminal is playing a first live video; determining a current rotation angle and a current rotation direction of the terminal when it is determined that the terminal is rotated; and switching from playing the first live video to playing a second live video according to the current rotation angle and the current rotation direction.
US10212474B2

A method of receiving a video program and information related to the video program by a first device registered in a user account of a user as a standalone device at a server is disclosed. The method comprises sending location information of the first device to the server; sending a request to the server for the video program; receiving the video program; and receiving information related to the video program according the location information.
US10212469B2

Systems, methods, and non-transitory computer-readable media can define a set of video quality levels. One or more social engagement signals associated with videos uploaded at each video quality level out of the set of video quality levels can be acquired. Information associated with each user out of a set of users can be acquired. A respective video quality level for each user can be determined based on at least one of the information associated with each user or the one or more social engagement signals.
US10212468B1

An online system presents content items to a group of users who provide ratings for the content items. Based on ratings received from various users of the group, the online system generates data describing presentation of the content items to users of the group. Because of a limited number of users in the group, the online system enforces rules that limit the ability to show content items to users of the group within a time interval. Accordingly, when a set of content items are selected for presentation to a user of the group, the online system replaces content items of the set that were previously shown to the user within the time interval with alternative content items. The online system also retrieves a previously received rating for a content item replaced by an alternative content item to use along with ratings received for content items of the set.
US10212462B2

An integrated intelligent server based system includes at least one autonomous system containing one or more analytical server for unified multiple sensory data mapped multi-modal or multi-sensory imagery analysis, generating analysis result and streaming of the sensory data with the generated analysis result to the receiver module. A fail safe and fault tolerant technique to generate, store and stream the multi-sensory images to the receiver module is also proposed. Once received, the receiver module extracts the sensory data and the results of the sensory data analysis from the image and video using a suitable decoder. The integrated intelligent server based system would enable embedding the results of the sensory data analysis within the image itself and streaming the multi-sensory image embedded with the results of said sensory data analysis to a receiver module. This results in adopting this new concept in Internet of Things scheme of activities as well.
US10212452B2

An apparatus for decoding an image, the apparatus including an entropy decoder configured to extract an intra prediction mode of a current block, and an intra prediction performer configured to determine a number of neighboring pixels located on a left side of the current block or an upper side of the current block, determine a location of one or more neighboring pixels, the intra prediction mode indicating a particular direction among a plurality of directions, the particular direction being indicated by using one of a dx number in a horizontal direction and a fixed number in a vertical direction, and the location of the one or more neighboring pixels being determined based on a shift operation.
US10212446B2

The present disclosure relates to image processing device and method that can suppress the deterioration in encoding efficiency.An image processing device includes: a reception unit that receives encoded data in which an image with a plurality of main layers is encoded, and inter-layer prediction control information controlling whether to perform inter-layer prediction, which is prediction between the plurality of main layers, with the use of a sublayer; and a decoding unit that decodes each main layer of the encoded data received by the reception unit by performing the inter-layer prediction on only the sublayer specified by the inter-layer prediction control information received by the reception unit. The present disclosure can be applied to, for example, an image processing device.
US10212445B2

According to techniques of this disclosure, a video decoder can be configured to, for one or more blocks coded with wavefront parallel processing enabled, determine a coding tree block (CTB) delay, wherein the CTB delay identifies a delay between when a first row of CTBs starts being decoded and when a second row of CTBs below the first row of CTBs starts being decoded; for a current block of video data coded in an intra-block copy (IBC) mode and coded with wavefront parallel processing disabled, determine an IBC prediction region for the current block within a picture that includes the current block based on the CTB delay that was determined for the one or more blocks coded with wavefront parallel processing enabled; identify, from within the determined IBC prediction region for the current block, a predictive block for the current block; and IBC decode the current block based on the predictive block.
US10212443B2

One embodiment provides for a general-purpose graphics processor comprising a multisample antialiasing compression module to perform planar multi-sample anti-aliasing, the multisample antialiasing compression module to analyze color data for a set of sample locations of a first pixel; determine a first plane to allocate for the first pixel, wherein the first plane is a lowest order plane to be allocated for the first pixel; and merge a plane allocation for the first pixel with a plane allocation for a second pixel in response to a determination that the first plane is the lowest order plane to be allocated for the second pixel.
US10212437B2

An apparatus configured to code video information includes a memory and a processor in communication with the memory. The memory is configured to store video information associated with a reference layer and an enhancement layer, the reference layer associated with a reference layer (RL) codec and the enhancement layer associated an enhancement layer (EL) codec. The processor is configured to determine whether the RL codec associated with the reference layer is a particular type of codec, and in response to determining that the RL codec is a particular type of codec, process, in a video bitstream, an indication that motion information of the reference layer cannot be used to code the enhancement layer. The processor may encode or decode the video information.
US10212434B2

A device for coding video data includes a memory storing video data and a video coder including one or more processors configured to determine a current coding unit of the video data is coded in a palette mode; determine a palette for the coding unit by, for a first entry of the palette, choosing a predictor sample from a reconstructed neighboring block of the coding unit and coding a difference between one or more color values of the first entry and one or more color values of the predictor sample.
US10212431B2

An image encoding method including: a constraint information generating step of generating tile constraint information indicating whether or not there is a constraint in filtering on boundaries between adjacent tiles among a plurality of tiles obtained by dividing a picture, and storing the tile constraint information into a sequence parameter set; and a filter information generating step of generating, for each of the boundaries, one of a plurality of filter information items respectively indicating whether or not filtering is executed on the boundaries, and storing the plurality of filter information items into a plurality of picture parameter sets, wherein, in the filter information generating step, the plurality of filter information items which indicate identical content are generated when the tile constraint information indicates that there is the constraint in the filtering.
US10212426B2

Coefficient coding for transform units (TUs) during high efficiency video coding (HEVC), and similar standards, toward simplifying design while enhancing efficiency. Elements of the invention include coefficient coding for TUs with up-right diagonal scans being modified, and selectively applying multi-level significance map coding.
US10212423B2

An image processing apparatus and a method for improving the coding efficiency for a quantization parameter are provided. The method includes steps of setting a predicted quantization parameter for a current coding unit by using multiple quantization parameters which are set for multiple surrounding coding units located around the current coding unit which is target of coding processing, and setting a difference quantization parameter indicating a difference value between the quantization parameter which is set for the current coding unit and the predicted quantization parameter.
US10212400B2

A controller for a work vehicle includes a processor and a memory device communicatively coupled to the processor. The memory device stores instructions that cause the processor to receive a first signal from an image capturing device, such that the first signal is indicative of image data associated with an environment of the work vehicle. Furthermore, the memory device stores instructions that may cause the processor to associate the first signal with a corresponding position of the work vehicle to generate a video log in response to a triggering event, such that the video log has a duration between a first time and a second time, and the triggering event includes a command to stop the work vehicle, a command to start a mission, a command to end a mission, a user input to override an autonomous command, a user input to override a highly automated command, detection of an obstacle, or any combination thereof.
US10212399B2

An wearable device and a system for controlling the same are provided. The wearable device is connected to a user biometric state measurement device to capture an image of a certain place or situation, and the system remotely controls the wearable device and the user biometric state measurement device in real time.
US10212394B2

A signal processing apparatus for obtaining a correlation between an A-image signal and a B-image signal which are output from an image pickup unit to be input and calculating a defocus amount includes: a near-in-focus detection unit for detecting a pixel signal in an in-focus state between the A- and B-image signals; and a correlation operation unit for operating a correlation between the A- and B-image signals, wherein the correlation operation unit has a mode for excluding the detected pixel signal in the in-focus state from a subject of the correlation operation in accordance with a detection result of the near-in-focus detection unit.
US10212393B2

An aircraft in-flight entertainment (IFE) system includes an entertainment source, passenger seatback displays coupled to the entertainment source, and passenger control units. Each PCU is associated with a respective seatback display and includes a touchpad configured to recognize multiple simultaneous touch points.
US10212392B2

The present disclosure is directed to a passive, enhanced MoCA entry device. The entry device includes an entry port, a broadband port, high-band ports, and a filter device. The entry device also includes a broadband path connecting the entry port to the broadband port and a high-band path connecting the entry port to the plurality of high-band ports. The filter device generates a broadband signal and a high-band signal. The filter device provides the broadband signal to broadband port via the broadband path. And, the filter device provides the high-band signal to the high-band ports via the high-band path.
US10212387B2

There are described methods and apparatus for scrambling digital content, such as video or audio content, by dividing the digital content into blocks set out in an original arrangement, and reordering the blocks from the original arrangement to a scrambled arrangement. Additional manipulation transforms such as rotations and reflections may be applied to individual blocks. A subsequent compression step may then be carried out. Methods and apparatus for carrying out corresponding descrambling of digital content are also described.
US10212384B2

A system and method of entering a low power mode includes an external tuner module having a first external tuner and a receiving device having a first receiving tuner. The receiving device has a controller determining an unused tuner from one of the first external tuner or first receiving tuner and controls entering a low power mode at the unused tuner.
US10212378B2

An image capturing apparatus is provided with a pixel array that has a plurality of image forming pixels and a plurality of focus detection pixels, a readout unit that reads out a pixel signal from the pixel array, an A/D conversion unit that has a first mode for A/D converting the pixel signal read out by the readout unit with a first resolution and a second mode for A/D converting the pixel signal read out by the readout unit with a second resolution that is higher than the first resolution, and a control unit that switches between the first mode and the second mode in accordance with the pixel signal read out from the pixel array.
US10212375B2

An analog-to-digital converter includes a comparator, a switch, and a counter circuit. The comparator is configured to generate a comparison signal by comparing an analog signal received through a first signal line and a reference signal received through a second signal line. The switch is coupled between the first signal line and the comparator. The switch is open before the analog signal is applied to the first signal line to disconnect the first signal line from the comparator, and is closed after the analog signal is applied to the first signal line to provide the analog signal to the comparator. The counter circuit is configured to generate a digital signal corresponding to the analog signal by performing a count operation in synchronization with a count clock signal based on the comparison signal.
US10212360B2

An actuator of a camera module including a magnet, a driving coil facing the magnet, a driving apparatus including a driving circuit configured to apply a driving signal to the driving coil to move the magnet, and a position calculator configured to generate a feedback signal based on a current position of the magnet, wherein the driving apparatus is further configured to calculate an error value by comparing an input signal with the feedback signal, and to determine a control gain of a control signal provided to the driving circuit according to the error value, and wherein the control gain is reduced in response to an increase in the error value, and the control gain is increased in response to a decrease in the error value.
US10212355B2

An apparatus, system, and method for dual mode imaging under different lighting conditions. A sensor is configured to image a target. A dual-mode illumination source is configured to illuminate the target while the sensor images the target. The dual-mode illumination source is configured to illuminate the target using a first wavelength of light under a first lighting condition and to illuminate the target using a second wavelength of light under a second lighting condition. The system may be used in an optical tracking system to track the motion of an object.
US10212346B2

An aerial vehicle may include a first sensor, such as a digital camera, having a lens or other component that includes a second sensor mounted thereto. Information or data, such as digital images, captured using the second sensor may be used to determine or predict motion of the lens, which may include components of translational and/or rotational motion. Once the motion of the lens has been determined or predicted, such motion may be used to stabilize information or data, such as digital images, captured using the first sensor, according to optical or digital stabilization techniques. Where operations of the first sensor and the second sensor are synchronized, motion of the second sensor may be modeled based on information or data captured thereby, and imputed to the first sensor.
US10212338B2

In general, techniques of this disclosure may enable a computing device to capture one or more images based on a natural language user input. The computing device, while operating in an image capture mode, receive an indication of a natural language user input associated with an image capture command. The computing device determines, based on the image capture command, a visual token to be included in one or more images to be captured by the camera. The computing device locates the visual token within an image preview output by the computing device while operating in the image capture mode. The computing device captures one or more images of the visual token.
US10212313B2

A data processing device includes first and second timing signal generators, a phase difference control unit, first and second output units, a data generating unit, a data generating unit, and an error determination unit. The phase difference control unit controls a phase difference between the first and second timing signals to be a predetermined phase difference. The first output unit outputs a first data at a timing based on the first timing signal. The data generating unit generates a second data by a prescribed unit based on the first data. The second output unit outputs the second data by the prescribed unit at a timing based on the second timing signal. The error determination unit determines there is an error when an Nth unit of the second data has not been generated at a timing at which the Nth unit of the second data is to be output.
US10212312B2

Methods of image calibration and in particular of image calibration having a multiple of color scales as well as to quantitative imaging such as quantitative medical imaging, or to a display device or to a system for displaying an image, or to a controller of a display, or to software to enable the image calibration, or to a visualization application and a display. The method for processing an image, includes the steps of: —selecting at least one trajectory in a color space; —defining a transformation which primarily increases perceptual linearity of consecutive points belonging to the at least one trajectory; —applying the transformation to the image. This has the advantage that the perceptual linearity can be restricted to the trajectory.
US10212307B2

Provided is a data transmission system that accurately performs transmitting and receiving of job data. A cloud server transmits job data, a vibration-detection sensor of a gateway detects vibration that is applied to the gateway, a vibration-detection sensor of an MFP detects vibration that is applied to the MFP, the gateway stores job data that is received from the cloud server in memory of the gateway, and then transmits the job data to the MFP. Moreover, the gateway, when the value of vibration-detection data of the vibration-detection sensor is equal to or less than a specified threshold value, stores the job data from the cloud server in memory, and when the value of vibration-detection data of the vibration-detection sensor equal to or less than a specified vale, transmits the job data that is stored in memory to the MFP.
US10212293B2

An information processing device includes a touchscreen that includes a first surface that outputs images and detects an input to the first surface, a sensor that detects whether a switching device is mounted an the touchscreen, and processing circuitry. The processing circuitry is configured to control a display state of the touchscreen based on a detection result of the sensor so that the touchscreen outputs in a first display mode when the switching device is not mounted on the touchscreen, and the touchscreen outputs in a second display mode when the switching device is mounted on the touchscreen.
US10212292B2

Generally, a job management apparatus of the present embodiment which sends a print job to an image forming apparatus comprises a communication section and a controller. The communication section communicates with the image forming apparatus and a delivery apparatus configured to deliver a sheet printed by the image forming apparatus to a delivery destination. The controller calculates printing time relating to completion of execution of the print job by the image forming apparatus and first arrival time when the delivery apparatus reaches the image forming apparatus and enables the image forming apparatus to execute the print job at a timing when the image forming apparatus can complete the execution of the print job by the first arrival time.
US10212282B2

Systems and methods for clustering emergency services routing proxies are provided. The described features allow a group of ESRPs running as individual servers or a group of virtual servers, to be referenced using a single URI. In one implementation, an emergency services routing proxy device includes an emergency services routing proxy node configured to route a call to a downstream entity, the call received from an upstream entity. The device further includes a cluster manager configured to receive registration information from the emergency services routing proxy node, the registration information including a routing service identifier. The cluster manager may be further configured to identify the emergency services routing proxy node for call routing based on a comparison of an identifier included in the call with the routing service identifier.
US10212281B2

A call center answers calls from callers reporting incidents and dispatch responders in response thereto. A computing system at the call center receives a particular call from a caller regarding a particular incident, and determines whether the particular call is an original call that is reporting the particular incident for a first time to the call center, or is a repetitive call that is reporting the particular incident after the original call for the particular incident has already been received by the call center. If an original call, the computing system forwards the particular call to an agent at the call center for further attention. However, if a repetitive call, the computing system diverts the particular call from the agent at the call center. Accordingly, the resources of the call center may be concentrated on original calls and away from repetitive calls.
US10212277B2

A phone frauds or scams detecting system comprises a first detecting unit for obtaining callers' characteristics and a second detecting unit for interacting with callers and obtaining callers' additional characteristics. The system determines frauds or scams based on the callers' characteristics and the callers' additional characteristics and plays commercial advertisements to the callers if one or many frauds or scams determined.
US10212275B2

A system and method for communicating presence information that can include at a first server of a communication platform, receiving an authorization token of a first client application; verifying at least one permission associated with the authorization token; registering a presence status of the first client application upon verifying the at least one permission of the authorization token; at a second server of the communication platform, accepting an incoming communication request; retrieving communication instructions according to the incoming communication request; identifying an instruction to communicate with a communication destination of the first client application; accessing the presence status resource of the first client application; establishing communication with the first client application according to the accessed presence status resource.
US10212253B2

Among other things, embodiments of the present disclosure discussed herein may be used to analyze the online social network profiles of users of the social network and generate customized summaries of the profiles. Among other things, the embodiments of the present disclosure help quickly and efficiently generate an intuitive and personalized summary of a user's profile, even where a user's profile contains a relatively lengthy amount of content.
US10212244B2

An information push method includes: an information push server determining recommendation information that currently needs to be pushed to a target user; the information push server obtaining setup information of the target user, where the setup information includes personalized graphic information preset by the target user; the information push server generating, according to the setup information of the target user, a personalized two-dimensional code that bears the recommendation information, where an image of the personalized two-dimensional code carries the personalized graphic information preset by the target user; and the information push server pushing the personalized two-dimensional code to the target user. By using the present disclosure, a click-through rate and conversion rate that a two-dimensional code pushed on the Internet has from a user can be improved.
US10212238B2

Aspects of the present disclosure involve systems, methods, computer program products, and the like, for managing the distribution of content from a content distribution network (CDN). In general, the system receives a request for content from the CDN from a user of the network and determines a server within the CDN to provide the content to the user. In addition, the system of the present disclosure may determine a preferred server or group of servers from which the content is provided to the user. This preference may be based on information received from a Border Gateway Protocol feed or Interior Gateway Protocol feed and one or more business determinations, such as the cost of providing the content through the CDN and particular egress port associated with the CDN.
US10212232B2

Aspects of the subject disclosure may include, for example, allocating virtual network function resources for a wireless connection with a gateway device, facilitating establishing the wireless connection with the gateway device utilizing the virtual network function resources to provide for transmitting of data from the gateway device to an application server where the data is stored by the gateway device until a determination is made that a threshold associated with the data has been satisfied, and tearing down the virtual network function resources responsive to a determination that the transmitting of the data from the gateway device to the application server via the wireless connection has been completed. Other embodiments are disclosed.
US10212229B2

A method includes receiving a data object for storage in a storage system. The storage system includes a number of datacenters (s) interconnected by a first network. Each of the datacenters is located in a geographic location that is different than any geographic locations of any other of the datacenters. The method includes creating secondary copies of the data object. A number of secondary copies is equal to at least s−1. The method includes, in accordance with a placement map of at least one of the datacenters, storing a primary copy of the data object in one of the datacenters. The method also includes, in each other of the datacenters, storing at least one of the secondary copies. The method also includes monitoring, via a plurality of data monitors, an accessibility of data stored in the storage system. The data includes the primary copy and the secondary copies of the data objects.
US10212226B2

Systems and methods associated with computing cluster synchronization are disclosed. One example method includes periodically requesting timing values from a set of notes in a computing cluster. The method also includes receiving timing values from members of the set of nodes. The method also includes providing a synchronization value to members of the set of nodes. The synchronization value may be generated based on the timing values. Additionally, the synchronization value may be used to order events across the members.
US10212223B2

Overlay networks of application components are managed. Applicant components may create overlay networks based on policies of the application components and an environment of the overlay network. The overlay network may be adjusted based on changes to the policies or the environment.
US10212221B2

A solution for running a software application on a computing machine is provided, which includes registering a capability of a delegation component to execute at least one action on the computing machine, each one defined by at least one characteristic thereof, receiving a request for executing the at least one action from the software application by the delegation component, the request being bound to the delegation component at run-time according to the capability registration thereof, and delegating, by the delegation component, the execution of the at least one action to at least one local component of the computing machine being capable of executing at least part of the at least one action and/or to at least one remote component of at least one remote computing machine being capable of executing at least part of the at least one action according to an availability of the at least one local component.
US10212216B2

The present invention relates to a network controlling apparatus including a node status sensing unit configured to sense at least one node operating at least two centers, a center module configured to define at least two closed curves having a common internal area without intersecting each other, to define a first area as the common internal area of the at least two closed curves and a second area as a space between the at least two closed curves and to display the at least two centers in the second area by dividing the at least two centers with a division line connecting the at least two closed curves in the second area; a connection module configured to display a connection line indicating a connection status of the at least one node; and a UI display unit configured to display the lines provided by the center module and the connection module.
US10212209B2

Techniques for metadata-driven dynamic content serving. Metadata content is stored as a source instance. The metadata content is utilized to provide dynamically-constructed pages. The metadata content is published to runtime pods communicatively coupled to receive the metadata content. The source instance includes a metadata definition repository and is a primary source of dynamic data for serving pages in the runtime pods. The runtime pods are groups of multiple servers that act as a single entity to dynamically generate metadata-driven content in response to requests received from client devices. A request for content is received with a selected one of the runtime pods for a specific site. The specific site is mapped to a user identified by a user identifier. The user identifier is utilized to retrieve site metadata from a site metadata server. Content is provided in response to the request with the selected runtime pod utilizing the metadata content.
US10212204B2

Systems and methods are disclosed for improving transmission of media data contained in data packets in a media session established over a network. According to certain embodiments, a first server can determine that at least one media quality metric associated with the media session is below one or more pre-determined thresholds, the at least one media quality metric being indicative of a media quality. The first server can also obtain identification information associated with the media session, provide the identification information to a second server, receive, from the second server data, related to a transmission of data packets, and media data contained in the data packets. The first server can determine configurations based on the received data related to a transmission of data packets. At least one of the first and second servers can be configured based on the determined configurations to provide a pre-determined media quality.
US10212200B1

Various embodiments of the invention provide methods, systems, and computer program products for handling an audio path failure and/or non-conformant QoS for a call between a contact center agent and remote party. Specifically, an audio path is established to a first telephony device being used by the agent and a call is bridged onto the audio path so that audio can be streamed back-and-forth between the first telephony device and a second telephony device being used by the party. Accordingly, various embodiments of the invention involve monitoring the audio path to detect an audio path failure and/or non-conformant QoS for the audio and bridging the call onto a second audio path when a failure or non-conformant QoS is detected so that the call is not disconnected from the second telephony device and a third device (e.g., IVR) can stream audio over the second audio path to the second telephony device.
US10212199B2

An architecture that can facilitate initiation of an automatic synchronization operation based upon presence information in connection with a wireless communications network is provided. For example, when certain mobile devices register with a particular network entity (e.g., a femtocell) that services a particular target location (e.g., place of residence), then such registration can be leveraged to indicate presence at the target location. Accordingly, synchronization between the mobile device and other devices can be automatically initiated, without requiring input or effort by a user, or even that the user remembers to perform the synchronization operation. Moreover, the synchronization operation can be wireless, so connection cables need not be maintained or employed.
US10212198B1

The present invention is directed towards a communication node, a system, and a method for dynamically switching a first codec to a second codec for a communication session. The communication node, to implement the method, can be operably connected to communication endpoints, a codec database, at least one second communication node, and a destination node. The communication node monitors the network within which the communication session originates to detect if a network event has occurred, and if detected, obtain the catalog of available and supported codecs. The communication node then selects a second codec from the catalog of available and supported codecs to replace the first codec, based at least in part on a prioritization of the catalog of available and supported codecs, the network event, a session type, a session criteria, and predetermined routing information for the communication session. Thereafter, the first communication node generates a network message, which directs at least one second communication node to switch from the first codec to the second codec, and transmits the communication session with the network message thereto. The at least one second communication node, upon receiving, replaces the first codec with the second codec by a modification of at least one signaling protocol. If the destination node is unable to accept the communication session using the second codec, the at least one second communication node can generate a network message to direct an at least one third communication node to replace the second codec with the first codec before delivery.
US10212190B2

A cloud infrastructure is enhanced to provide a context-based security assurance service to enable secure application deployment. The service inspects network and cloud topologies to identify potential security capabilities and needs. Preferably, these options are then surfaced to the user with easy-to-understand, pre-configured templates representing security assurance levels. When a template (e.g., representing a pre-configured assurance level) is selected by the user, the system then applies specific capabilities and controls to translate the user-selected generalized specification (e.g., “high security”) into granular requirements for a specific set of security resources. Preferably, the identification of these security resources is based on system configuration, administration, and information associated with the pre-configured template.
US10212183B2

An information processing apparatus which is capable of preventing unauthorized access thereto. The information processing apparatus is capable of communicating with a server. An inquiry is made of the server about an IP address of the information processing apparatus, which is managed by the server. When it is determined that the IP address obtained from the server as a result of the inquiry and an IP address stored in the information processing apparatus match each other, a warning that a security level of the information processing apparatus is low is issued.
US10212179B2

A method for checking security of a URL for a mobile terminal includes: receiving a URL security check request sent by a mobile terminal, where the URL security check request includes a URL; determining, through querying, whether there is security information corresponding to the URL; downloading, if there is no security information corresponding to the URL and the URL is a mobile application program download URL, a mobile application program corresponding to the URL; checking security of the mobile application program; and correspondingly storing the security information obtained through checking and the URL.
US10212173B2

Computer systems and methods for improving security or performance of one or more client computers interacting with a plurality of server computers. In an embodiment, a computer system comprises a first server computer and a second server computer; wherein the first server computer is configured to: generate a challenge nonce, wherein the challenge nonce corresponds to a challenge state; generate the challenge state based on the challenge nonce, wherein the challenge state corresponds to a response state; send, to a first client computer, the challenge nonce and the challenge state, but not the response state; wherein the second server computer is configured to: receive, from the first client computer, a test nonce and a test response state; determine whether the test response state matches the response state based on the test nonce, without: receiving the challenge state from the first server computer; receiving the challenge state from the first client computer.
US10212172B2

A data access method based on a cloud computing platform, and a user terminal, are provided. The method is performed by a user terminal, and the method includes obtaining an access request for a data ciphertext of the cloud computing platform, the access request including a decryption key, and the decryption key including a user precise identity identifier and a user attribute identifier. The method further includes decrypting the data ciphertext into a data plaintext, in response to the user precise identity identifier belonging to an identity identifier set included in an access structure of the data ciphertext and/or in response to the user attribute identifier belonging to a user attribute identifier set included in the access structure of the data ciphertext.
US10212168B2

An electronic device and a control method thereof are provided. The control method for the electronic device includes: acquiring a call instruction; calling a target application to acquire collection data; acquiring a security label, in a case that the target application operates in a first operating mode; storing the acquired collection data based on the security label, as a collection data with the security label, wherein the collection data with the security label is in an accessible state when a first access authority is met.
US10212163B1

To provide increased security in Wi-Fi enabled client devices, Media Access Control (MAC) address of a client device may have to be entered manually in a hotspot device which may increase complexity. A method and apparatus are disclosed in which a first client device, referred as Admin client device, may be authenticated by provisioning the MAC address of the client device in a hotspot device. When a new client device is connected with hotspot device, the hotspot device may send MAC address of the new client device to Admin client device. The Admin client device may prompt the device authentication request with MAC address of a new client device. If the user authenticates the request, MAC address of the new client device may be authenticated and internet access may be provided to the new client device. With this method, connection establishment of new client devices is simplified with increased security.
US10212157B2

An augmented reality system that includes an augmented reality user device for a first person including a head-mounted display configured to overlay virtual objects onto tangible objects in real-time, a memory, a camera, and one or more processors. The augmented reality user device is configured to perform facial recognition on the captured image to identify a face of the second person, to identify an entry for the second person, and to initiate a peer-to-peer transfer when the entry for the second person has been identified. The augmented reality user device is further configured to authenticate the identify of the second person, to generate a transfer token for facilitating the peer-to-peer transfer, and to send the transfer token to a first institution associated with the first person to initiate the peer-to-peer transfer. A network device of the first institution is configured to receive the transfer token and facilitate the peer-to-peer transfer.
US10212144B2

Methods and systems are provided for sending messages in a security system. In particular, a new message syntax can include one or more positive assertions that may be verified. The receiver of the message or credential may verify all the positive assertions. In other configurations, one or more nodes that relay the message from the sender to the receiver can verify the positive assertions or may create one or more of the positive assertions. In this way, the network or entities used to relay the message can also be checked.
US10212142B2

A method of establishing a network by sharing a secret between a first entity (A) and a second entity (B), comprising the steps of: the first entity (A) broadcasting (100) an ANNOUNCE message announcing its identity and details of other entities it is aware of, wherein each of the other entities of which it is aware is associated with a particular nonce, and the message is encrypted using a broadcast encryption scheme common to the first and second entities (A,B), and; the second entity (B), upon receiving and decrypting the ANNOUNCE message, transmitting (110) to the first entity (A) a SHARE message, wherein the SHARE message comprises a signcryption of the secret, authenticated using signcryption data associated with the particular nonce associated with the second entity (B).
US10212130B1

Methods and apparatus are described for detecting browser extensions. Specific implementations relate to configurable security policies and automated actions performed in response to the detection of browser extensions.
US10212122B2

A method performed by a physical computing system includes, with a first virtual entity manager of a first host machine, detecting an Address Resolution Protocol (ARP) request from a first virtual entity supported by the first virtual entity manager to a second virtual entity having a first logical address within a fan network. The method further includes, with the first virtual entity manager, translating the first logical address to a second logical address and transmitting the ARP request to a second host machine using a physical address resolved from the second logical address, the second host machine supporting the second virtual entity. The method further includes receiving a response to the ARP request, the response including a virtualized physical address of the second virtual entity. The method further includes with the first virtual entity manager, forwarding a data packet from the first virtual entity to the virtualized physical address.
US10212118B2

Notifying a user about a previous conversation includes based on an analysis of the previous conversation between a first user and second user determining a characterization between the first user and the second user, in response to the first user selecting, via a user device, an option to open a subsequent conversation with the second user, notifying the first user via an alert as to the characterization of the previous conversation that the first user had with the second user before reengaging the second user in a subsequent conversation, and based on an analysis of the subsequent conversation between the first user and the second user, updating the characterization to a current characterization in a database.
US10212115B2

A system may detect multiple accesses of an engagement interface from a user. The multiple accesses may include a first group of accesses performed by a first device and a second group of accesses performed by a second device. Both the first device and the second device may correspond to the user. A message may be selected from a set of messages. Moreover, the message may correspond to the engagement interface. The system may identify the first group of accesses as having a greater amount of user interaction with the engagement interface than the second group of accesses. The system may then determine that the selected message has the greatest likelihood of being read on the first device. The selected message may be communicated to the first device based on the determination.
US10212108B2

A system includes a memory configured to store computer-readable instructions; and one or more processors configured to execute the computer-readable instructions such that the one or more processors are configured to, receive a message from a first electronic device connected to a communication session for an instant messaging service, determine hidden attribute information for playing content corresponding to a keyword using the keyword further included in the message, if the message includes a desired character, add the determined hidden attribute information to the message, and transmit the message to which the hidden attribute information is added, to a second electronic device connected to the communication session through the communication session.
US10212102B2

During path switching between sidelink (SL) and uplink (UL) for vehicle-to-everything (V2X) message transmission, a path switching layer of a user equipment (UE), which may be located right above a packet data convergence protocol (PDCP) layer of the UE, stores a vehicle-to-everything (V2X) message, which is not transmitted yet on an old path, in a transmission buffer. And then, the path switching layer of the UE re-submits the V2X message stored in the transmission buffer to a lower layer of a new path.
US10212101B2

A network fabric application coupled to a data link layer is provided with access to network elements in an optical fiber network. The network fabric application defines a network fabric configuration comprising at least a subset of the network elements, wherein the network fabric forms a multi-path communication network among the subset. The network fabric is configured to transmit data among networked devices in the network fabric along the multi-path communication network.
US10212100B2

A method includes iteratively executing, by a computer, a scheduling process computing an allocation of wireless access network data rate to each link between an Access point and a User Equipment within a coverage area of the Access Point, and a routing process computing an allocation of wired network resources to each wired link between the Access Point and nodes of a wired network. The scheduling and routing processes are independent of each other. At each iteration, information of the allocated wireless access network data rate is passed to the routing process; and information of the aggregate allocated data rate for each service at the Access Point is passed to the scheduling process.
US10212093B2

A method, apparatus and computer program product are provided for sub-service flow based mapping in a cellular communication system. A sub-service flow User-plane interface between an Enforcement Point and a network control system (NCS) is defined. Relation and coordination of the sub-service flow User-plane interface associated with sub-service flow management actions on a Control-plane interface is defined. In-band packet marking is created to dynamically assist the identification of sub-service flow identities and receive corresponding quality of service (QoS)/quality of experience (QoE) treatments.
US10212082B2

In one embodiment, packets are forwarded in a network based on lookup results in a content-addressable memory that includes multiple blocks of content-addressable memory entries, with the relative priority of these blocks typically determined on a per search basis. In one embodiment, the content-addressable memory blocks perform lookup operations based on a search key resulting in a lookup results. The result determiner determines an overall highest-priority content-addressable memory lookup result based on ordering the lookup results according to a dynamic priority ordering (e.g., retrieved from storage) among the content-addressable memory blocks. One embodiment allows multiple searches to occur simultaneously among the content-addressable memory blocks by selectively performing lookup operations on multiple search keys. One embodiment weights such lookup operations to initially assign search keys to content-addressable memory block(s) with a corresponding higher-priority, and if a match is found, other content-addressable memory block(s) will not need to be searched.
US10212073B2

Aspects of the present disclosure involve systems, methods, computer program products, and the like, for collaboration conferencing with multiple participants over a communications network, and more specifically for a conferencing routing service for managing and routing collaboration participants.
US10212070B2

A technique for discovering and identifying locations at which to deploy new Layer-2 nodes within a telecommunications network. The disclosed technique is intended to identify Layer-2 nodes at locations where they can improve service availability when deployed, especially in geographic regions that suffer frequent or simultaneous cable breaks, or both. The locations of the new Layer-2 nodes depend on the underlying Layer-0 network topology, as well as on the existing Layer-2 topology. Thus, the disclosed technique features a cross-layer approach that takes these factors into account and evaluates the locations in a way that can considerably increase the availability of one or more services offered in the telecommunications network.
US10212066B1

A speech-based system is configured to use its audio-based user interface to present various types of device status information such as wireless signal strengths, communication parameters, battery levels, and so forth. In described embodiments, the system is configured to understand spoken user requests for device and system status. For example, the user may speak a request to obtain the current wireless signal strength of the speech-based system. The speech-based system may respond by determining the signal strength and by playing speech or other sound informing the user of the signal strength. Furthermore, the system may monitor operational parameters to detect conditions that may degrade the user experience, and may report such conditions using generated speech or other sounds.
US10212053B2

A method for offering a set of services is disclosed. The method may comprise storing, by a cloud infrastructure system, subscription order information identifying a service from a set of services provided by the cloud infrastructure system, the cloud infrastructure system comprising one or more computing devices. A computing device from the one or more computing devices may determine a service declaration for the service, the service declaration comprising information indicative of procedures for provisioning resources for enabling the service. A computing device from the one or more computing devices may cause the service to be provisioned based on the service declaration.
US10212039B1

A management server communicates with an authentication server that authenticates endpoints, which are configured to connect wirelessly with access points (APs) controlled by respective ones of a plurality of controllers. Weights for the APs and the controllers are stored. Event logs detailing requests for authentication of the endpoints are received. For each request, roaming conditions for the endpoint that triggered the request are determined. Also, a respective weight of one or more of the AP connected with the endpoint and of the controller that controls the AP is increased by a respective amount depending on whether the roaming conditions are caused by the AP and the controller being improperly configured or properly configured. Identities of ones of the APs and the controllers having weights that exceed one or more weight thresholds each indicative of an improperly configured AP or controller are stored.
US10212036B2

Provided is a performance testing method, a system and a storage medium for the same. The method may include determining test object metadata that defines a protocol for a test object and test job metadata that defines a performance test using a prescribed job, generating job data based on the test job metadata, generating load data according to the prescribed job to provide the load data to at least one test performing node among a plurality of test performing nodes coupled to the test object, and causing the at least one test performing node to perform the performance test for the test object.
US10212029B2

Techniques for provisioning cloud services in cloud computing systems are disclosed herein. In one embodiment, a method can include providing a user portal configured to communicate with a deployment application configured by a user for provisioning cloud services in the cloud computing system. The method can also include receiving a notification from the user-configured deployment application that a provisioning process is initiated for a cloud service in the cloud computing system. In response to receiving the notification, the method can include assigning a distinct provisioning identifier to the initiated provisioning process associated with the notification and causing an output field associated with the distinct provisioning identifier to be displayed on the user portal. Subsequently, messages of status updates can be forwarded to the status display according to the assigned distinct provisioning identifier.
US10212028B1

Disclosed is a method and system for controlling air interface communication in a wireless communication system that supports multiple TDD configurations. In a disclosed example, a base station's cell is initially configured to operate with a particular TDD configuration. The base station then detects a trigger to reduce uplink latency in the cell, such as by detecting a threshold number of devices being served with latency-sensitive communication such as voice-over-packet communication. And the base station responsively reconfigures the cell to operate with a different TDD configuration having lower uplink latency, where uplink latency of each TDD configuration is based average wait to uplink subframe of the TDD configuration.
US10212024B2

Various embodiments are generally directed to systems for multi-stage measurement data analysis (MMDA), such as for evaluation and/or validation of data received from a measurement device, for instance. Some embodiments are particularly directed to a MMDA system that utilizes event stream processing (ESP) to provide near real-time validation of measurement data, at least in part, by detecting losses in the measurement data. In many embodiments, the MMDA system may detect technical losses (e.g., due to equipment malfunction) and/or non-technical losses (e.g., due to compromised equipment). For example, the MMDA system may receive measurement data generated by an electrical meter and determine the electrical meter is malfunctioning by detecting a technical loss in the measurement data. In many embodiments, the MMDA system may utilize both direct and indirect measurement data transmitted via separate communication paths to provide near real-time validation of measurement data.
US10212018B2

Certain features relate to a telecommunications system with a modular frequency combiner combining multiple received signals at different frequency bands without using frequency-dependent multiplexers. The frequency combiner can include adjustable tuning elements for adjusting various signal-processing parameters of the frequency combiner while the frequency combiner is in the telecommunications system. For example, adjustable tuning elements can adjust the phases of phase shifters of each RF path so that the RF paths are matched for combining the received signals and outputting them through an output port. The adjustable tuning elements can also adjust the electrical length or physical length of the transmission lines that carry the received signals. The adjustable tuning elements can be adjusted manually or automatically while the frequency combiner is deployed in the field in the telecommunications system.
US10212011B2

A wireless device includes a plurality of antenna and a plurality of wireless modules that transmit or receive signals via the plurality of antennas. Each of the plurality of wireless modules includes: a generator that generates a high-frequency signal; and a high-frequency circuit that transmits or receives, based on the generated high-frequency signal, a signal via at least one of the plurality of antennas. The wireless device further includes a controller. The controller obtains, each time the plurality of wireless modules start generation of a plurality of the high-frequency signals, a difference of phases of the plurality of high-frequency signals, and controls, based on the obtained difference, at least one phase of a plurality of signals to be transmitted or received by the plurality of wireless modules.
US10212009B2

In some examples, a binary bit stream of input bits is encoded into a three-amplitude bipolar symbol stream of symbols, the encoding using a coding rule that specifies setting a value of a respective symbol of the symbol stream based on a respective input bit of the binary bit stream and a prior input bit of the binary bit stream that is prior to the respective input bit, the coding rule further specifying that adjacent non-zero pulses keep the same polarity. A radio frequency (RF) carrier signal is modulated using the symbol stream to produce a modulated RF signal.
US10212008B2

An integrated receiver supports adaptive receive equalization. An incoming bit stream is sampled using edge and data clock signals derived from a reference clock signal. A phase detector determines whether the edge and data clock signals are in phase with the incoming data, while some clock recovery circuitry adjusts the edge and data clock signals as required to match their phases to the incoming data. The receiver employs the edge and data samples used to recover the edge and data clock signals to note the locations of zero crossings for one or more selected data patterns. The pattern or patterns may be selected from among those apt to produce the greatest timing error. Equalization settings may then be adjusted to align the zero crossings of the selected data patterns with the recovered edge clock signal.
US10212006B2

A filtering device includes a low-pass filter (LPF), a noise estimation circuit and a first combining circuit. The LPF receives and filters a pre-filtering signal to generate an output signal of the filtering device. The noise estimation circuit estimates an estimated noise signal according to the output signal and the pre-filtering signal. The first combining circuit subtracts the estimated noise signal from an input signal of the filtering device to generate the pre-filtering signal.
US10212003B2

According to one embodiment, an Ethernet communication device is configured to be connected to one or more twisted-pair links, each twisted-pair link having a particular capacity. The Ethernet communication device includes a physical interface transceiver. The physical interface transceiver sets a data transmission rate of the Ethernet communication device based on a total capacity of the twisted-pair links connected to the Ethernet communication device. The physical interface transceiver transmits data over the twisted-pair links connected to the Ethernet communication device at the data transmission rate.
US10211999B2

A building management system comprising an integrated sensor and control system integrated on a single application specific integrated circuit (ASIC). The ASIC combines sensor inputs necessary to monitor ambient light levels, light color, occupation/motion sensors, security sensors, temperature and humidity, barometric pressure, smoke and toxic substance sensors, and a processor to receive the sensor inputs and deliver control output signals to effect changes and make settings to each of the environmental systems that are monitored. The ASIC also provides human interface processing for operator control of each environmental system.
US10211987B2

A system and methods are provided herein for verifying proof of transit of traffic through a plurality of network nodes in a network. In one embodiment, a method is provided in which information is obtained about a packet at a network node in a network. The information includes in-band metadata. Verification information is read from the in-band metadata. The verification information for use in verifying a path of the packet in the network. Updated verification information is generated from the verification information read from the packet. The updated verification information is written to the in-band metadata of the packet, and the packet is forwarded from the network node in the network.
US10211981B2

Disclosed herein is a method for generating a high entropy password using a low entropy password and low-entropy login data comprising supplying the low entropy password to a system comprising a generating client and/or a recovery client; and at least n servers; submitting request data derived, at least in part, from the user's low entropy password, where the request data includes authentication data; engaging in a distributed protocol with at least t servers to generate high-entropy values based on stored cryptographic information and a set of authentication information stored on the at least n servers which is checked against the authentication data provided by the user and/or the generating client and/or a recovery client; and generating the high entropy password.
US10211973B2

The invention relates to a method for transmitting data between a first unit which accumulates data that has been generated with a first frequency and a second unit which requests the accumulated data with a second frequency. The method has the steps of requesting a first total increment and a first value, which represents a time increment belonging to the first total increment, from the first unit, said first total increment being the data content of the accumulated data block provided at the request time in the first unit; generating a second total increment from the first total increment using the first value, the second total increment being the data content of a data block adapted to a nominal time increment of the second frequency; and transmitting the second total increment to the second unit.
US10211971B2

A system or a network may include an optoelectronic module that includes an optical transmitter optically coupled with an optical fiber, and a controller communicatively coupled to the optical transmitter. The controller may be configured to operate the optical transmitter to transmit data signals through the optical fiber. The optoelectronic module may be configured to transmit time synchronization signals through the optical fiber along with the data signals.
US10211967B2

A method for transmitting and receiving a signal by a terminal in a wireless communication system is disclosed in the present invention. More particularly, the method comprises the steps of: receiving an indicator for changing the usage of a specific subframe corresponding to a sub-component carrier from a network; determining whether near-end crosstalk between the sub-component carrier and another component carrier occurs if the usage of the subframe is changed according to the indicator; and transmitting and receiving a signal to and from the network through the sub-component carrier according to the changed usage if it is determined that the near-end crosstalk does not occur.
US10211965B2

An apparatus includes a first transceiver, at least two antennas coupled to the first transceiver to exchange one or more keys and phase data with a second transceiver via a plurality of rounds of phase data exchange, each round including: a first pilot signal sent from a first of the antennas of the first transceiver to the second transceiver, a second pilot signal received from the second transceiver, the second pilot signal modulated using a measured first phase of the first pilot signal, a third pilot signal received from the second transceiver; a fourth pilot signal sent from a second of the antennas of the first transceiver to the second transceiver, the fourth pilot signal modulated using a measured second phase of the third pilot signal, and wherein between the plurality of rounds of phase exchange, the first transceiver perturbs a radio frequency (RF) environment surrounding the at least two antennas.
US10211958B2

A method for transmitting information, a station, and an access point in a MU-MIMO system includes: determining, by a first station, multiple to-be-sent first long training sequences, where the multiple first long training sequences include at least one pilot for phase tracking; and sending, by the first station, the multiple first long training sequences to an access point on multiple symbols, where a second station sends multiple second long training sequences to the access point on the multiple symbols, the multiple second long training sequences include at least one pilot for phase tracking, and a first pilot for phase tracking and a second pilot for phase tracking occupy different time-frequency resources, where the at least one pilot for phase tracking included in the multiple first long training sequences includes the first pilot for phase tracking.
US10211957B2

A simultaneous information and energy transfer method and system with a guard interval signal are provided. The method comprises the steps of generating, by a transmitting terminal, a controllable guard interval signal according to the current energy demand and environment conditions for channel transmission. The system comprises a transmitting terminal configured to generate a controllable guard interval signal. In the system and method, the guard interval time is fully utilized to transfer a guard interval signal with controllable amount of energy, which not only prevents intersymbol interference, but also provides controllable energy signals within the guard interval time at the same time, thus improving the energy transfer performance of the system and reducing the probability that the receiving terminal is unable to operate normally due to energy shortage. The present invention can be widely applied to a variety of simultaneous wireless information and energy transfer systems.
US10211953B2

Certain aspects of the present disclosure relate to methods and apparatus for implementing one or more antenna diversity schemes using communications systems operating according to 5G technologies. For example, techniques and apparatus may be provided for employing Alamouti encoding in a time domain for one or more portions of a plurality of modulated symbols associated with a first signal to be transmitted by a first antenna or a second signal to be transmitted by a second antenna to create a first plurality of encoded symbols or a second plurality of encoded symbols with tone-wise Alamouti in the frequency domain.
US10211951B2

Embodiments of the present invention provide a decoding method and apparatus. The method includes: receiving K user signals by using N subcarriers, where one user signal is carried on at least two subcarriers of the N subcarriers, one subcarrier carries at least two user signals of the K user signals, and 2≤N
US10211950B1

Approaches for recovering one or more media datagrams. A plurality of media datagrams, a plurality of row forward error correction (FEC) datagrams, and a plurality of column FEC datagrams are received. The plurality of media datagrams is logically arranged in rows and columns of media datagrams. Each row FEC datagram corresponds to one of the rows of the media datagrams and each column FEC datagram corresponds to one of the columns of media datagrams. Each received datagram is stored in a buffer. Upon determining that a particular media datagram is missing, it is determined whether a particular row FEC datagram or a particular column FEC datagram covering the particular media datagram has been received and is missing only a single media datagram for which it covers. If so, then, the particular media datagram is recovered using the particular row FEC datagram or the particular column FEC datagram.
US10211949B2

Provided is a receiver which includes at least one processor configured to control or execute: a first Bit-Interleaved Coded Modulation (BICM) decoder configured to generate a first output signal corresponding to an upper layer signal by processing a first input signal which includes a superposition coding signal generated at a transmitter by superimposing the upper layer signal and a lower layer signal; a parity generator configured to generate at least one parity based on a result of the processing of the first input signal by the first BICM decoder; and a second BICM decoder configured to generate a second output signal corresponding to the lower layer signal by processing a second input signal which is generated using the parity generated by the parity generator.
US10211948B2

A new lower density parity check (LDPC) tone mapper is proposed when DCM is applied for a given resource unit (RU) when LDPC is used as the channel control coding. For HE PPDU transmission with DCM, LDPC encoded streams are first modulated by a DCM constellation mapper. The modulated symbols of the lower half of the frequency segment and the modulated symbols of the upper half of the frequency segment are modulated using the same LDPC encoded bits using DCM mapping. The modulated symbols of the lower half of the frequency segment are mapped to lower half of the data subcarriers using DCM LDPC tone mapper. The modulated symbols of the upper half of the frequency segment are mapped to upper half of the data subcarriers using the same DCM LDPC tone mapper. Maximum frequency diversity for DCM can be achieved.
US10211947B2

Inventive concepts relates to a system-on-chip using a dynamic voltage frequency scaling and a method of operating the same. The method of operating the system-on-chip may include learning a correlation between network throughput of a network input/output device receiving data packets and processing performance of a central processing unit processing the data packets, estimating a data transmission rate of the data packets based on a learning result of the correlation, dynamically changing setting information of a dynamic voltage frequency scaling algorithm based on the estimated data transmission rate, and controlling an operation frequency of the central processing unit according to the dynamic voltage frequency scaling algorithm. According to example embodiments of inventive concepts, the dynamic voltage frequency scaling algorithm may dynamically be applied considering the data transmission rate of the data packets being received.
US10211935B2

Methods, apparatus, systems and articles of manufacture to verify radio station watermarking with software defined radios are disclosed. Example apparatus disclosed herein include a notch filter having a bandwidth and a center frequency corresponding to a first radio station broadcast signal, and a software defined radio front-end to downconvert a radio frequency band to a baseband signal, the radio frequency band including a second radio station broadcast signal different from the first radio station broadcast signal. Disclosed example apparatus also include a software defined radio application to tune to a portion of the baseband signal corresponding to the second radio station broadcast signal and to demodulate the portion of the baseband signal to generate audio data corresponding to the second radio station broadcast signal. Disclosed example apparatus further include a watermark decoder to detect a watermark in the audio data corresponding to the second radio station broadcast signal.
US10211931B1

A method of interference cancellation includes the following steps: performing a take-energy operation on a to-be-sent signal at multiple times to generate multiple to-be-sent signal powers; performing a first high-pass operation on the to-be-sent signal powers to generate a to-be-sent high-pass result; performing a second high-pass operation on a received signal to generate a received high-pass result; adjusting multiple filter coefficients according to the to-be-sent high-pass result and the received high-pass result; and generating a recover signal according to the filter coefficients.
US10211927B1

A device of one aspect of the present invention includes a receiver to receive a modulation signal that has been subjected to frequency shift keying division ratio. The receiver includes a first demodulator and a demodulation control signal generator. The demodulation control signal generator includes a first frequency divider, a frequency control signal generator, and an oscillator. The first frequency divider divides a frequency of one of the modulation signal and the demodulation control signal by a first or second reception division ratio. The frequency control signal generator generates a frequency control signal based on a frequency of the other of the modulation signal and the demodulation control signal, and a frequency of the one of the modulation signal and the demodulation control signal obtained by division by the first or second reception division ratio. The oscillator generates the demodulation control signal based on the frequency control signal.
US10211926B2

An apparatus in one embodiment comprises a first stackable transmitter/receiver module. The first stackable transmitter/receiver module comprises a housing having first and second ends and multiple sides between the first and second ends, a first signal connector arranged at the first end of the housing, a second signal connector arranged at the second end of the housing, and one or more sets of interconnects arranged on respective ones of the sides of the housing. The first stackable transmitter/receiver module is configured for mated stacking with one or more additional stackable transmitter/receiver modules via the one or more sets of interconnects. A given one of the sets of interconnects of the first transmitter/receiver module is configured to mate with a corresponding complementary set of interconnects arranged on a side of a housing of one of the additional stackable transmitter/receiver modules when the first and additional modules are stacked.
US10211924B2

An optical transmission device is provided. The optical transmission device is coupled between a first electronic device and a second electronic device, and includes a first optical transceiver module coupled to the first electronic device; a second optical transceiver module coupled to the second electronic device; and first and second optical fibers coupled between the first optical transceiver module and the second optical transceiver module, wherein the second optical transceiver module transmits an optical signal to the first optical transceiver module periodically when the second electronic device is idle for a first predetermined period.
US10211922B2

Systems and Methods for reducing distortion due to bursts of upstream transmission in an HFC CATV network. In some preferred systems, the functionality of an Optical Network Unit (ONU) may occur within a node or amplifier along a direction upstream from a subscriber's home.
US10211920B1

Optical communication systems include optical time domain reflectometers that are coupled to link fibers to determine link fiber lengths. After length measurement, chromatic dispersion associated with the measured length is estimated. In some examples, the estimated chromatic dispersion is compensated. A single OTDR can be used to assess a pair of link fibers coupling first and second network nodes by injecting a probe pulse at a common end of the link fibers or by routing the probe pulses from a remote end of one link fiber into a remote end of a second fiber.
US10211908B2

Provided is a multi-antenna relay device. The multi-antenna relay device having first to n-th (n is a natural number of 2 or more) channel formed between receiving antennas and transmitting antennas corresponding to each other, comprising: first to n-th channel interference cancellation units, respectively, included in a corresponding channel among the first to n-th channels and canceling first to n-th channel interference signals corresponding to signals radiated through the first to n-th channels from signal input into the corresponding channel in real time.
US10211900B2

There is provided beam forming using an antenna array configured to transmit across an angular sector. A first set of virtual antenna ports is determined by a mapping of physical antenna ports of the antenna array, the first set of virtual antenna ports defining a beam pattern. A first set of reference signals for acquiring channel state information is transmitted over the first set of virtual antenna ports. Angular information about a wireless transceiver device receiving the transmitted first set of reference signals is acquired. The beam pattern is adapted based on an accuracy of the angular information and/or the angular information itself.
US10211899B1

Systems and methods are described for detecting interference at an access node. A rate at which packets are unsuccessful received at a wireless device may be monitored, wherein the wireless device is in communication with a cell of an access node. The access node may retransmit one or more unsuccessfully received packets to the wireless device. A retransmission metric for retransmission attempts to the wireless device from the access node may be monitored. And it may be determined that communication between the cell of the access node and the wireless device is experiencing interference from a neighboring cell when the monitored rate and monitored retransmission metric meet the interference criteria.
US10211897B2

The present invention relates to a method for selecting transmitting and receiving antennas in a full-duplex MIMO system based on channel information. An embodiment of the present invention provides a method for selecting antennas in a full-duplex MIMO wireless communication system for communication between a first node and a second node. The method may include: calculating the number of transmitting antennas and the number of receiving antennas at a node i having an Ni number of antennas such that Nc has a maximum value, where Nc represents the number of all possible antenna set candidates, N is a natural number of 2 or higher with Ni being the sum of transmitting antennas and receiving antennas at said node i, and i is 1 or 2; and determining transmitting antennas and receiving antennas at node i in consideration of the transmission rate.
US10211887B2

A receiver of the disclosure includes: a load modulator that transmits an active load modulation signal generated by active load modulation to a reader writer, in response to a carrier signal transmitted from the reader writer; and a controller that determines whether the active load modulation signal has reached the reader writer, and controls the load modulator to retransmit the active load modulation signal, after changing a phase of the active load modulation signal with respect to the carrier signal, in a case where the controller determines that the active load modulation signal has not reached the reader writer.
US10211884B2

A method is for processing a channel analog signal coming from a transmission channel. The method may include converting the channel analog signal into a channel digital signal, and detecting a state of the transmission channel based on the channel digital signal to detect whether the transmission channel is, over an interval of time, one or more of linear and time invariant and linear and cyclostationary.
US10211881B2

Systems and methods for implementing an Energy-Efficient Ethernet (EEE) communication are provided. In some aspects, a method includes identifying an EEE signal configured to be communicated via a first set of wires. The method also includes processing the EEE signal such that the processed EEE signal is configured to be communicated via a second set of wires. The second set of wires including fewer wires than the first set of wires. The method also includes communicating the processed EEE signal via the second set of wires.
Patent Agency Ranking