US10407849B1
There is provided a three vehicle train for the continuous cold in-place recycling of asphalt road surface, the train comprising a first supply vehicle containing both water and asphalt emulsion that is in fluid communication with the remaining vehicles; a second milling vehicle for removing a portion of the topmost layer of the road surface as aggregate and evacuating the aggregate via a system of conveyors to a third vehicle; and a third processing vehicle for screening the aggregate to a proper size, mixing the aggregate with cement, water, and/or asphalt emulsion under computer control into a slurry, and depositing the resulting slurry onto the previously milled asphalt road surface.
US10407846B2
A material transfer vehicle includes a material receiving device that is adapted to receive asphalt paving material, and a receiving conveyor that is operatively attached to the material receiving device. The receiving conveyor is driven by a chain drive assembly and includes a chain tension adjustment assembly. The receiving conveyor is pivotable about a substantially horizontal axis so that it can be moved between a transport configuration in which the material receiving device is raised, an intermediate adjustment configuration, and a working configuration in which the material receiving device is lowered. A housing structure encloses protected components and includes an opening adjacent to the protected components. A combination door and platform is attached to the housing structure and is adapted to be moved between a closed configuration that covers the opening and an open configuration that provides access to the protected components, and also provides a platform on which an operator can stand to access the chain tension adjustment assembly.
US10407843B2
A road paver for paving paving material in a paving direction (a) is provided comprising a machine frame, a driver's platform, a drive motor, a chassis with at least a left travel unit and a right travel unit, a material container arranged at the front of the road paver in the paving direction (a) for receiving paving material, the material container comprising a left container half and a right container half, which each have a container floor, a rising container sidewall and a rising container rear wall, and a longitudinal conveying device configured to transport paving material from the material container to a paving screed arranged at the rear of the road paver in the paving direction.
US10407837B2
Certain pavement systems and methods for paving are suitable for locations containing a generally weak subgrade with a California Bearing Ratio of four (4) or lower. The pavement system includes a first geogrid layer placed directly on the subgrade; a first granular layer upon the first geogrid layer, the first granular layer having a thickness of from 0.5 times to 20 times the aperture distance of the geogrid layer; a first geocell layer upon the first granular layer comprising a geocell and an infill material; and a capping layer over the geocell layer. A second geocell/geogrid layer can be placed beneath the capping layer if desired. An optional surface layer may be applied upon the capping layer if desired. The resulting pavement system provides long-term support for pavements applied over the pavement system.
US10407830B2
A surfactant treated bleached softwood kraft pulp fiber, useful as a starting material in the production of cellulose derivatives including cellulose ether, cellulose esters and viscose, is disclosed. Methods for making the kraft pulp fiber and products made from it are also described.
US10407829B2
The present disclosure relates to an aramid paper for a honeycomb, which is prepared by mixing, with an aramid floc, an aramid pulp having a fiber length equal to or longer than a predetermined length and a fibril development equal to or higher than a predetermined level, at a predetermined ratio, a wholly aromatic aramid paper for an electrical insulation paper having superior paper formation property and thus having uniform electrical insulation property, which is prepared by mixing an aramid pulp having a fines content equal to or higher than a predetermined ratio at a predetermined ratio, a laminated aramid paper having a uniform thermal expansion coefficient, uniform electrical conductivity and uniform thermal conductivity, which is prepared by laminating an aramid paper with superior paper formation property on an aramid paper with superior paper strength by calendering, and a method for preparing the same. The aramid paper according to the present disclosure is applicable to a material or a component which requires precision with little difference in physical properties such as a thermal expansion coefficient, electrical conductivity and thermal conductivity. Specifically, it is applicable to a honeycomb, an electrical insulation paper, a PCB substrate, etc. because it has superior paper strength and paper formation property. Moreover, the method for preparing an aramid paper can solve the problems of poor transfer of a base paper, nonuniformity of strength and aggregation between flocs.
US10407828B2
A sheet manufacturing apparatus includes a defibrating unit that defibrates a raw material containing fiber in the atmosphere, a forming unit that forms a sheet by using at least a part of a defibrated material that is defibrated by the defibrating unit, a first supply unit that supplies a first paper material to the defibrating unit, and a second supply unit that supplies a second paper material to the defibrating unit. At least one of the first paper material and the second paper material is a paper material having a resin layer.
US10407824B2
An air bag base cloth according to the present invention includes a synthetic fiber fabric constituted by warp and weft that are constituted by synthetic fibers, and a synthetic resin layer that coats at least one surface of the synthetic fiber fabric, and only threads in one of the warp and the weft of the synthetic fiber fabric are exposed from the synthetic resin layer.
US10407807B2
A protective textile sleeve for providing protection to an elongate member contained therein; a method of construction thereof, and a method of bonding at least a portion of the sleeve to at least one of itself and an elongate member extending through a cavity thereof is provided. The sleeve has a wall of interlaced yarn, with the wall having an outermost surface and an innermost surface. The innermost surface is configured to bound a cavity extending between opposite open ends. The sleeve further includes an adhesive coating bonded to at least a portion of at least one of the outermost and innermost surfaces. The adhesive coating has a first, dried non-adhesive state and a second, wetted adhesive state, wherein the second adhesive state is activated via application of a water-based liquid thereto.
US10407798B2
In various embodiments, growth of large, high-quality single crystals of aluminum nitride is enabled via a two-stage process utilizing two different crystalline seeds.
US10407794B2
Disclosed herein are methods for electroplating which employ seed layer detection. Such methods may operate by selecting a wafer, illuminating one or more points within an interior region of the wafer surface, measuring a first set of one or more in-process color signals from the one or more points within the interior region, illuminating one or more points within an edge region of the wafer surface, measuring a second set of one or more in-process color signals from the one or more points within the edge region, each color signal having one or more color components, calculating a metric indicative of a difference between the color signals in the first and second sets of in-process color signals, determining whether an acceptable seed layer is present on the wafer based on whether the metric is within a predetermined range, and repeating the foregoing for one or more additional wafers.
US10407791B2
A method provides a structure that includes a substrate having a metal layer disposed on a surface and a metal feature disposed on the metal layer. The method further includes immersing the structure in a plating bath contained in an electroplating cell, the plating bath containing a selected solder material; applying a voltage potential to the structure, where the structure functions as a working electrode in combination with a reference electrode and a counter electrode that are also immersed in the plating bath; and maintaining the voltage potential at a predetermined value to deposit the selected solder material selectively only on the metal feature and not on the metal layer. An apparatus configured to practice the method is also disclosed.
US10407790B1
Provided here is a method for providing a coating on a plurality of substrate particles utilizing concurrent dissolution and deposition processes occurring among a plurality of source particles. Both the plurality of source particles and the plurality of substrate particles are freely immersed in the aqueous solution to form a slurry. A pH of the aqueous solution the electrochemical potential between the plurality of source particles and the aqueous solution establishes the source particles at a corrosion potential providing the concurrent dissolution and re-deposition of a cationic species on the source particles. Agitation of the slurry generates close proximity and/or brief contact between source and substrate particles causing substrate particles pass through the local environment of the source particles, resulting in some portion of the cationic species depositing at nucleation sites on the substrate particles.
US10407789B2
In one implementation, a method of depositing a material on a substrate is provided. The method comprises positioning an aluminum-containing substrate in an electroplating solution, the electroplating solution comprising a non-aqueous solvent and a deposition precursor. The method further comprises depositing a coating on the aluminum-containing substrate, the coating comprising aluminum or aluminum oxide. Depositing the coating comprises applying a first current for a first time-period to nucleate a surface of the aluminum-containing substrate and applying a second current for a second time-period, wherein the first current is greater than the second current and the first time-period is less than the second time-period to form the coating on the nucleated surface of the aluminum-containing substrate.
US10407785B2
The additive for high-purity copper electrolytic refining of the present invention is an additive which is added to a copper electrolyte in electrolytic refining for high-purity copper and is formed of a non-ionic surfactant that includes a hydrophobic group containing an aromatic ring and a hydrophilic group containing a polyoxyalkylene group.
US10407784B2
An electrode on valve metal substrate suitable for the evolution of oxygen in electrolytic processes is provided with a coating having a catalytic layer containing platinum group metals and one or more protective layers based on tin oxide modified with a doping element selected from bismuth, antimony or tantalum and with a small amount of ruthenium. The electrode is useful in processes of non-ferrous metal electrowinning.
US10407779B2
The invention is a method of stripping one or more additional coats covering a barrier primer coat that covers a surface. The barrier coat contains a catalyst, such as manganese dioxide and, or, manganese carbonate, for the decomposition of hydrogen peroxide. The top coat of the covered surface is contacted with the stripping agent at decomposition reaction conditions.
US10407776B2
A method and system for die compensation and restoration uses high-velocity oxy-fuel (HVOF) thermal spray coating and plasma ion nitriding to compensate for a particular part (damaged part) of a press die that causes formation of fine curves at a door of a vehicle to restore it to its original state. A coating thickness quantification technique may precisely compensate for the damaged part of the die that causes formation of the fine curves at the door of the vehicle in a circular form using HVOF thermal spray coating. A surface of the die may be nitrided using plasma ion nitriding after HVOF thermal spray coating is performed, so as to harden the surface of the die so that wear resistance and fatigue resistance of the die can be greatly improved and the hardfacing or overlay welding efficiency of the die can be increased.
US10407775B2
A base plate is arranged to define a portion of a housing of a hard disk drive, and includes a base body defined by casting, and an electrodeposition coating film arranged to cover a surface of the base body. The surface of the base body includes a coated surface covered with the electrodeposition coating film, and a flat worked surface exposed from the electrodeposition coating film. The worked surface may include a gate position to which a gate has been connected at the time of the casting. At least a portion of the worked surface is covered with an impregnant.
US10407771B2
Methods and apparatus for cleaning an atomic layer deposition chamber are provided herein. In some embodiments, a chamber lid assembly includes: a housing enclosing a central channel that extends along a central axis and has an upper portion and a lower portion; a lid plate coupled to the housing and having a contoured bottom surface that extends downwardly and outwardly from a central opening coupled to the lower portion of the central channel to a peripheral portion of the lid plate; a first heating element to heat the central channel; a second heating element to heat the bottom surface of the lid plate; a remote plasma source fluidly coupled to the central channel; and an isolation collar coupled between the remote plasma source and the housing, wherein the isolation collar has an inner channel extending through the isolation collar to fluidly couple the remote plasma source and the central channel.
US10407770B2
A polycrystalline chemical vapor deposited (CVD) diamond wafer comprising: a largest linear dimension equal to or greater than 125 mm; a thickness equal to or greater than 200 μm; and one or both of the following characteristics measured at room temperature (nominally 298 K) over at least a central area of the polycrystalline CVD diamond wafer, said central area being circular, centered on a central point of the polycrystalline CVD diamond wafer, and having a diameter of at least 70% of the largest linear dimension of the polycrystalline CVD diamond wafer: an absorption coefficient ≤0.2 cm−1 at 10.6 μm; and a dielectric loss coefficient at 145 GHz, of tan δ≤2×10−4.
US10407769B2
A method and apparatus for decreasing the radial temperature gradient in CVI/CVD furnaces is provided. The apparatus may comprise a graphite susceptor disposed within a vessel. Porous structures may be stacked within the graphite susceptor. The stack of porous structures may form a circular shape proximate a radially inward surface of the graphite susceptor. Graphite panels may be disposed within the graphite susceptor. The graphite panels may be located proximate a radially inward surface of the porous structures. The graphite panels may radiate heat radially outward and towards the graphite susceptor. Reactant gas may be flowed into the graphite susceptor.
US10407765B2
An evaporation device has an evaporation material that can be uniformly heated when it is evaporated with the evaporation device. The evaporation device comprises: a crucible for loading an evaporation material, a body wall of the crucible comprising an inner wall and an outer wall, a chamber being formed between the inner wall and the outer wall, which is filled with an inorganic salt; and a heating element for heating the crucible. During the working process of the evaporation device, when the crucible is heated by the heating element, the inorganic salt inside the chamber would become a molten state under heating, and the inorganic salt in molten state which fills the chamber can conduct heat uniformly such that the temperature distribution of the inner wall of the crucible is more uniform during the heating process and the evaporation material can be heated more uniformly. A method of manufacturing an evaporation device and a usage of the evaporation device are also disclosed in this patent application.
US10407759B2
A corrosion-resistant, hot and cold formable and weldable steel for use in hydrogen-induced technology with high resistance to hydrogen embrittlement has the following composition: 0.01 to 0.4 percent by mass of carbon, ≤3.0 percent by mass of silicon, 0.3 to 30 percent by mass of manganese, 10.5 to 30 percent by mass of chromium, 4 to 12.5 percent by mass of nickel, ≤1.0 percent by mass of molybdenum, ≤0.2 percent by mass of nitrogen, 0.5 to 8.0 percent by mass of aluminum, ≤4.0 percent by mass of copper, ≤0.1 percent by mass of boron, ≤1.0 percent by mass of tungsten, ≤5.0 percent by mass of cobalt, ≤0.5 percent by mass of tantalum, ≤2.0 percent by mass of at least one of the elements: niobium, titanium, vanadium, hafnium and zirconium, ≤0.3 percent by mass of at least one of the elements: yttrium, scandium, lanthanum, cerium and neodymium, the remainder being iron and smelting-related steel companion elements.
US10407754B2
A process for manufacturing a reclaimed alloy material includes the steps of crushing a magnetic core including an amorphous alloy ribbon; putting a prepared organic solvent and crushed pieces obtained in the step of crushing into a container and putting the crushed pieces into contact with the organic solvent in the container; selectively discharging the organic solvent from the container after putting the crushed pieces into contact with the organic solvent; and evaporating, after discharging the organic solvent, the organic solvent remaining in the container. The crushed pieces, removed from the container after the organic solvent is evaporated, is reused as a reclaimed alloy material.
US10407753B2
A method of improving leach kinetics and recovery during atmospheric or above-atmospheric leaching of a metal sulfide is disclosed. A system for practicing the aforementioned method is also disclosed. Apparatus for practicing the aforementioned method is also disclosed. A new composition of matter which is formed by the aforementioned method, and which may be utilized in the system and apparatus is further disclosed. The new composition of matter may exhibit improved leach kinetics, and may have some utility in the semi-conductor arts, including uses within photovoltaic materials.
US10407751B2
A multipurpose continuous processing line able for heat treating and hot dip coating a steel strip containing: an annealing section (1) for heating the steel strip to a predetermined annealing temperature and for maintaining the steel strip at said annealing temperature, a first transfer section (2), an overaging section (3) able to maintain the temperature of the steel strip between 300° C. and 700° C., a second transfer section (4) able to adjust the temperature of the steel strip to allow the hot dip coating of the strip and, a hot dip coating section (5), wherein the first transfer section (2) includes, in sequence, a cooling section (21) and a heating section (22).
US10407749B2
A hot-rolled steel sheet having a composition comprising, in mass %, C: 0.06 to 0.3%, Si: 0.4 to 2.5%, Mn: 0.6 to 3.5%, P: at most 0.1%, S: at most 0.05%, Ti: 0 to 0.08%, Nb: 0 to 0.04%, a total content of Ti and Nb: 0 to 0.10%, sol.Al: 0 to 2.0%, Cr: 0 to 1%, Mo: 0 to 0.3%, V: 0 to 0.3%, B: 0 to 0.005%, Ca: 0 to 0.003%, REM: 0 to 0.003%, the remainder Fe and impurities, is cold rolled, then heated at an average heating rate of at least 15° C./sec so that a proportion of an unrecrystallization of a region not transformed to austenite at a time of reaching (Ac1 point+10° C.) is at least 30 area %, and then held for 30 seconds at temperature of at least (0.9×Ac1 point+0.1×Ac3 point) and at most (Ac3 point+100° C.).
US10407746B2
The invention relates to a method for manufacturing a ferritic-austenitic stainless steel having good formability, good weldability and high elongation. The stainless steel containing the sum of carbon and nitrogen C+N in the range 0.17-0.295 in weight % in which sum C+N a lower carbon content to avoid sensitisation during welding is compensated by an increased nitrogen content to maintain formability is heat treated so that the microstructure of the stainless steel contains 45-75% austenite in the heat treated condition, the remaining microstructure being ferrite, and the measured Md30 temperature of the stainless steel is adjusted between 0 and 50° C. in order to utilize the transformation induced plasticity (TRIP) for improving the formability of the stainless steel.
US10407741B2
The present disclosure provides a transgenic corn comprising event MON87403 that exhibits increased grain yield. The disclosure also provides cells, plant parts, seeds, plants, commodity products related to the event, and DNA molecules that are unique to the event and were created by the insertion of transgenic DNA into the genome of a corn plant. The disclosure further provides methods for detecting the presence of said corn event nucleotide sequences in a sample, probes and primers for use in detecting nucleotide sequences that are diagnostic for the presence of said corn event.
US10407721B2
Some embodiments described herein relate to modified nucleotide and nucleoside molecules with novel 3′-hydroxy protecting groups. Also provided herein are methods to prepare such modified nucleotide and nucleoside molecules and sequencing by synthesis processes using such modified nucleotide and nucleoside molecules.
US10407711B2
The present invention relates to a method of obtaining peptides from procaryotic and/or eucaryotic cells.
US10407710B2
A disposable, enzymatic assay based test strip device for colorimetric detection of an analyte compound, such as ethanol, in a body liquid sample, such as saliva, is provided. The test strip device includes at least one reactive test zone configured to develop a visual indication when the concentration of the analyte compound in the body liquid sample exceeds a predetermined limit, and a reactive control zone configured to develop a visual indication upon being supplied with the body liquid sample. The test strip device further includes a compound buffer, preferably selected from non-volatile alcohols and disposed to closely adjoin the reactive control zone such, that the content of the compound buffer admixes with the reagents provided within the reactive control zone, while the control zone is being supplied with the body liquid sample. Deposition of the reactive zones is preferably implemented by conventional printing methods utilizing biological inks.
US10407706B2
To provide a mogrol glycosyltransferase and a method for producing a mogrol glycoside using the enzyme. The present invention provides a mogrol glycosyltransferase and a method for producing a mogrol glycoside using the enzyme, and a transformant into which a mogrol glycosyltransferase gene is introduced and a method for preparing the transformant.
US10407704B2
The invention relates to methods of saccharifying a cellulosic material comprising subjecting the cellulosic material to a cellulolytic enzyme composition and a GH61 polypeptide, and optionally a catalase in the presence of dissolved oxygen at a concentration in the range of 0.5 to 10% of the saturation level. The invention also related to methods of producing desired fermentation products, such as ethanol, using a method including a saccharification step of the invention.
US10407696B2
This disclosure provides replication-incompetent adenoviral vectors useful in vaccine development and gene therapy. The disclosed vectors comprise a selective deletion of E3 and are particularly useful for preparation of vaccines development and for gene therapy using toxic transgene products that result in vector instability that occurs when the entire E3 domain is deleted.
US10407695B2
The present invention provides nucleic acid, vectors, viruses, and recombinant cells comprising triple-stranded structures, such as those resulting from central initiation and termination of HIV-1 reverse transcription at the center of HIV-1 linear DNA genomes. These triplex structures can act as a cis-determinant of HIV-1 DNA nuclear import, allowing infection of non-dividing target cells. In one aspect, the presence of the DNA triplex sequence in an HIV vector strongly stimulates gene transfer in hematopoietic stem cells. The invention also provides methods of using these triplex structures for making recombinant cells, as well as methods of using the recombinant cells to express proteins of interest both in vitro and in vivo.
US10407691B2
Provided herein are compounds and methods for increasing disease resistance and/or root length in plants.
US10407687B2
Provided are constructs and methods for expressing a transgene in plant cells and/or plant tissues using gene regulatory elements obtained from Brassica napus.
US10407686B2
The present disclosure provides a cotton promoter, designated “p2”, which exhibits promoter activity. Interestingly, the promoter is also influenced by water or salt stress. Deletion analysis reveals upstream elements/motifs in the promoter which influence promoter activity, and sequences that are potentially responsive to salt or water stress.
US10407674B2
The present invention relates to methods of producing polypeptides having protease activity.
US10407673B2
A mutant of EndoS2 includes one or more mutations in the sequence of a wild-type EndoS2 (SEQ ID NO:1), wherein the one or more mutations are in a peptide region located within residues 133-143, residues 177-182, residues 184-189, residues 221-231, and/or residues 227-237, wherein the mutant of EndoS2 has a low hydrolyzing activity and a high tranglycosylation activity, as compared to those of the wild-type EndoS2. A method for preparing an engineered glycoprotein using the mutant of EndoS2 includes coupling an activated oligosaccharide to a glycoprotein acceptor. The activated oligosaccharide is a glycan oxazoline.
US10407665B2
This disclosure relates to methods of producing induced pluripotent (iPS), multipotent, and/or lineage-committed stem cells from differentiated cells, maintaining iPS, multipotent, and/or lineage-committed cells in culture, and re-differentiating the iPS and multipotent stem cells into any desired lineage-committed cell type.
US10407662B2
A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.
US10407660B2
Devices for magnetic 3d culture are described including magnetic lids/bases for single Petri plates, adjustable height cap for same, as well similar devices for multi-magnet culture plates. A pen-like device for sterilely lifting and moving cells is also described, and this magnetic pipettor can also exist in multi-well magnetic pipettor formats.
US10407652B1
A wooden barrel apparatus for aging products includes an inner wooden barrel positioned in an outer wooden barrel. A first volume may be defined within the inner wooden barrel. A second volume may be defined between the inner wooden barrel and the outer wooden barrel. One or more surfaces of the inner wooden barrel and the outer wooden barrel may be charred.
US10407644B2
A perfume composition having controlled release of phytoncides in an atmosphere in order to generate an air condition resembling the air environment of a forest is provided. The perfume composition includes a) at least about 0.6% by weight of at least one phytoncide; and b) a perfume mixture including (i) at least one solvent; and (ii) at least one fragrance ingredient. At least about 25% by weight of the at least one phytoncide is selected from the group consisting of pinene alpha, pinene beta and combinations thereof.
US10407641B2
A composition of an oil-soluble ionic detergent that does not contribute metal ions to the composition, and which comprises a quaternary non-metallic pnictogen cation and an organic anion having at least one hydrocarbyl group of sufficient length to impart oil solubility to the detergent, the detergent having a total base number (TBN) to total acid number (TAN) ratio of at least 2:1 imparts ash-free basicity to a lubricant composition.
US10407638B2
The present invention relates to the biosynthesis of α-olefins. In particular, the invention provides methods for the production of medium-chain α-olefins, more particularly C11 α-olefins, using a polypeptide with decarboxylase activity on free fatty acids with 8 to 14 carbons, in particular on C8-C12 free fatty acids, more particularly on C12 free fatty acids, or a genetically engineered host cell expressing or overexpressing said polypeptide.
US10407634B2
The invention relates to the use of quaternized nitrogen compounds as a fuel and lubricant additive or kerosene additive, such as in particular as a detergent additive, for decreasing or preventing deposits in the injection systems of direct-injection diesel engines, in particular in common rail injection systems, for decreasing the fuel consumption of direct-injection diesel engines, in particular of diesel engines having common rail injection systems, and for minimizing the power loss in direct-injection diesel engines, in particular in diesel engines having common rail injection systems; the invention further relates to the use as an additive for petrol, in particular for operation of DISI engines.
US10407626B2
Scavenging compounds and compositions useful in applications relating to the production, transportation, storage, and separation of municipal waste water, hydrocarbons, crude oil, and natural gas among others are disclosed. Also disclosed herein are methods of using the compounds and compositions as scavengers, particularly in applications relating to the production, transportation, storage, and separation of hydrocarbons, crude oil, and natural gas.
US10407612B2
The invention is directed to polymers that self-crosslink at acidic pH or can be crosslinked by phenolic agents in brine. Such polymers have lower viscosity and can be pumped deep into reservoirs, where they will cross link in situ, thus increasing their viscosity and/or form a gel and blocking thief zones. Methods of making and using such polymers are also provided.
US10407601B2
Ooids, microabrasive compositions containing ooids and methods of making microabrasive compositions containing ooids are described. Generally, ooids represent small particles, which are selectable for size, size distribution, and other characteristics and can be used as a microabrasive particle. Ooids generally show a high level of symmetry, sphericity, roundness and a low aspect ratio. As described here, these characteristics generally yield a predictable and highly effective abrasive.
US10407578B2
The present invention relates to an aqueous coating composition (A) having a pH in a range from 4.0 to 6.5 and comprising at least one cathodically depositable binder (A1), a total amount of at least 130 ppm of Bi, based on the total weight of (A), including at least 30 ppm of Bi in a form (A3) in solution in (A) and at least 100 ppm of Bi in a form not in solution in (A), and at least one at least bidentate complexing agent (A5) suitable for complexing Bi, (A5) being present in (A) in a fraction of at least 5 mol %, based on the total amount of the Bi present in (A), for at least partly coating an electrically conductive substrate with an electrocoat material, to a method for producing (A), to the use of (A) for at least partly coating an electrically conductive substrate with an electrocoat material, to a corresponding coating method, to an at least partly coated substrate obtainable by this method, and to a method for setting and/or maintaining the concentration of component (A3) and/or (A4) in the coating composition (A) during the coating method.
US10407576B2
The present disclosure relates to water repellent coating compositions, kits and methods of applying the same, for use as fireproofing materials. The water repellent spray applied fire resistant material contains an latex polymer(s), such as a vinyl acetate/ethylene copolymer, a silicone, such as methoxy-functional polysiloxane, or both to reduce or eliminate the effect of water damage to the SFRM and underlying substrate.
US10407568B2
A cold shrink article made from a composition comprising (A) an ethylene/α-olefin interpolymer; (B) a filler; and (C) an α,β-unsaturated carboxylic acid. The composition may optionally include additives selected from the group consisting of plasticizer, peroxide curing agent, antioxidant, process additives, flame retardant and combinations thereof.
US10407566B2
The present invention relates to a method for preparing a low styrene-butadiene rubber having a low combined styrene content and, more particular, to a method for preparing a low styrene-butadiene rubber, wherein the low styrene-butadiene rubber contributes to an excellent polymerization rate and vulcanization rate by using an aliphatic organic acid and a sulfonate based compound as emulsifiers, and is excellent in heat stability after blending, thereby improving the workability and viscosity in in roll processing, such that the low styrene-butadiene rubber is advantageous to produce a molded article with improved rigidity and hardness when mixed with a high styrene-butadiene rubber.
US10407562B2
A compound represented by the formula: wherein R is selected from the group consisting of (i) substituted or unsubstituted alkyl with C=0 to 12 inclusive; (ii) substituted or unsubstituted aryl; and (iii) substituted and unsubstituted alkylaryl; wherein X1, X2, X3 and X4 are each selected from the group consisting of alkyl, aryl, alkylaryl groups and hydrogen; wherein R1, R2, R3, and R4 are each selected from the group consisting of alkyl, aryl, alkylaryl groups and hydrogen and R2 and R3 may optionally be bridged by a polymethylene group; wherein when C=0 in R, the combined group R1 R2 is the same as the combined group R3 R4; and wherein when C=1 in R, each of R1, R2, R3, and R4 are hydrogen.
US10407559B2
An object of the present invention is to provide a plasticizer for vinyl chloride-based resin superior in cold resistance and volatility resistance, and desirable in flexibility, fogging resistance, heat discoloration resistance, and weather resistance, and to also provide a vinyl chloride-based resin composition comprising the plasticizer.An ester obtained by reacting a specific carboxylic acid or a derivative thereof with a C9 saturated aliphatic alcohol at a specific proportion is superior in cold resistance and volatility resistance, and desirable in flexibility, fogging resistance, heat discoloration resistance, and weather resistance. Therefore, if becomes possible to obtain a vinyl chloride-based resin composition applicable to automobile parts, medical materials, or the like, as well as a molded article of the vinyl chloride-based resin composition.
US10407558B2
The present invention relates to light color, shelf-stable liquid compositions of overbased calcium carboxylate soaps and a process for their preparation. The inventive soaps are prepared by neutralizing calcium base in a mixture of two different aliphatic carboxylic acids and carbonating the mixture in the presence of a non-polar hydrocarbon solvent and a polar organic solvent as a promoter under controlled temperature conditions. The overbased calcium carboxylate soaps of the invention contain 20%-90% by weight of C7 to C25 saturated carboxylic acids, which are branched on carbon 2, and between 1% and 20% by weight short chain saturated carboxylic acids. These liquid compositions have light colors and excellent heat stability. They can be used as anticorrosion/antirust additives, and paint dryers and stabilizers, in paints, coatings and lubricants, as well as other applications.
US10407556B2
Many different substrates are used in tissue engineering as platforms to enhance cell attachment, proliferation and activity, either in-vitro, to multiply specific cell lines, or in-vivo, to induce shorter healing time of injured or missing tissue. However, their hydrophobicity and lack of specific functionalities make them non-ideal for cell adhesion and growth. Treating the surfaces by exposing them to a series of steps including, but not limited to, a diazonium based wet chemistry allows one or more functional groups to be applied to the surface improving cell adhesion and growth. Embodiments of the invention exploiting PDLLA, PMMA and roughed PEEK are demonstrated including both a one-stage and a two-stage process, and at times a vacuum treatment, allowing modification of inner and outer surfaces.
US10407554B2
A film for use in architectural applications (e.g. for roofs, walls or windows of buildings) comprises a polymeric material and an additive, wherein said polymeric material is a fluoropolymer and said additive is selected from titaniumnitride and tungsten oxide. Preferred polymeric materials may be ethylene chlorotrifluoroethylene (ECTFE) or an ethylene-tetrafluoroethylene copolymer (ETFE).
US10407549B2
A photosensitive polyimide resin composition is provided. The resin composition comprises an infrared absorber, an epoxy, a photosensitive polyimide and a photo initiator. The infrared absorber includes pigment and has an amount of weight accounting for 5-40% of total solid weight of the photosensitive polyimide resin composition. The epoxy has an amount of weight accounting for 5-40% of total solid weight of the photosensitive polyimide resin composition. The photosensitive polyimide has the structure of formula (1): wherein m, n are independently 1 to 600; X is a tetravalent organic group, and the main chain of X includes alicyclic structure; Y is a divalent organic group, and the main chain of Y includes siloxane structure; Z is a divalent organic group, and the side chain of Z includes phenolic hydroxyl group or carboxyl group. The photosensitive polyimide has an amount of weight accounting for 30-90% of total solid weight of the photosensitive polyimide resin composition. The photo initiator has an amount of weight accounting for 0.1-15% of total solid weight of the transparent photosensitive resin.
US10407546B2
The present invention relates to a process for producing hydrosilylatable, eugenol-based polyethers, to the conversion thereof into polyether siloxanes and also to the products that may be produced by this process and to the use of said products as surfactants.
US10407538B2
A low chromatic aberration polyester different-shrinkage composite yarn is made of polyester POY yarn and polyester FDY composite yarn. The polyester POY yarn and polyester FDY yarn is obtained by spinning the polyester solution, the rupture strength of the low color polyester different-shrinkage composite yarn is ≥1.9 cN/dtex, the elongation at break is 30.0±5.0%, the crimp shrinkage is 2.50±3.0%, the network degree is 20±5/m, the color difference ΔE is less than 0.200. In the invention, the magnesium ethylene glycol is relatively mild, the thermal degradation coefficient is small, the oligomers in the polymerization process is reduced, and the oligomers in the dissolution process are further reduced, so that the appearance of stains and streaks reduces during the dyeing and post-processing heat setting of the polyester fiber, which ensures the fiber's leveling and rubbing fastness.
US10407533B2
A polymer preparation consisting of silane-functional polymers, including at least one polymer having at least one terminal group of formula (I) and at least one further silane terminal group, a method for producing the polymer preparation and a composition containing it. The polymer preparation has a surprisingly low viscosity, cross-links surprisingly quickly even without the use of EHS-critical catalysts such as organotin compounds or DBU, and hardens into a non-sticky material with good strength and elasticity. It is especially well suited as an elastic adhesive or sealant or as an elastic coating. The invention further relates to a method for lowering the viscosity of a polymer having at least one terminal group of formula (I) by introducing at least one further silane terminal group.
US10407529B2
The invention relates to a method for producing vinyl chloride graft copolymers by emulsion polymerization and to a method for producing mixtures of said graft copolymers. The invention also relates to transparent articles produced using the claimed graft copolymers or mixtures thereof.
US10407523B2
The present disclosure concerns a bulk polymerization process for the preparation of high heat performance copolymer resins with a reduced amount of oligomer byproduct. The method can comprise isolating oligomer byproduct and introducing the oligomer byproduct into the reactant mixture for the bulk polymerization process.
US10407521B2
The present specification relates to a polymer and a polymer electrolyte membrane including the same.
US10407519B2
Solid adducts comprising MgCl2 and an alcohol ROH in which R is a C1-C20 hydrocarbon group, in which the amount of alcohol ranges from higher than 42% to 60% by weight and the porosity determined with Hg method due to pores up to 1 μm and expressed in cm3/g, is such that the value of its ratio with the amount of alcohol in percentage falls above the straight line defined by the equation y=−0.0158x+1.03 in which y is the porosity of the adduct and x is the alcohol percentage by weight.
US10407507B2
Described herein are anti-MCAM antibodies and antigen binding fragments thereof that are capable of inhibiting the interaction between MCAM and its ligand, a protein comprising a laminin α-4 chain. These anti-MCAM antibodies and antigen binding fragments thereof may be useful for, for example, treating inflammatory conditions characterized by the infiltration of MCAM-expressing cells into a site of inflammation in the body.
US10407505B2
The present invention provides variant target binding agents and methods relating to the use of such binding agents for the prophylaxis or treatment of cancers and immunological disorders. The variant target binding agent is conjugated to a therapeutic agent that exerts a cytotoxic, cytostatic, or immunomodulatory effect on target cells.
US10407485B2
The invention provides an isolated or purified T cell receptor (TCR) having antigenic specificity for NY-ESO-1. Also provided are related polypeptides, proteins, nucleic acids, recombinant expression vectors, isolated host cells, populations of cells, antibodies, or antigen binding portions thereof, and pharmaceutical compositions. The invention further provides a method of detecting the presence of cancer in a mammal and a method of treating or preventing cancer in a mammal using the inventive TCRs or related materials.
US10407478B2
The invention relates to novel therapeutic approaches to cancer treatment that exploits tumor suppressor functions of DKK3b by site-specific delivery of DKK3b. Novel therapeutics and methods for treating tumors and cancers utilizing DKK3b tumor suppressor functions are disclosed.
US10407475B2
Protein secretory factor with high secretory efficiency and an expression vector comprising the same
The present invention relates to a novel protein secretion factor, a vector including a nucleic acid sequence encoding the protein secretion factor, and a transformed cell into which the vector is introduced. The invention also relates to a method of producing a target protein using the transformed cell including the vector.
US10407474B2
Aggregation is a major cause of the misbehavior of proteins. A system for modifying a protein to create a more stable variant is provided. The method involves identifying non-conserved hydrophobic amino acid residues on the surface of a protein, suitable for mutating to more hydrophilic residues (e.g., charged amino acids). Any number of residues on the surface may be changed to create a variant that is more soluble, resistant to aggregation, has a greater ability to re-fold, and/or is more stable under a variety of conditions. The invention also provides GFP, streptavidin, and GST variants with an increased theoretical net charge created by the inventive technology. Kits are also provided for carrying out such modifications on any protein of interest.
US10407473B2
Provided herein are FDC-SP polypeptides and methods of using such polypeptides. Methods include, but are not limited to, altering IgA concentration in a subject, treating a subject having signs of a disorder that includes excessive IgA production, identifying a compound that decreases the concentration of IgA in an animal, and identifying a compound that treats a condition associated with increased levels of IgA. Also provided herein is an animal that has decreased expression of an endogenous FDC-SP coding sequence. The animal may develop pathophysiological features of IgA nephropathy, and/or may display increased IgA in serum, saliva, bronchoalveolar lavage fluid, or a combination thereof; increased IgA expressing B lymphocytes in circulation, lymphoid tissue, or a combination thereof; or increased IgA production in vitro by isolated B lymphocytes.
US10407467B2
Described are compounds of formula (I) for use in combination treatment with a second active agent, such as rifampicin, for example for treatment of a microbial infection. The compound of formula (I) is a polymyxin compound is: where the groups -A-, —R1, —R2, —R3, —R4, —R5, —R6, —R7, —R8, and —X— are described in detail within the description.
US10407457B2
The present disclosure provides pyrrolopyrimidine nucleoside analogs of the Formula I, Formula IA, Formula IB, or Formula II and phospholipid conjugates and pharmaceutical compositions thereof wherein Rc and A are defined herein. Also presented are methods of treating and/or preventing viral infection and/or viral infection-associated disease or disorder with one or more compounds of Formula I, Formula IA, Formula IB, or Formula II.
US10407455B2
The present invention provides a novel phillygenin glucuronic acid derivative shown as a general formula (I). wherein, R1=H, R2=CnH2n+1, R3=CnH2n+1 or R1=CnH2n+1, R2=CnH2n+1,R3=H or R1-R2=—CH2—, R3=CnH2n+1; n=1-30. The present invention further relates to a preparation method of the compound, a pharmaceutical composition taking the compound as an active ingredient, as well as application of the compound in the present invention in antiviral diseases.
US10407452B2
The invention relates to a method for removing lignin from lignocellulosic biomass. The method comprises feeding of lignocellulosic biomass and a first aqueous solution into a reactor vessel, the lignocellulosic biomass and the first aqueous solution forming a reaction mixture; reducing the pressure in the reactor vessel below 0.8 bar absolute pressure, preferably 0.5 bar absolute pressure, more preferably below 0.2 bar absolute pressure; keeping the reaction mixture in a predetermined extraction temperature, and adding at least one extraction chemical, such as base or acid, to the reaction vessel and extracting lignin from the biomass to the liquid phase of the reaction mixture.
US10407450B2
A heterogeneous polynuclear complex for use as a raw material in the chemical deposition of composite metal or composite metal thin films with the below formula. In the formula, M1 and M2 are mutually different transition metals, x is an integer of 0 or more and 2 or less, y is in integer of 1 or more and 2 or less, z is an integer of 1 or more and 10 or less, R1 to R4 are each one of a hydrogen atom and an alkyl group with a carbon number of 1 or more and 5 or less, and R5 is a hydrogen atom, a carbonyl, an alkyl group with a carbon number of 1 or more and 7 or less, an allyl group or an allyl derivative. The heterogeneous polynuclear complex allows a composite metal thin film or a composite metal compound thin film containing a plurality of metals to be formed from a single raw material.
US10407446B2
The specification generally relates to compounds of Formula (I): and pharmaceutically acceptable salts thereof, where R1 and R2 have any of the meanings defined herein. The specification also relates to the use of such compounds and salts thereof to treat or prevent DNA-PK mediated disease, including cancer. The specification further relates to pharmaceutical compositions comprising such compounds and salts; kits comprising such compounds and salts; methods of manufacture of such compounds and salts; intermediates useful in the manufacture of such compounds and salts; and to methods of treating DNA-PK mediated disease, including cancer, using such compounds and salts.
US10407441B2
The invention features compositions and methods for treating or preventing a neoplasia. More specifically, the invention provides compositions and methods for disrupting the interaction of a BET family polypeptide comprising a bromodomain with chromatin (e.g., disrupting a bromodomain interaction with an acetyl-lysine modification present on a histone N-terminal tail).
US10407439B2
The present invention relates to stereochemically defined polypropionates and methods for preparing and using the same. The stereochemically defined polypropionates may be useful in the synthesis of natural products and/or natural product-like libraries.
US10407436B2
Carboxamide-substituted xanthene dyes, reactive dyes, and the use of such dyes as a labeling reagent are disclosed. Specifically, a carboxamide-substituted dye of the formula (I) is disclosed.
US10407433B2
The present invention provides a compound having the structure: wherein R1, R2, R3, R4, and R5 are each independently H, halogen, CF3 or C1-C4 alkyl, wherein two or more of R1, R2, R3, R4, or R5 are other than H; R6 is H, OH, or halogen; and B is a substituted or unsubstituted heterobicycle, wherein when R1 is CF3, R2 is H, R3 is F, R4 is H, and R5 is H, or R1 is H, R2 is CF3, R3 is H, R4 is CF3, and R5 is H, or R1 is Cl, R2 is H, R3 is H, R4 is F, and R5 is H, or R1 is CF3, R2 is H, R3 is F, R4 is H, and R5 is H, or R1 is CF3, R2 is F, R3 is H, R4 is H, and R5 is H, or R1 is Cl, R2 is F, R3 is H, R4 is H, and R5 is H, then B is other than or a pharmaceutically acceptable salt thereof.
US10407430B2
Provided are Janus kinase 1 selective inhibitors of Formula 1 or Formula 2: wherein R1, R2, and X are as described herein. Pharmaceutical uses thereof, for example, for the treatment of a disease associated with a Janus kinase, are also provided.
US10407428B2
The present invention relates to spiro-isoquinoline-1,4′-piperidine compounds having dual pharmacological activity towards both the sigma (σ) receptor and the μ-opiod receptor, to processes of preparation of such compounds, to pharmaceutical compositions comprising them, and to their use in therapy, in particular for the treatment of pain.
US10407425B2
Indazole compounds for treating various diseases and pathologies are disclosed. More particularly, the present invention concerns the use of an indazole compound or analogs thereof, in the treatment of disorders characterized by the activation of Wnt pathway signaling (e.g., cancer, abnormal cellular proliferation, angiogenesis, Alzheimer's disease, lung disease and osteoarthritis), the modulation of cellular events mediated by Wnt pathway signaling, as well as genetic diseases and neurological conditions/disorders/diseases due to mutations or dysregulation of the Wnt pathway and/or of one or more of Wnt signaling components. Also provided are methods for treating Wnt-related disease states.
US10407405B2
The present invention relates to compounds of formula I: and pharmaceutically acceptable salts thereof, pharmaceutical compositions comprising the compounds of formula I or their pharmaceutically acceptable salts, and methods of using said compounds, salts and compositions in the treatment of various disorders associated with CRM1 activity.
US10407402B1
A method of forming a chalcogenophene compound of formula (I) includes reacting a compound of formula (II) with a chalcogenide salt in presence of a proton source. Y is O, S, Se, Te or Po. R1 is hydrogen, deuterium, an aliphatic, heteroaromatic, or aromatic group, or a precursor of a leaving group Z whose conjugate acid (HZ) has pKa less than 30. R2 is hydrogen, deuterium, or an aliphatic, heteroaromatic, or aromatic group. R1 and R2 may be the same or different, and may joint together to form a saturated or unsaturated, heteroalicyclic or alicyclic ring. R3 is, for example, alkyl, aryl, heteroaryl, organosilyl, organotin, or organogermyl. R3′ is the same as R3 or is hydrogen. X is a precursor of a leaving group X whose conjugate acid (HX) has a pKa of less than 30.
US10407393B2
Provided is a compound represented by formula (IV) or a salt thereof, wherein the content of the compound represented by formula (I) is 350 ppm by mass or less.
US10407373B2
The invention relates to a process to separate formic acid from methyltetrahydrofuran (MTHF) said process comprising subjecting a composition comprising formic acid and MTHF to distillation, characterized in that the process comprises adding water to said distillation. This allows for cost-efficient recovery and recycling of MTHF, for example in process to produce and recover formic acid from a biomass hydrolysate.
US10407371B2
The invention relates to the production of acrolein and/or acrylic acid from glycerol, and more particularly to a method for continuous production of a stream comprising acrolein by dehydration of glycerol, comprising cycles of reaction and regeneration of a dehydration catalyst.
US10407363B2
Processes, systems, and catalysts for the conversion of 2-butene to 1,3-butaidene without the use of steam or, in some embodiments, with a reduced use of steam as compared to prior art processes are provided. The catalyst includes tungsten trioxide (WO3) on an inorganic support includes activated magnesium oxide (MgO) and may be referred to as a “dual catalyst” or a “co-catalyst.” Embodiments of the catalyst. A process for the production of 1,3-butadiene may include contacting a feed stream of 2-butene with a WO3-inorganic support catalyst or a MgO and WO3-inorganic support catalyst and may be performed without steam in the feed stream.
US10407362B2
A method for producing diene comprises a step 1 of obtaining a straight chain internal olefin by removing a branched olefin from a raw material including at least the branched olefin and a straight chain olefin; and a step 2 of producing diene from the internal olefin by oxidative dehydrogenation using a first catalyst and a second catalyst, and the first catalyst has a complex oxide including bismuth, molybdenum and oxygen, and the second catalyst includes at least one selected from the group consisting of silica and alumina.
US10407359B2
A process for deactivation of an olefin oligomerization catalyst is described, including contacting a catalyst composition with a catalyst quenching medium to form a deactivated catalyst composition, and recovering excess catalyst quenching medium. The catalyst quenching medium includes an alcohol having at least 6 carbon atoms, an organic amine, an amino alcohol, or a combination comprising at least one of the foregoing. The catalyst quenching medium is present in a molar ratio of catalyst quenching medium to catalyst of at least 3:1. A process for the oligomerization of an olefin is also described, including feeding the olefin, a solvent, and a catalyst composition into a reactor, oligomerizing the olefin in the reactor to form a reaction product stream including linear alpha olefins, solvent, and the catalyst composition, and contacting the reaction product stream with a catalyst quenching medium.
US10407358B2
Described here are various processes for producing linear alpha olefins using a heterogeneous catalytic composition in the reaction mixture. These processes include size-based or phase-based separation of the heterogeneous catalytic compositions from the product stream and recycling the catalysts to the reaction mixture. Various other embodiments may be disclosed and claimed.
US10407351B2
Methods for embedding photocatalytic titanium dioxide in concrete surfaces to reduce pollutants via photocatalytic reactions are provided herein. One method includes mixing a solvent compound with an anatase titanium dioxide (TiO2) photocatalyst, applying an amount of concrete treatment compound to an upper surface of the concrete, the concrete treatment compound comprising a mixture of a liquid carrier compound with the anatase titanium dioxide (TiO2) photocatalyst.
US10407341B2
The invention relates to a lithium silicate glass ceramic, which contains at least lithium disilicate as a crystal phase, and lithium aluminum silicate as further crystal phase. The lithium silicate glass ceramic in its initial composition contains Al2O3 at 1.5 to 3.5 percent by weight, and K2O at 0.6 to 1.8 percent by weight.
US10407340B2
A glass composition includes, as expressed by mol % in terms of oxide, from 15 to 40% of PbO, from 25 to 50% of MoO3, from 5 to 25% of P2O5 and from 7 to 15% of ZnO. A glass powder includes the glass composition. The glass powder has D50 of from 0.3 to 2.0 μm, where D50 is a 50% particle diameter in a volume-based cumulative particle size distribution.
US10407338B2
Fusion-formable sodium-containing aluminosilicate and boroaluminosilicate glasses are described. The glasses are particularly useful for controlled release of sodium—useful in semiconductor applications, such as thin film photovoltaics where the sodium required to optimize cell efficiency is to be derived from the substrate glass.
US10407337B2
According to some embodiments method for making an optical fiber preform comprises the steps of: (i) placing a plurality of rods with an outer surface having a coefficient of friction 0.02≤COF≤0.3 into an inner cavity of an apparatus; (ii) placing particulate glass material in the inner cavity between the rods and an inner wall of the mold cavity; and (iii) applying pressure against the particulate glass material to press the particulate glass material against the plurality of rods.
US10407336B2
A method for cutting a thin glass including the steps of guiding, by a transport device, the thin glass ribbon over a levitation support, and directing, within a range of the levitation support, a laser beam onto the thin glass ribbon, which heats up the thin glass ribbon at an impingement point of the laser beam. The method also includes the step of blowing, by a cooling jet generator, a cooling fluid onto the track heated by the laser beam so that a region heated by the laser beam is cooled down and a mechanical stress is created. The cooling fluid contains vapor of a liquid at a saturation ratio of at least 0.5 or a plurality of liquid droplets. The liquid droplets form a contact angle on a surface of the thin glass ribbon which is smaller than that of water on the same surface.
US10407331B2
A scale detection device of a concentrating device comprises: a reverse osmosis membrane device 13 that is a concentrating device including a reverse osmosis membrane 13a, which is a filtering membrane for concentrating salt in a water to be treated 11, containing at least calcium sulfate to obtain reclaimed water 12; and a scale detection unit 15 disposed in a branched line L14 branched from a concentrated water line L13 discharging concentrated water 14 having a high concentration of salt, the scale detection unit further concentrating the salt in the concentrated water 14 to obtain reclaimed water for detection 16, and including a detection membrane 15a detecting the absence or presence of scale component deposition in the concentrated water 14.
US10407328B2
A method to control a process variable in a process by means of a control unit comprises: sequential determination of values of a reference variable to be supplied to the first control unit based on the values of a first measurand; sequential determination of values of a regulating variable using both values for the reference variable and sequentially determined values for the process variable; with a current value for the reference variable being determined: by sequentially saving values of the first measurand, or values derived therefrom, in a first FIFO memory having a number K of memory locations for saving one value respectively, namely a memory featuring a number K of logically consecutive memory locations (j=i) in such a way that the oldest of the values saved in the first FIFO memory is saved in a first memory location (j=1) and the value saved last in the first FIFO memory is saved in a final memory location (j=k); and by using only the n oldest values saved in the first FIFO memory to determine the current value for the reference variable, with n being a number of values that is smaller than the number K of the values saved in the memory locations of the first FIFO memory and greater or equal 1.
US10407327B2
The present invention provides a bioelectrochemical system for removing a polyvalent ion present in seawater etc., capable of producing electricity. The bioelectrochemical system according to the present invention comprises: an anode chamber comprising an anode which accommodates an electron produced when treating an organic material in wastewater with a microorganism; a cathode chamber comprising a cathode receiving the electron from the anode, for producing a hydroxide ion by reacting the electron with oxygen and water provided from the outside, and depositing the polyvalent ion inside an electrolyte by using the hydroxide ion; and an anion exchange membrane for blocking the polyvalent ion inside the electrolyte from moving to the anode chamber. Also, the present invention provides the bioelectrochemical system capable of removing the polyvalent ion present in seawater etc., and simultaneously producing hydrogen. The present invention comprises: the anode chamber, provided with the anode to which electrochemically active bacteria are attached, for producing the electron by having organic wastewater, as a substrate, injected thereto; the cathode chamber, provided with the cathode, for removing the polyvalent ion and simultaneously producing a hydrogen gas by having seawater, as an electrolyte, injected thereto; the anion exchange membrane for separating the anode chamber and the cathode chamber and preventing the polyvalent cation in seawater from moving to the anode chamber; and a power source connected between the anode and the cathode.
US10407325B2
A method for providing a safe and healthy water and water-based product, comprising: testing pretreated reverse osmosis water to determine whether it meets a first set of pre-defined specifications; introducing a pre-defined nutrient composition into the water, wherein the predefined nutrient composition comprising one or more of mineral nutrients, trace elements and nutritional supplements; testing the water to determine whether it meets a second set of predefined specifications; and disinfecting the water along with its container by UV irradiation from a UV light source to obtain a water product.
US10407320B2
Techniques for depleting target organisms in water include a waterproof transducer configured for ensonifying a container of water with low intensity sound at one or more ultrasound frequencies for a duration sufficient to prevent maturation of at least 90% of the target organism. In some cases the target organism is mosquito larvae. For example, a portable system for depleting target organisms in water includes a control system and a plurality of waterproof transducers. The system is configured for ensonifying a surface layer of water in an acoustic frequency range from about 40 kilohertz to about 100 kilohertz and in a power concentration range from about 35 milliwatts per milliliter to 100 milliwatts per milliliter for a duration in a range from about 1 to about 100 seconds.
US10407319B2
A photocatalytic filter including first photocatalytic particles each of which is a composite of an adsorbent and titanium apatite, second photocatalytic particles each of which is glass coated with titanium apatite, a light source configured to emit ultraviolet rays, and a container accommodating the first photocatalytic particles, the second photocatalytic particles, and the light source.
US10407309B2
Production of polycrystalline silicon in substantially closed-loop processes and systems is disclosed. The processes and systems generally involve disproportionation of trichlorosilane to produce silane or dichlorosilane and thermal decomposition of silane or dichlorosilane to produce polycrystalline silicon.
US10407308B2
A system for the exfoliation of a layered material is described, comprising in combination: an exfoliation station (14-22) operating on a volume of a dispersion of a layered precursor material, including a wet-jet milling device (10); and a collecting station (30, 40), located downstream of the exfoliation station (14-22), operating on a volume of a dispersion of the at least partly exfoliated material, in which the exfoliation station (14-22) and the collecting station (30, 40) are connected to each other through a fluid communication path (20) along which there are interposed flow regulating means (50) adapted to assume a first operating configuration in which the communication path (20) between the exfoliation station (14-22) and the collecting station (30, 40) is discontinued, where the exfoliation station (14-22) is adapted to subject a volume of dispersion of layered precursor material to a predetermined number of wet jet milling cycles; and a second operating configuration in which the communication path (20) between the exfoliation station (14-22) and the collecting station (30, 40) is continuous, where the exfoliation station (14-22) is adapted to convey a volume of previously milled dispersion including at least partly exfoliated material to the collecting station (30, 40) and is placed in communication with a supply chamber (12) to be fed with a further volume of a dispersion of layered precursor material that has to be exfoliated.
US10407300B2
An integrated structure of an MEMS pressure sensor and an MEMS inertia sensor are provided, comprising: an insulating layer formed on a substrate, a first lower electrode and a second lower electrode both formed on the insulating layer, further comprising a first upper electrode forming an air pressure-sensitive capacitor together with the first lower electrode, and a second upper electrode forming a reference capacitor together with the second lower electrode; further comprising an inertia-sensitive structure supported above the substrate by a third support part, and a fixed electrode plate forming an inertia detecting capacitor of an inertia sensor together with the inertia-sensitive structure; and a cover body which packages the inertia detecting capacitor composed of the inertia-sensitive structure and the fixed electrode plate on the substrate.
US10407296B2
An optical fluid sensor (OFS) is disclosed that includes a body defining a chamber and having one or more apertures to allow a fluid to enter the chamber, a light source optically coupled to the chamber and configured to emit light into the chamber, and a detector optically coupled to the chamber and configured to receive light from the chamber. The light source may emit IR, visible, and UV light into the chamber, and the detector may measure an intensity of one or more wavelengths of IR or visible light received by the detector. When fluid is disposed within the chamber, the light emitted by the light source may pass into and through the fluid disposed in the chamber before being received by the detector. A crossover protection system is also disclosed that includes an OFS for determining a transported liquid type.
US10407293B2
The system described herein employs electronic technology to improve the ability to dispense liquid from a container. The container can be programmed to dispense a specific amount of liquid, at a specific time. It can be voice-activated and connected to other electrical components such as a laptop or alarm system. The system may be used in laboratory equipment, medicine bottles, and food processors, although alternate methods may also be used.
US10407292B2
A beverage dispensing system including a control unit and a touch screen. Inputs are made to the touch screen to dispense beverages and apply system adjustments. The control unit controls a plurality of beverage dispensing valves according to inputs made to the touch screen.
US10407284B2
It is aimed to enable an easier attachment of a lower spreader to a machine main body. The mast 30 is tiltably attached to the machine main body 13, and operable to lie over the machine main body 13. The lower spreader retainer 40 is fixedly attached to the machine main body 13, and adapted for retaining the lower spreader 50. The connector 60 connects the mast 30 and the lower spreader 50 with each other so that the mast 30 holds the lower spreader 50. The lower spreader 50 and the lower spreader retainer 40 are arranged at a position that allows the lower spreader retainer 40 to retain the lower spreader 50 in a state where the mast 30 holding the lower spreader 50 is lowered.
US10407270B2
A press structure for a press type stationery, having mounting board (1), a button (400) and a resilient piece. The mounting board has a recess (11). A position limiting block (12) is provided at the front surface of the mounting board in this recess. A closed loop sliding track is formed between outer walls of the position limiting block and inner walls of the recess. The resilient piece has a spring (2) and a resilient rod (3). The position limiting block has a first inclined surface (122) and a second inclined surface (123). End portions of the first and second inclined surfaces are at one side of the resilient rod; upper ends of the first and second inclined surfaces are at another opposite side of the resilient rod. A contact part (4) positioned within the sliding track is provided at an upper end portion of the resilient rod.
US10407267B2
A textile feed for a stepped operation digital textile printer, comprises a textile feeding mechanism, and a tension storage mechanism. The textile feeding mechanism feeds the textile in a forward direction onto the printer, but is at the same time mechanically connected to a tension storage mechanism which is tensioned by the forward feeding. At the end of the feed step, the tension storage mechanism releases respectively stored tension to cause the feed mechanism to briefly reverse feed, thereby to pull the textile taut and take up any slack caused by the feeding step. The textile is thus kept taut, to allow effective digital printing by the printer.
US10407266B2
A transport apparatus includes a driving roller that transports a medium in a transport direction, a driven roller that presses the medium against the driving roller when the medium is transported, a changer that changes a pressing force by which the driven roller presses the medium against the driving roller, and a feeder configured to feed the medium toward the driving roller and pull back the medium in a direction opposite to the transport direction. Before the driving roller transports the medium, the feeder pulls back the medium after the changer has changed the pressing force to a value that is smaller than the value of the pressing force set for transport of the medium.
US10407261B2
In a paper feeding apparatus, paper feed rolls in paper feed roll rows for feeding the lowermost one of cardboard sheets placed in a stacked manner on a paper feeding table intermittently one by one toward the printing device are coupled via shafts to separate servomotors. The servomotors are controlled so to be accelerated synchronously and rapidly from a stopped state to a high rotational speed during one cycle of feeding through contact with the lowermost cardboard sheet, while controlled so to be decelerated from the high rotational speed to be stopped rapidly and respectively when determined not to be in contact with the lowermost cardboard sheet.
US10407253B2
An automated method and system for distributing prescription vials from upstream locations of a pharmacy to various downstream destinations using a stacked configuration of outbound lanes so that vials will enter the first outbound lane that is not blocked. The distribution table of the present invention has a lower portion having outbound lanes and an upper portion having outbound lanes and where the table is adapted to move vials in a loop pattern around the lower and upper portions.
US10407251B2
A workpiece handling apparatus is configured to supply and discharge a workpiece to and from a first conveyor configured to convey the workpiece. The workpiece handling apparatus includes a storage, a conveyance device, and a workpiece transfer robot. In the storage, a case for the workpiece is storable. The conveyance device is configured to convey the case between the storage and a predetermined work position. The workpiece transfer robot is configured to transfer the workpiece between the case conveyed to the work position and the first conveyor.
US10407247B2
A vibratory conveyor with a base frame, a vibrating frame mounted on the base frame and is vibrated relative to the base frame by a vibratory drive, and a conveyor trough made of a continuous flexible mat. The flexible mat is alternately connected to the base frame and the vibrating frame at connection points which are mutually spaced when seen in the longitudinal direction of the conveyor trough. A respective mat portion lies between each pair of connection points adjoining each other in the longitudinal direction of the conveyor trough. The vibrating frame can be vibrated relative to the base frame by means of the vibratory drive, and mat portions adjoining one another in the longitudinal direction of the conveyor trough are thus alternately stretched and slackened in a push-pull mode.
US10407246B2
In order to specify a transport apparatus in the form of a long stator linear motor, by which the negative effects of a non-uniform magnetic flux in the joint region between two adjacent transport segments can be at least alleviated, according to embodiments, the spacing between the coil center of an end coil of a transport segment and the relevant end of the transport segment is smaller than half the tooth pitch of the two adjacent end coils of the transport segments, the tooth pitch of the two adjacent end coils corresponding to the tooth pitch of the drive coils of at least one of the transport segments.
US10407240B2
Disclosed is a universal trash can spacer, a rigid spacer of particular shape designed to rest on the floor between a flip-top trash can and the wall of a building, in order to keep the can away from the wall and prevent the open lid of the can from hitting the wall and causing damage to the wall or can lid. Since flip-top trash cans come in many sizes and shapes (square, rectangular round, oval, etc.), the spacer device may be able to accommodate any and all such cans.
US10407228B2
A fabric folding article includes guide sections, cover section, and fold sections, cooperating to fold, place, and secure a fabric article inside the apparatus. The guide sections comprise three sections and folding sections comprise four sections cooperating to fold and place the article within the apparatus. The cover sections operate to secure the fabric article within the apparatus. The entire apparatus is made from a single material. Alternatively, the guide sections and the cover sections are made from a first flexible material and the fold sections are made from a second flexible material.
US10407220B2
A closure includes a top panel and a corner section connecting an outer periphery of the top panel with a downwardly extending annular skirt. A plurality of gently curved ridges are spaced about the outer perimeter of the closure. The ridges generally extend from a lower portion of the skirt and around the corner section, with the upper ends of the ridges terminating proximate the top panel outer periphery. A plurality of knurls extend radially outwards from the midpoints of the ridges along the skirt of the closure. The configuration, arrangement, and spacing of the ridges and knurls about the closure provide an enhanced grip and feel, allowing for easier twist-off of the closure from a container. The closure may be used interchangeably with existing capping chucks used to apply conventional closures without requiring any modification to the capping chucks to apply the closures to containers during a capping process.
US10407219B2
Provided is a method for making barrier tube shoulders. The method includes forming a parison from a multi-layer laminated structure having an inner layer that faces an interior of the parison, an outer layer comprising an exterior surface of the parison, and an interdisposed layer between the inner layer and the outer layer, wherein the interdisposed layer is a flavor barrier layer. The method also includes providing an extrusion blow molding (EBM) mold comprising at least one cavity shaped as a barrier tube shoulder, positioning the parison in the EBM mold, and blow molding the parison such that the parison substantially conforms to the EBM mold to form a barrier tube shoulder having the barrier layer.
US10407210B2
The FFS plastic container for a dairy product or similar food composition is provided with a body having a side wall extending along a longitudinal axis from a bottom to a top that defines a wide upper opening. The container, which is provided with a generally planar annular flange integral with the body and extending around the upper opening, has a decorative layer around the side wall. The upper portion of the side wall tapers toward the opening. Either a peripheral bulge is formed in the side wall at a junction between the upper portion and a lower portion, or the lower portion has a generally cylindrical shape. The decorative layer is defined by a plastic sleeve that includes a shrink film annularly secured to the upper portion, the sleeve extending adjacent or over the junction.
US10407201B1
Printing systems may include a rotatable tamp head that may be repositioned, as necessary, in order to cause a label to be printed in a specific location or in a certain alignment on an object. Such tamp heads may be repositioned as necessary where the label may cross a seam, a crease, a fold or another surface feature which might cause the label to be bowed or damaged in transit. The tamp head may be positioned in a manner that would enable any information, markings or bar codes thereon to remain legible and intact even if the label is applied across such a surface feature. An orientation of the object may be determined using one or more sensors aligned at various angles with respect to a direction of travel of the object.
US10407198B2
A method for dividing a blister strip having a plurality of blister-packaged drugs apportioned into separate sections of the blister strip is provided. A blister strip with a substrate having a plurality of depressions for drug portions is provided and an image of the substrate is generated by a 3D-sensor device. A control device evaluates the image with image analysis. Based on the analysis results, an arrangement of the depressions is determined and control signals for a separating device are generated. The blister strip is then divided into a plurality of blister strip parts based on the control signals. A blister strip dividing device is also provided.
US10407195B2
A pickup and delivery station for products includes a movement arm that is articulated with respect to a fixed frame and supports, at its free end, at least one respective grip component for a product. The free end of the arm includes at least one track for two carriages for supporting at least one respective shaft that supports the grip component. A linear actuator, which is substantially parallel to the direction of the track, is associated with one of the carriages for its movement along the track, from a configuration of separation from the other carriage to a configuration of proximity thereto. The shaft of a respective grip component is coupled to a second linear actuator that is perpendicular to the first one for the offset of the respective grip component with respect to the contiguous ones.
US10407194B2
A method and system involves vacuum sealing a semi-enclosure at room temperature without requiring mechanical actions within the vacuum chamber. The semi-enclosure has an inlet channel that extends inwardly into the vacuum chamber from an exterior opening (entryway) into the semi-enclosure. An uncured entryway vacuum sealant is provided at the entryway for the semi-enclosure. A vacuum is established in the vacuum chamber until the vacuum pressure reaches a desired vacuum pressure that causes the uncured entryway sealant to be provided to the entryway for the semi-enclosure. The uncured entryway vacuum sealant is cured under vacuum pressure in the semi-enclosure in the vacuum chamber.
US10407193B2
A machine for the wrapping of pallets (P) by means of a stretchable film cap, comprising: a main frame (1) which defines a working area (A) of the machine; a traction device (2), predisposed for lowering the film cap and for fitting it onto the pallet (P); a feeder device (3) arranged to feed the film to the traction device (2); a cutting and welding device (4) of the film, arranged to cut and weld the film so as to obtain a cap closed at one end thereof;in which the feeder device (3) is movable along the frame (1) between an operating position, located superiorly to the main frame (1), and a service position, in which said feeder device is located at a given height from the ground, on one side of the main frame (1).The feeder device (3) is movable on an outside area of the main frame (1) and, when switching from the operating position to the service position, the feeder device (3) is maintained externally of the main frame (1), without cluttering the working area (A).
US10407191B1
The system may be configured to receive a selection of a plurality of timepoints corresponding to an orbital object. The selection of the plurality of timepoints can include sets of identifiers within the selected time period. The system may further be configured to determine an orbital path of the orbital object associated with the selected plurality of timepoints. The orbital path may be determined over an orbital time period that includes a first time period that (i) overlaps the selected time period, (ii) precedes the selected time period, (iii) succeeds the selected time period, or (iv) any combination thereof. The system may generate a display interface that includes a longitude-time graph having a longitude axis spanning from a lower-longitude limit to an upper-longitude limit, a time axis spanning from the lower-time limit to the upper-time limit, and an indication of the orbital path spanning at least the first time period.
US10407190B2
A method for arranging a plurality of spacecraft comprises the following steps: arranging a first layer of spacecraft around a dispenser; fixing the spacecraft of the first layer to the dispenser using mechanical interfaces extending in a radial direction; arranging a second layer of spacecraft around the first layer and the dispenser, the spacecraft of the second layer being arranged that they extend beyond, in a longitudinal direction of the fairing, the spacecraft of the first layer which are interposed between them and the dispenser; fixing the spacecraft of the second layer to the dispenser using mechanical interfaces extending in a radial direction over a distance greater than that of the mechanical interfaces of the first layer; and arranging the assembly thus obtained, under the fairing of a launcher. Assembly of spacecraft that can be obtained by the method and a dispenser suited to the assembly is provided.
US10407184B2
A debris removal device includes: an end mass adapted to approach debris to be removed; a debris capture device separably-mounted on the end mass; and a tether connecting the debris capture device and the end mass to each other. The debris capture device includes a harpoon adapted to penetrate into the debris, a shooting device adapted to shoot the harpoon, a guide member positioned to come into contact with the surface of the debris to adjust the shooting angle of the harpoon with respect to the surface of the debris, and a switch that sends the shooting signal to the shooting device. When the harpoon is penetrated into the debris, the end mass is separated from the debris capture device, and the tether is released into outer space.
US10407179B2
A vehicle system includes a control unit with a weather module configured to receive weather data and to identify a wind shear zone at a location based on the weather data, the weather module further configured to generate wind shear coordinate data and wind shear characteristic data based on the weather data. The control unit further includes a display module configured to generate display commands based on the wind shear coordinate data and wind shear characteristic data from the weather module. The vehicle system further includes a display device coupled to receive the display commands from the control unit and configured to display a three-dimensional forward perspective view corresponding to a vehicle environment. The display device is further configured to display first wind shear symbology within the view at a position that indicates the location of the wind shear zone.
US10407176B2
In an illustrative embodiment, a seat is oriented at an oblique angle with respect to a centerline of an aircraft fuselage, the seat having an Aircraft Passenger Restraint System (APRS) with a pre-tensioner and integral retractable shoulder and seat belt webbing. In an illustrative example, the ARPS may be a three-point restraint to control a seat occupant's upper body, head and torso area. In some embodiments, the ARPS may further control the forces on the lower spine and torso. In some applications, the ARPS may operate to control the Head Injury Criteria (HIC) levels for the seat occupant's head, as well as the neck twist and upper spinal forces, to meet aircraft certification requirements imposed by the Federal Aviation Administration (FAA) and/or European Aviation Safety Agency (EASA). In response to a deceleration event, the ARPS may rapidly retract the belt webbing to substantially remove slack.
US10407173B2
A galley cart system employs a dry ice compartment and a refrigeration compartment in a galley cart in flow communication with the dry ice compartment. A ventilation system is in interruptible flow communication with at least the refrigeration compartment and configured to receive gas discharged from at least the refrigeration compartment.
US10407171B2
The present invention discloses an unmanned aerial vehicle, including: a fuselage; a battery accommodation cavity, disposed on the fuselage; a battery pack, including at least two battery blocks and mounted inside the battery accommodation cavity; a battery circuit board, electrically connected to the battery blocks in the battery pack; and a functional module, electrically connected to the battery circuit board, the battery blocks in the battery pack supplying power to the functional module via the battery circuit board at the same time. By using the solution of the present invention, endurance of the unmanned aerial vehicle is increased.
US10407152B2
According to one embodiment, an aircraft features a fuselage, a wing member, and two fuselage beam. The fuselage features a first plurality of structural supports, a second plurality of structural supports, a first opening disposed between the first plurality of structural supports, and a second opening disposed between the second plurality of structural supports. The wing member is disposed above the first opening and above the second opening. The wing features a plurality of ribs including a first rib and a second rib. The first fuselage beam couples the first rib of the wing member to the fuselage and has an elongated body portion extending across the first plurality of structural supports. The second fuselage beam couples the second rib of the wing member to the fuselage and features an elongated body portion extending across the second plurality of structural supports.
US10407151B2
An aircraft of flying wing or blended wing body type comprising, for access to a pressurized housing, a non-pressurized door in the trailing edge of the aircraft and a pressurized door on the pressurized housing. The distance between the center of the pressurized door and a plane of symmetry of the aircraft is less than or equal to the distance between the center of the non-pressurized door and the plane of symmetry, and the pressurized door is located on a wall other than a rear wall of the pressurized housing or upstream of a rear extremum point of the housing in the absence of any such rear wall.
US10407149B2
The arrangement comprises a seal (500) sealing a cylindrical rotating part (100) passing through an opening in a support structure in the vessel (10) against a medium (W). The seal (500) comprises a package of annular seal rings (510, 520, 530). Each seal ring (510, 520, 530) comprises a seal part (512, 522, 532) being supported in a corresponding seal support part (511, 521, 531). The seal support part (511) in the first seal ring (510) positioned closest to the medium (W) has the form of a cylinder (511A) provided with an annular flange (511B) at one end of the cylinder (511A). The outer surface of the cylinder (511A) is supported and sealed with an auxiliary seal (610) against the inner circumference of the opening. The annular flange (511B) is supported against the support structure (83) surrounding the opening. There are adjusting means (900) for adjusting the position of the first seal support part (511) in relation to the support structure (83) surrounding the opening in order to relocate the seal (500) in an axial direction in relation to the rotating part (31, 100).
US10407143B2
Dive computers incorporating a variety of features are disclosed. One embodiment of the invention includes a dive computer including a microprocessor, memory configured to store a software application, a pressure transducer configured to determine depth information, and a communications device configured to communicate with external devices, wherein the software application configures the microprocessor to create a dive log stored in memory, wherein the dive log includes recorded information including depth of submersion information recorded from the pressure transducer, and transmit the dive log using the communications device.
US10407141B2
A vessel has a compartment (34) for containing water, which compartment (34) has at least one opening (31) in a wall (30) thereof for allowing water to pass therethrough. The compartment (34) comprises an assembly (1) of a grating (10) and at least one anti-biofouling source (20), the grating (10) being positioned in the opening (31) for blocking items from passing through the opening (31) along with the water, and comprising a number of elements and spaces between the elements, and the anti-biofouling source (20) being configured to emit ultraviolet light during operation thereof for realizing anti-biofouling of at least a portion of the grating (10). At least one of the elements of the grating (10) is at least partially transparent to the ultraviolet light, enabling a design of the assembly (1) in which anti-biofouling of the entire grating (10) may be guaranteed.
US10407132B2
A device and a method for attaching a cover to a structure includes a female snap having a central open surface to receive by friction fit a complementary male snap, a lever connected to the female snap, wherein the lever extends sufficiently out from the female snap to enable one to gain grasp of the lever, and a pin having a piercing portion which serves to retain a fabric material.
US10407119B1
A scooter apparatus and methods of use are disclosed where the scooter comprises a locking assembly generally having a neck latch cam having an elongate member and an angled member configured to rotate relative to a first pivot and a pivot throat latch positioned in proximity to the angled member and configured to rotate relative to a second pivot when actuated via the angled member. The locking assembly further includes a neck latch configured to rotate relative to a third pivot and a neck latch receiving member configured to lock a position of the neck latch when rotated about the third pivot upon actuation of the neck latch cam when rotated about the first pivot and the pivot throat latch when rotated about the second pivot.
US10407117B2
A scooter includes a connecting seat and a connecting bar extending rearward of the connecting seat, at least one rotatable front wheel and at least one rear wheel; a handle bar to control turning of front wheel; and a foot pedal connected to the connecting bar, the foot pedal having a left foot pedal portion and a right foot pedal portion; each of the left and right foot pedal portions being configured to support a rider's left foot and right foot, respectively, to lie substantially parallel to the connecting bar. The front wheel has a diameter, and the front and rear wheels are spaced apart a lateral distance, and wherein a ratio of the diameter to the lateral distance is selected to allow a rider to propel the scooter along flat ground without pushing the feet along the ground. The front wheel may have a rounded shape as seen from front view to establish substantially tangential line contact with a rolling surface. The pedal defines a support surface for the rider's feet, and the support surface may be positioned above a plane connecting a rotation axis of the front wheel and a rotation axis of the rear wheel.
US10407113B2
An LED driver is provided. The LED driver comprises a plurality of driving units and a fold circuit. The driving units are coupled to an LED string including a plurality of LEDs for driving the LEDs. The fold circuit is coupled to the LED string and divides the LED string into a plurality of LED segments when an input voltage is lower than a threshold voltage. The LED segments are coupled to each other in parallel, and the input voltage is supplied to the LED segments.
US10407109B2
An instrument panel reinforcement includes a large-diameter pipe portion, a diameter-changing pipe portion, which extends to one end side continuously and integrally from one end of the large-diameter pipe portion, and a small-diameter pipe portion, which extends to the one end side continuously and integrally from one end of the diameter-changing pipe portion. By performing a process of drawing a circular tube-shaped element tube to the one end side while reducing a diameter of the element tube by ironing more than once, the large-diameter pipe portion, the diameter-changing pipe portion, and the small-diameter pipe portion are formed integrally, thereby manufacturing the instrument panel reinforcement.
US10407100B2
The present disclosure provides a vehicle body frame structure including: a side rail extending in a vehicle longitudinal direction and disposed so as to face a front tire in a vehicle transverse direction; a cab mount member projecting toward a vehicle transverse direction outer side, from a region of the side rail that is further toward a vehicle rear side than the front tire, and to which a body is mounted; and a projecting portion projecting toward the front tire from a region of the cab mount member that is away from the side rail in the vehicle transverse direction.
US10407091B2
An electric power steering control apparatus that assists a steering operation made by a driver with a motor includes: a target torque calculation unit calculating a target steering torque; an assist torque calculation unit calculating an assist torque which enables an actual steering torque follows close to the target steering torque according to a difference therebetween; a motor drive unit driving a motor acting on a steering system mechanism so that a steering angle of vehicle is changed according to the assist torque; and a followability change unit that detects an abnormality of a torque sensor for detecting the actual steering torque. When abnormality is detected in the torque sensor, a followability of the actual steering torque to the target steering torque controlled by the assist torque is degraded compared with a case where no abnormality is detected in the torque sensor.
US10407089B1
An off-road walker is a support apparatus to assist or support an infant or toddler child to be mobile. The off-road walker includes a toy tray, a walker frame, an adjustable support, a plurality of casters, a plurality of frame guards, and a seat assembly. The toy tray supports objects for the child to interact with. The walker frame and the plurality of casters support the weight of the child and the toy tray through the adjustable support. The adjustable support allows the parent to set the distance the toy tray is displaced from the walker frame. The plurality of frame guards protects the walker frame from uneven terrain and can be positioned to assist the parent in maneuvering the off-road walker across the uneven terrain. The seat assembly supports the child and suspends the child from the toy tray and allows the child to rotate within the off-road walker.
US10407087B1
A vehicle door removal and storage dolly using a height controllable upper frame with side extending door support platforms that allows the vehicle doors to be positioned both vertically and horizontally for installation and removal from a vehicle. The extending door platforms are planarly aligned for a compacted position and include padded vertical door supports for supporting the vehicle doors during storage periods.
US10407086B2
A device and a method for operating decentralized functional units in an industrial system include a) a higher-level control system which exchanges information with the decentralized functional units by data telegrams, b) a data transport network with network access points; c) communication units connected to a network access point and providing the decentralized functional units with access to the data transport network; d) an energy transport network to which the decentralized functional units are connected and which supplies electric energy to the decentralized functional units; e) intelligent energy storage devices connected to the energy transport network and consuming or outputting energy in accordance with the higher-level control system and/or with at least one of the remaining energy storage devices. The energy transport network has energy supply points distributed along a bus structure. Selectively one of at least two independent energy backbones can supply corresponding electric power to the supply points.
US10407085B2
A train travel prediction device includes a required time database that records a station-to-station required timetable created in advance between stations and indicating a relation of a time difference between a last station departure time of a target train and a next station departure time of a precedent train with respect to a required time of the target train to a next station by the use of a train simulation on the basis of a train moving condition and an operation prediction unit that creates a prediction schedule on the basis of information of the required time acquired for each target train during a prediction period by referring to the station-to-station required timetable recorded in the required time database on the basis of information of a train schedule and a train arrival-departure time.
US10407073B2
A traction control system is provided for a vehicle having wheels driven on a primary axle via an engine, and wheels on a secondary axle torsionally isolated from the engine. Wheel speed sensors and brakes are provided for each wheel. A motor/hydraulic pump is operatively associated with each secondary axle wheel for selectively powering the secondary axle wheel or being regenerativly powered by the secondary axle wheel for regenerative braking. A clutch is provided to connect each secondary axle wheel with the secondary axle wheel's motor/hydraulic pump. An accumulator is provided to hydraulically power the secondary axle wheels and to accept regenerative pressure from the secondary axle wheel's motor/hydraulic pump. A wheel valve is provided for each respective secondary axle wheel for selectively connecting the secondary axle wheel's motor/hydraulic pump with the accumulator. A controller is provided to control the primary axle and secondary axle wheels. The controller commands braking and powering of the primary and secondary axle wheels during low traction events.
US10407072B2
A vehicle traction control system for a vehicle, in which the vehicle has a prime mover, at least one wheel for providing tractive effort on a support surface, and a transmission having an input side operably coupled to the prime mover and an output side operably coupled to the at least one wheel, and in which the transmission has a controllable clutch pressure between the input side and the output side, includes a controller operable to monitor wheel slip of the at least one wheel. When wheel slip is detected the controller is operable to control the clutch pressure for modulating an output torque of the transmission for reducing the wheel slip. The clutch pressure can be controlled as a function of clutch slip.
US10407070B2
A control device for a vehicle includes: an engine (10); an engine torque adjustment mechanism for adjusting an output torque of the engine; and a PCM (50) configured, upon satisfaction of a vehicle attitude control executing condition that the vehicle is traveling and a steering angle-related value is increasing, to control the engine torque adjustment mechanism to reduce the engine torque to thereby generate deceleration of the vehicle so as to control vehicle attitude. The PCM (50) is further configured to set a rate of change in the engine output torque being reduced, such that the rate of change becomes larger as the number of times of combustion per unit time in the engine (10) becomes smaller, and to control the engine torque adjustment mechanism to reduce the engine output torque according to the rate of change set by the torque reduction change rate-setting part.
US10407068B2
A method of releasing an Automatic Vehicle Hold (AVH) function of an automotive vehicle equipped with a pedal simulator is provided. During operation of the AVH function, either a first mode for releasing the AVH function by an increase of torque of a power train by depressing the accelerator pedal or a second mode for releasing the AVH function by an increase of torque of the power train by depressing the brake pedal again is selected according to driving conditions.
US10407067B2
A hill start assist system for a motor vehicle including a control system using sensor data from at least one sensor to provide the hill start assist with improved response behavior. The control system activating the hill start assist automatically and independently of whether the motor vehicle is on an upward incline depending on sensor data from the sensor indicating a local upward gradient in a driving surface in a region of a vehicle axle.
US10407066B2
A vehicle control apparatus mounted to an own vehicle to control the own vehicle according to a position of other vehicle ahead of the own vehicle is provided. The device includes a setting means setting a parameter indicating a position of the other vehicle relative to the own vehicle in a lateral direction perpendicular to the path of the own vehicle, a determination means determining whether the other vehicle is in the path of the own vehicle based on the parameter, a detection means detecting whether a relative movement has been made in the lateral direction by at least one of the own vehicle and the other vehicle, and a correction means correcting the parameter when a relative movement has been made in the lateral direction.
US10407064B2
A method for controlling driving of an SSC-cruise system is provided. The method includes determining whether a cruising function is operated and receiving a target vehicle speed set by the driver and deriving a first offset vehicle speed from the target vehicle speed, when the cruising function is operated. Additionally, the method includes determining whether a second offset vehicle speed is set by the driver and entering the vehicle into SSC in a driving section between the target vehicle speed and the second offset vehicle speed, in response to determining that the second offset vehicle speed is set.
US10407060B2
A method for operating a driver assistance apparatus includes: recognizing a driving environment of a vehicle; determining a driving mode based on the driving environment; determining whether the vehicle is driven using at least one sensor based on the driving mode; and controlling steering and braking of the vehicle based on whether the vehicle is driven using the at least one sensor.
US10407042B2
A device is provided for predicting the remaining lifetime of a component in a compressed air supply system for a vehicle. This device includes a memory unit for a value related to the degradation of the component, at least one first input for a usage quantity which is a measure for the operating time and/or number of operating cycles of the component and/or for the amount of compressed air delivered by the compressed air supply system, at least one second input for at least one state variable which is a measure for at least one vehicle and/or air supply operation condition or environmental condition. It also includes an evaluation unit that is configured to combine the usage quantity and the state variable into a lifetime decrement value that is a measure for the degradation of the component caused by the usage according to the usage quantity, and update the value in the memory unit according to this lifetime decrement value.
US10407041B2
An electric parking brake actuator has a transmission mechanism, which is rotationally drivable by an electric motor and converts rotational movement into an axial movement of an actuating rod that carries an actuating element for the parking brake. The actuating rod normally moves by electric motor displacement via the transmission mechanism from an unblocking position to a blocking position and vice versa. A blocking mechanism serves the purpose of holding the actuating rod in the unblocking position of the actuating rod against the force of a spring element. A blocking disc, which is in drive connection with the transmission mechanism, has a stop surface for a locking device in only one rotational direction of the blocking disc. For secondary alternate operation the stop surface is releasable by the locking device so that the actuating rod is biased by the spring element to the blocking position without electric-motorized assistance.
US10407039B2
Even when downstream stiffness in a brake hydraulic circuit changes due to variation in a caliper forming a part of a wheel cylinder, temperature, wear degree, and deterioration of a frictional pad, and/or the like, a brake control apparatus performs calculation processing for calculating a switching reference operation amount, switching operation amount deviation calculation processing for calculating a deviation from the switching reference operation amount, operation amount offset processing for offsetting a pedal operation amount detected by an operation amount detection unit, target hydraulic pressure calculation processing for calculating the target hydraulic pressure with use of the offset operation amount and a reference hydraulic characteristic, and control of the electric motor (21) according to the target hydraulic pressure. By this configuration, the brake control apparatus limits an excessive movement amount of a primary piston by changing the reference hydraulic characteristic according to the change in the downstream stiffness.
US10407037B2
A pneumatic brake system (110) for a commercial vehicle (1) has one spring brake (27), a protection valve (56), a parking brake unit (30), a network of pipelines (40), at least a first (4) and a second (5) tank with compressed air and a relay valve (19) for the parking brake unit (30). A first subnetwork of pipelines (40a) comprises pipelines configured to be pressurized at all times. A second subnetwork of pipelines (40b) comprises at least one pipeline configured to be non-pressurized when the parking brake function is applied. The first subnetwork (40a) comprises pipelines establishing fluid communication between the tanks (4, 5) and the parking brake unit (30), wherein the direction of air flow in these pipelines is by at least one thereto associated valve (50). A method for managing an air flow to an air-actuated spring brake (27) of a pneumatic brake system (110) is disclosed.
US10407031B2
A parked freight trailer stabilizer and restraint comprising: (a) a kingpin receiver configured to lock onto a kingpin of a parked freight trailer; (b) a jack operatively coupled to the kingpin receiver, the jack repositionable between a retracted position and an extended position; (c) a tail hold operatively coupled to the kingpin receiver, the tail hold repositionable between a stowed position and a restraining position, the tail hold configured to engage a ground mount; and, (d) a transport receiver configured to engage a transport vehicle.
US10407030B2
A filler neck for use with an automotive fluid container having a body that includes an opening in communication with a reservoir and a fluid passageway for allowing fluid to flow through the body into the container. The reservoir and the fluid passageway are configured to regulate fluid flow through the body. The reservoir has a fill limit section. The body further includes an air passageway, an air channel and an exhaust port for allowing displaced air from the container to flow through the body. The air passageway, the air channel and the exhaust port are integrally formed with the body. The exhaust port is positioned above the fill limit section to maximize air exhaust and minimize fluid leakage from the body.
US10407028B2
A rain sensor according to an embodiment comprises: a substrate; a sensing electrode formed on a first surface of the substrate; a reaction layer formed on the first surface of the substrate and burying an upper surface of the substrate and the sensing electrode; a driving unit electrically connected to the sensing electrode formed on the first surface of the substrate and processing a sensing signal transmitted through the sensing electrode; and a protective layer formed surrounding the driving unit, wherein an impedance value according to a change of at least one of a force and a dielectric constant caused by presence of rainfall is changed, and the sensing electrode transmits the sensing signal with respect to a variation amount of the impedance value of the reaction layer to the driving unit.
US10407021B2
An alert system to assist in child safety in a vehicle includes a seat belt buckle insert adapted to be inserted between the male and female parts of a standard safety belt found in most automobiles or for a child car safety seat. It may also include a portable receiver device designed to be carried by a vehicle operator. The seat belt buckle insert detects whether the seat belt has been buckled and the temperature is within an acceptable range, as well as the approximate distance between the seat belt buckle insert and portable receiver device. The seat belt buckle transmits information gathered to the portable receiver device and triggers alerts notifying the vehicle operator of a child's safety status.
US10407020B2
Embodiments disclose systems and methods associated with safety devices for vehicles. Specifically, embodiments are directed towards a user operated, manually controlled, inflatable safety device for off-road vehicles, which may reduce, eliminate, or lessen upper body and head injuries.
US10407019B2
A head-protecting airbag device includes a case which houses an airbag in a folded-up configuration and a mounting bracket which is used to mount an inflator on a vehicle body structure. The case is mounted on a region of the airbag extending from one end of the inflator. The mounting bracket includes an insert region which fits in an assembling opening of the case. The assembling opening includes a receiving region which receives the insert region along an axial direction of the inflator and a limiting plane that is located in a periphery of the receiving region and holds the insert region from rotating in both directions in a circumferential direction of the inflator. The fitting of the insert region and assembling opening suppresses the airbag stored in the case in the folded-up configuration from rotating in a circumferential direction.
US10407018B2
A system includes a roof and an airbag supported by the roof. The airbag is inflatable away from the roof to an inflated position. The airbag includes an apex adjacent to the roof. The airbag includes a first leg inflatable away from the apex to an end, and a second leg inflatable away from the apex to an end spaced from the end of the first leg. The airbag includes a bottom portion spaced from the apex and inflatable to the inflated position. The bottom portion extends from the end of the first leg to the end of the second leg.
US10407015B2
A restraint system includes a seat and a seat airbag supported by the seat and inflatable to an inflated position. The restraint system includes an instrument panel and a forward airbag supported by the instrument panel and inflatable to an inflated position. When the seat airbag is in the inflated position and the forward airbag is in the inflated position, the seat airbag extends from the seat to the forward airbag.
US10407014B2
Devices and methods are disclosed for detecting or predicting an underride impact. An example vehicle includes a camera for capturing an image of a target vehicle, sensors for detecting a speed and heading of the vehicle, and a processor. The processor is configured to determine a target vehicle classification, determine an open space of the target vehicle, determine a closing speed between the vehicle and target vehicle, predict an underride impact based on the classification, open space, and closing speed, and responsively execute an impact action.
US10407010B2
A strengthening member for an automobile includes a cellular structure having a plurality of cells. A cross section of each cell has eight sidewalls interconnected at eight corners to define a closed polygon. The sidewalls define eight internal angles located at the corners. Two of the internal angles are acute and two of the internal angles are reflex.
US10406994B2
An in-vehicle camera is provide which has a case and a lens, and which is attached in a vehicle interior so that the lens is exposed at a top face of the case and the top face is opposed to a windshield or another window. The top face has an angular shape bent at a ridge line passing through the top face. The lens is positioned in the vicinity of the ridge line. The in-vehicle camera includes a hood attached to a front portion of the case, the front portion being positioned at a front side of the case with respect to the lens.
US10406989B2
A vehicle accessory mounting device according to some embodiments of the disclosure is configured to attach accessories to a spare-tire hub assembly of a vehicle. The vehicle accessory mounting device includes a first member attached to the spare-tire hub assembly, a second member which is movable relative to the first member, and a handle which is movably attached to the second member. The second member includes pin ends which are configured to engage within slots in the first member. A locking protrusion is provided to lock the second member into place relative to the first member. A locking assembly is provided to lock the handle into place relative to the second member.
US10406985B2
The armrest comprises an arm support that is vertically adjustable by an adjuster that is held on the vehicle frame. The adjustment takes place here independently of a storage compartment. In this way, the vertical position of the armrest can be adapted to the size of the occupants of the seat. The adjuster can be operated with a manual drive or electrically as an alternative, for example. The adjuster has a guide fixed to the vehicle frame and a slide that carries the arm support and that is vertically shiftable on the guide.
US10406979B2
A user interface apparatus for a vehicle includes a display unit; an interface unit that receives information; at least one processor; and a computer-readable medium having stored thereon instructions that, when executed by the at least one processor, causes the at least one processor to perform operations that include: receiving, through the interface unit, first information regarding a planned autonomous parking operation of the vehicle, and second information regarding a progress of an autonomous parking maneuver performed by the vehicle based on the planned autonomous parking operation; displaying, through the display unit, a graphic object corresponding to the first information regarding the planned autonomous parking operation of the vehicle; and controlling the display unit to apply an animation effect to the graphic object being displayed, the animation effect corresponding to the second information regarding the progress of the autonomous parking maneuver performed by the vehicle.
US10406965B1
A strap holding and placement system that propels a rolled up strap over a load such as a truck bed. A handle attaches to a strap part that holds a rolled up strap. The strap part has multiple surfaces for holding the rolled strap. The multiple surfaces include a first rounded portion, which holds only a portion of the rolled strap, and a second curved portion above the rounded portion, which enables the strap to be propelled from the strap part from an area near a distal end of the strap part, when the handle is moved to propel the strap. The strap is held below the level of the front surface, in a rounded surface that is recessed below the front.
US10406957B2
A head restraint for a seating assembly of a vehicle comprising: an exterior surface; one or more interior wall surfaces disposed beneath the exterior surface forming an internal receptacle; an opening into the internal receptacle; the internal receptacle comprising a bottom; and the one or more interior wall surfaces are configured to prevent an object resting on the bottom from falling out of the internal receptacle through the opening during normal use of the vehicle.
US10406956B2
A seat assembly is provided for supporting in an automotive vehicle. The seat assembly comprises a seat cushion and a seat back pivotally coupled to the seat cushion for movement between a reclined seating position and a fold flat position. A recliner assembly is coupled between the seat back and the seat cushion to provide pivotal movement of the seat back. A riser assembly is pivotally coupled to the seat cushion and pivotally latched to the floor to allow pivotal movement of the seat cushion between a horizontal seating position and a forwardly upright tumbled position. A release mechanism is coupled between the seat back and the riser assembly for automatically synchronizing actuation of the recliner assembly and the riser assembly to provide movement of the seat assembly to the tumbled position in response to the pivotal movement of the seat back to the fold flat position.
US10406953B2
An attachment of a surface cover to a seat back in a vehicle seat having through-holes is described. A bucket seat includes a pad provided with through-holes, a surface cover configured to cover a front surface of the pad, and a back frame disposed on a back side of the pad. The back frame includes: a support portion provided with through-holes positioned to face the first through-holes, the support portion being configured to support the pad; and retaining portions provided around the through-holes and configured to retain hooks of the surface cover. The support portion and the retaining portions are integrally molded.
US10406942B2
In a slide rail device for use in a vehicle , a lock spring support portion of an upper rail includes an upward-downward movement restriction support portion. The upward-downward movement restriction support portion includes an open holding portion which is open at a top thereof and holds a supported portion of a lock spring and an uplift prevention projection which is formed projecting into the open holding portion so as to overlap the supported portion of the lock spring, which is held by the open holding portion, in the upward and downward directions.
US10406925B2
A wireless charging system for use in vehicles includes power transmitting coils which are used for resonant power transfer to power receiving devices in the vehicle. The system includes a detection system for detecting power receiving devices in the vicinity of the transmitting coils so that only the power transmitting coils having objects detected nearby are activated. The system also includes a tuning circuit that enables power transmitting coils to be tuned with respect to each other to increase the power delivery range or detuned with respect to each other to decrease interference between coils.
US10406905B2
In the case that an all-cylinder operational state is detected by an ENG vibration pattern determining function, an ACM-ECU executes an amplitude variable—phase fixed control. Further, in the case that a cylinder paused operational state is detected by the ENG vibration pattern determining function, the ACM-ECU executes an amplitude variable—phase variable control exhibiting a large vibration damping effect.
US10406894B2
A water shield member includes a cup-shaped concaved portion that has an opening, a hinge portion and a flange portion. The hinge portion extends from the concaved portion and extends around the opening of the concave portion, the hinge portion having a first thickness. The flange portion extends around the hinge portion and the concaved portion. The flange portion is spaced apart from the concaved portion and defines a first plane. The flange portion has a second thickness greater than the first thickness. The concaved portion, the hinge portion and the flange portion are all made of a common material.
US10406893B2
A door inner support panel for a vehicle door assembly includes a header section with a window frame for receiving a windowpane. A shell section is attached to the header section and mounts to a door frame of a body of a vehicle. The shell section has a hardware frame for mounting a hardware module. The hardware frame includes: a mounting interface on the an inboard surface of the shell section for coupling to an outboard surface of the hardware module; a mounting interface on a flanged surface of the shell section for sealingly attaching to a peripheral surface of the hardware module; and a mounting interface on the outboard surface of the shell section for coupling to an inboard surface of the hardware frame. A method of making the door inner support panel is also disclosed.
US10406868B2
A tire equipped with a sensor patch includes a sensor module and a sensor patch. The sensor patch is formed integrally with the inner liner of the tire by being vulcanized into the inner circumferential surface, and an accommodation space is formed in a region so that the sensor module can be fixed therein. A sensor patch is integrated with the inner liner without damaging the inner liner, and thus the sensor patch can be strongly bound to the tire. Furthermore, since the sensor patch is formed to have a thickness smaller than the thickness of the inner liner, when the sensor patch is vulcanized into the inner liner, the pressure of the bladder being exerted locally non-uniformly on the inner liner can be prevented.
US10406864B2
A tire includes a tread portion provided with at least one circumferentially and continuously extending shoulder main groove and at least one circumferentially and continuously extending crown main groove. The at least one crown main groove extends in a straight manner in a tire circumferential direction. The at least one shoulder main groove includes narrow segments inclined at angles with respect to the tire circumferential direction and wide segments each having widths greater than widths of the narrow segments. The narrow segments and the wide segments are arranged alternately in the tire circumferential direction so as to form a zigzag groove shape, wherein the widths of the narrow segments are in a range of from 5% to 7% of a tread width.
US10406860B2
Various example embodiments of a non-pneumatic tire, and methods for making the same, are disclosed. In one embodiment, a non-pneumatic tire is provided, the non-pneumatic tire comprising: a tread; at least one support ring, wherein the at least one support ring and the tread are concentric; at least one base element oriented between the tread and the at least one support ring; and a hub.
US10406858B2
Disclosed is a cyclic mechanism for engaging or disengaging a switch with the stage of the cycle being determined by a height to which a first object is lifted relative to a second object. The mechanism has few moving parts, is inexpensive to manufacture, is reliable, can be incorporated into a wide range of devices or structures, and operates as an incident to raising or lowering a first object relative to a second.
US10406857B2
An apparatus and method for aligning a rim of a wheel assembly to a wheel hub. The apparatus can include a wheel handler device that is structured to securely engage the wheel assembly. The apparatus can include one or more light emitting devices that project one or more light spots on the face of the wheel hub. The position of one or more light spots relative to another light spot(s) and/or to a reference feature on the face of the hub can provide an indication of the location, orientation, and/or alignment of at least the rim relative to the wheel hub.
US10406852B2
An adjustable rim includes a first annular ring rotatable about a first axis, the first ring having radially extending first linear slots circumferentially spaced about the first ring, a first annular adjustment hoop rotatable about the first axis, the first hoop having circumferentially and radially extending first arcuate slots spaced about the first hoop, a second annular ring rotatable about a second axis, the second ring having radially extending second linear slots circumferentially spaced about the second ring, a second annular adjustment hoop rotatable about the second axis, the second hoop having circumferentially and radially extending second arcuate slots spaced about the second hoop, and an axially extending arcuate member having a first axial end and a second axial end. The first axial end is circumferentially and radially aligned with a first linear slot of the first annular ring and a first arcuate slot of the first annular hoop. The first linear slot and the first arcuate slot interact to move part of the arcuate member in only a radial direction.
US10406851B2
A bicycle wheel includes a first panel member including a first rim portion for mounting a tire, a first hub mounting end connected to a hub, a first spoke portion for connecting the first rim portion and the first hub mounting end, a second panel member having a second rim portion for mounting the tire, a second hub mounting end connected to the hub, and a second spoke portion for connecting the second rim portion and the second hub mounting end, wherein the bicycle wheel is formed by joining the first panel member and the second panel member together such that the first panel member and the second panel member are symmetrical to each other about a line passing through the hub and the rim.
US10406850B2
The present application relates to a film having a polyester layer comprising a blend of amorphous polyester and a copolymer of an olefin and a hydrocarbon ester of an acrylic acid, wherein the amount of copolymer is at least 30 parts per 100 parts by weight of amorphous polyester and wherein the polyester layer exhibits an E-modulus at 23 C of at least 200 N/mm2?. The application further discloses a method of making graphic with the film, in particular by ink jet printing and further discloses a method of applying the graphic to a substrate such as a building or a vehicle.
US10406847B2
A security tag can be used to identify or authenticate a substrate that has the security tag. The security tag includes a pattern of inimitable biological particles, a transparent adhesive layer, a substrate, and a transparent superstrate, where the pattern of inimitable biological particles is directly transferred from an organism to the transparent adhesive layer on the substrate, and where said biological particles are covered with the transparent superstrate, such that said inimitable biological particles are encapsulated between said substrate and said superstrate.
US10406845B2
An article may include a biodata page defining a perimeter including an edge and a hinge layer attached to at least a portion of the biodata page. The hinge layer comprises a cross-linked polyurethane. In some examples, the hinge layer may include a cross-linked thermoset polyurethane.
US10406844B1
According to examples, an apparatus may include a processor and a memory. The memory may have stored thereon machine readable instructions that when executed by the processor, may cause the processor to determine a job thickness of a print job including sheets, determine an average sheet thickness of the sheets, and determine an average print material coverage on the sheets. The instructions may also cause the processor to identify, based on the determined job thickness, the determined average sheet thickness, and the average print material coverage, a plurality of correction factors to be applied in a calculation of a corrected stack height of print jobs in an output bin and apply the identified plurality of correction factors to a measured stack height in the output bin to calculate the corrected stack height.
US10406830B2
Backing material is passed by a first heater to pre-heat the backing material. The backing material is then passed by a printing engine to print marking material on the backing material, and passed by a first light source to apply ultra-violet (UV) light to the marking material printed on the backing material, to partially cure the marking material. Further, the backing material is passed by a container to expose the partially cured marking material to adhesive particles to cause the adhesive particles to adhere only to the marking material. The backing material is passed by a second light source to apply additional UV light to the marking material partially cured on the backing material to fully cure the marking material. Finally, the backing material is passed by a second heater to melt the adhesive particles that are adhered to the marking material on the backing material.
US10406820B2
An inkjet recording apparatus includes: a conveyor having an endless conveying belt that conveys a recording medium; an image former that forms an image on the recording medium conveyed by the conveying belt; a correction mark formed on the conveying belt; a line sensor disposed downstream of the image former in a conveying direction of the recording medium, the line sensor having a linear detection surface; and a hardware processor that controls the conveying belt, the image former, and the line sensor, wherein the hardware processor calculates an inclination angle of the detection surface of the line sensor with respect to a width direction orthogonal to the conveying direction, based on image data of the correction mark read by the line sensor, and corrects image data of the line sensor based on the inclination angle.
US10406816B2
The invention relates to a circuit (100) for recovery of vaporized solvent in a cavity (5) in a print head of an inkjet printer, comprising: a double flow heat exchanger (30) comprising a first circuit between a first inlet (35) and a first outlet (36), for a gas flow from said cavity, this exchanger comprising a second circuit thermally coupled to the first circuit and located between a second inlet (37) and a second outlet (39), a condenser (8) with an inlet (35) with fluid coupling to the first outlet (36) from the exchanger, along the direction of circulation of the gas flow, and an outlet (86), with fluid coupling to the second inlet (37) of the double flow exchanger (30).
US10406814B2
According to one embodiment, a liquid discharge head includes a pressure chamber, and a nozzle plate having a plurality of nozzle holes formed therein and a discharge face with an upstream side and a downstream side, the plurality of nozzle holes being in fluid communication with the pressure chamber and including a first nozzle hole on the upstream side of the discharge face, and a second nozzle hole on the downstream side of the discharge face. A liquid discharge speed from the first nozzle hole is higher than a liquid discharge speed from the second nozzle hole.
US10406809B2
An inkjet printer composes a first dot group including a first base dot group from ink dots of a first ink, and a second dot group including a second base dot group and a second additional dot group from ink dots of a second ink having a weaker color developing capability than the first ink. A total proportion of the first dot group with respect to the ink dots of the first ink is set to be a first print coverage greater than or equal to 100%. A total proportion of the second dot group with respect to the ink dots of the second ink is set to be a second print coverage greater than the first print coverage. Ink dots including the second additional dot group form a first print layer, and ink dots including the first base dot group and the second base dot group form a second print layer over or under the first print layer.
US10406799B1
A film separation apparatus and a film separation method are disclosed. The film separation apparatus includes a mechanical arm, a needle and a stopping member; the needle has one end connected to the mechanical arm and the other end including a needle tip; the stopping member includes a connecting rod and a stopper, the connecting rod has one end connected to the mechanical arm and the other end connected to the stopper, the needle tip is configured to be inserted into a film to be separated, the stopper and the needle tip are configured to move with respect to each other in an extension direction of the needle so as to separate the film to be separated from the needle tip.
US10406789B2
Embodiments disclosed herein relate to polymer resins having a first thermoset and one or more additional components (e.g., a second thermoset and/or a thermoplastic), composite laminates including the same, methods of making and using the same, and composite laminate structures including the same.
US10406781B2
A composite material with an insert-molded attachment steel is provided. The composite material includes a plurality of burring apertures, each of which has a flange in one direction on the attachment steel and is inserted between fibers. A resin is then introduced between the fibers in each burring aperture and external to the flange.
US10406772B2
To facilitate permeation of water when water is applied to the crimping range of a sheet made of a water-permeable paper material. A binding unit applies water to placed sheets and then crimp-binds the sheets. The binding unit includes a pair of pressure teeth (pressure teeth and receiving teeth part) provided on both the front and back sides of the sheets and configured to crimp-binding the sheets, a water reservoir provided on the back surface side of any one of the pressure teeth and configured to store water to be applied to the sheet, and a pressurizing member (piston) that pressurizes the water in the water reservoir to apply water to the sheet crimping range.
US10406766B2
A system and method is provided that allows for the non-interrupted coating of a pulled substrate with coating materials, even while a coated portion of the substrate is held stationary for cutting. The present invention eliminates waste and improves efficiency and yield, and is particularly applicable to laboratory drawdown coaters.
US10406765B2
A fiber-reinforced polyimide resin molded article and a production process therefor. After a prepolymer of an addition reaction type polyimide resin and functional fibers are dispersed and kneaded together, the kneaded product is kept at a temperature not lower than the heat curing start temperature of the reaction type polyimide resin for a fixed amount of time or mixed with a thickener to increase its viscosity, and shaped at a temperature not lower than the heat curing start temperature of the reaction type polyimide resin to obtain a molded article having excellent sliding performance with a limit PV value of not less than 3,000 kPa·m/s and excellent shape stability during molding and containing the functional fibers dispersed in the polyimide resin.
US10406762B2
A carbon-fiber-reinforced resin composite material includes: carbon fibers including carbon fiber bundles and a thermoplastic resin, in which (1) a coefficient of variation (CV1) of a total areal weight of the carbon-fiber-reinforced resin composite material is 10% or lower, (2) a coefficient of variation (CV2) of a carbon fiber volume fraction (Vf) in the carbon-fiber-reinforced resin composite material which is defined by Expression (a) is 15% or lower, and (3) a weight average fiber length of the carbon fibers is 1 to 100 mm. Carbon Fiber Volume Fraction (Vf)=100×Volume of Carbon Fibers/(Volume of Carbon Fibers+Volume of Thermoplastic Resin) Expression (a).
US10406758B2
An apparatus and method for multi-stage printing teaches a 3D printer in combination with one or more additional dispensing nozzles. One or more additional dispensing nozzles are combined with the 3D for filling cavities with other compounds such as foam, sterilizing parts by spraying printed mold with disinfectant or antibacterial treatments, and embedding parts or other materials such as paper, fiberglass, or carbon fiber within the printing layers for additional strength and changing mold properties of a final product. In other embodiments, the apparatus of the present invention can be used in combination with a robotic packaging mechanism for bagging sterilized parts for shipment.
US10406754B2
Apparatuses, systems and methods provide at least a controller for a print server which executes at least one additive manufacturing print process on an additive manufacturing printer. The disclosed embodiments may include a plurality of sensors capable of monitoring at least one of a build perimeter, a build height, and a build volume for an additive print build resultant from the additive manufacturing print; at least one processor associated with the print server and capable of receiving sensor data regarding the monitoring from the plurality of sensors, and comprising non-transitory computing code for applying to the sensor data a print process plan indicative of the additive print build; a comparator embedded in the non-transitory computing code for assessing a lack of compliance by the additive print build to the print process plan; and at least one modified output of the additive manufacturing print suitable to revise the compliance of the additive print build to the print process plan.
US10406752B2
A method of additive manufacturing of a three-dimensional object is disclosed. The method comprises sequentially forming a plurality of layers each patterned according to the shape of a cross section of the object. In some embodiments, the formation of at least one of the layers comprises performing a raster scan to dispense at least a first building material composition, and a vector scan to dispense at least a second building material composition. The vector scan is optionally along a path selected to form at least one structure selected from the group consisting of (i) an elongated structure, (ii) a boundary structure at least partially surrounding an area filled with the first building material, and (iii) an inter-layer connecting structure.
US10406749B2
The disclosure relates in particular to a machine for additive manufacturing by sintering or melting powder using an energy beam acting on a powder layer in a working zone, said machine comprising a device for layering said powder. The device is configured to distribute the powder that are able to travel over the working zone in order to distribute the powder in a layer having a final thickness suitable for additive manufacturing; transfer the powder to a distribution structure by gravity, and control the quantity of powder transferred to the distribution structure.
US10406747B2
The invention relates to a composite material filament having rheological characteristics suitable for use in additive manufacturing by extrusion, a method for manufacturing a three-dimensional composite product with an additive manufacturing system from a filament of such composite material, and to a three-dimensional composite product obtained by an additive manufacturing system using such composite material. The filament is formed of material comprising semi-crystalline polylactic acid and chemical pulp of wood-based cellulose fibers, wherein the amount of chemical pulp of wood-based cellulose fibers is selected such that sufficient complex viscosity is obtained at melt state, such that upon additive manufacturing by extrusion, composite melt formed of the filament has a ratio of shear storage modulus to shear loss modulus G′/G″ equal to or higher than 1.0 at a temperature equal to or higher than 133° C.
US10406739B2
There is provided a parison guide which improves a flatness of parison with a simple configuration. A parison guide (1) guides a parison (P) which has an arc shape in horizontal cross section and is discharged from an extrusion apparatus (2). The parison guide is fixed to a discharge-side end portion of the extrusion apparatus (2). The parison guide includes a contact face (17) configured to come into contact with and guide an edge portion of the parison to flatten the parison. Preferably, the contact face (17) includes a curved surface, and the contact face (17) has a curvature of a horizontal cross section which gets smaller in a discharge direction.
US10406737B2
Provided is an injection molding apparatus for a worm wheel, in which the worm wheel is not only integrally manufactured by an injection mold method, but a gear teeth structure of a gear forming unit is also manufactured as an injection mold without a hobbing operation, and the structure of the injection molding apparatus is also improved so that worm wheel products can be easily taken out from the injection mold. The injection molding apparatus includes: a boss injection mold; a product injection mold having a movable side core, a fixed side core, and a worm gear tooth-shaped core; and a take-out unit for taking out a worm wheel product formed with a worm gear by the product injection mold, wherein the take-out unit includes: a plurality of take-out pins; a take-out plate; and a guide unit guiding rotation of the worm gear tooth-shaped core.
US10406730B2
An imprint apparatus includes a mold stage that holds a mold, a substrate stage that holds a substrate, a dispensing device that dispenses resin on the substrate, and a controller configured to obtain a result of a foreign substance inspection conducted on the substrate. In a case that the obtained result indicates existence of a foreign substance, the controller controls the dispensing device to dispense the resin onto the foreign substance, cures the dispensed resin without bringing the resin into contact with the mold, controls the dispensing device to dispense the resin again on a first chip region of the substrate where the foreign substance and the cured resin thereon exists, and performs imprint processing to the first chip region.
US10406726B2
Methods of preparing a three-dimensional structure are provided. One method includes the steps of extruding beads of thixotropic thermoset materials, and subjecting the beads to curing conditions such that the thixotropic thermoset materials at least partially cure to form cured polymer layers. In some cases, the curing conditions are not applied until multiple beads are extruded and in contact with one another. The steps of these methods can be performed repeatedly as desired to prepare a three-dimensional structure of nearly limitless shapes by additive manufacturing processes. Thixotropic thermoset materials are also provided, as are three-dimensional objects formed therefrom.
US10406717B2
A cutting machine can include a cutting machine body that is movably supported above a table and capable of vertical movement, the cutting machine body can be positioned at an upward waiting position and a lower end position. The cutting machine body can include an auxiliary cover positioned around a portion of a blade and including a projection. When in the upward waiting position the auxiliary cover is not able to move upward because of the position of the projection, and in the lower end position the auxiliary cover is able to move upward.
US10406715B2
Embodiments provide a tie rivet with a body that is configured to ride on a rail of a guide bar, and an integrated rivet extending from an inner surface of the body. The integrated rivet may include a draft angle that varies over a circumference of the integrated rivet. Additionally, or alternatively, the tie rivet may include an undercut portion around at least a portion of the integrated rivet. The undercut portion may be recessed from the inner surface of the body. Other embodiments may be described and claimed.
US10406714B2
A power-tool cutting device that is free of a torque-transmitting element includes at least one cutting strand and at least one guiding unit for guiding the cutting strand. The guiding unit together with the cutting strand forms a closed system. The power-tool cutting device has at least one preloading unit that is arranged on the guiding unit. The preloading unit is configured for automatic play compensation and/or tolerance compensation of the cutting strand at least during a state of the guiding unit in which the guiding unit is removed from a coupling device of a portable power tool.
US10406712B2
An arrangement for handling narrow rolls includes a flow-through warehouse, which includes an inlet end and an outlet end. The narrow rolls are handled such that the narrow rolls are fed into the inlet end in a first direction. The flow-through warehouse further includes at least two rack rows having a second direction transverse to said first direction, at least two isles having the second direction and carriages that move the narrow rolls into a rack and from a rack and also carry them in the second direction. At least one carriage moves along each isle, at least two isles include carriages that are capable of sorting the narrow rolls, and at least one carriage is sorting the narrow rolls for forming a customer stack. The customer stack is formed of several narrow rolls and delivered from the outlet end to be transported to a customer.
US10406710B2
Machines and methods suitable for performing cutting operations on a product to yield a reduced-size product, for example, slicing and strip-cutting elongate food products. Such a method includes introducing a product into an impeller, rotating the impeller to form at least a first longitudinal cut through the product with a slicing knife and produce therefrom a sliced product, and producing strip-cut products from the sliced product by forming at least a second longitudinal cut that is substantially perpendicular to the first longitudinal cut made with the slicing knife.
US10406708B2
A paper sheet processing apparatus for processing a paper sheet with conveying the paper sheet having been fed, the apparatus main body including: a paper feed section; a conveyance section; and at least one kind of paper sheet processing section, wherein a paper passable region width Wb defined as a dimension of a paper passable region of the conveyance path in width directions is set to be a maximum width dimension that permits conveyance of the paper sheet without a paper jam in the paper sheet processing section in a standby state, and wherein a prevention section for, when a feed paper sheet width Wp defined as a width dimension of a paper sheet to be fed is greater than the paper passable region width Wb, preventing the to-be-fed paper sheet 100 from being conveyed intact to the paper sheet processing section is further provided.
US10406696B2
A lockable connector device and system is described. An example lockable connector device includes a first spherical body connected to a first end of a shaft and a plurality of appendages connected to a second end of the shaft. The appendages partially encase a second spherical body and an actuator connected to the appendages, where the actuator is comprised of synthetic muscles that compress to lock the second spherical body.
US10406683B2
Provided is a robot and a control method thereof in which the motion of an arm 12 as a specified limb among a plurality of limbs 12 and 14 extended from a body 10 is controlled according to a specified trajectory. If a first interaction state, in which a hand 126, which is an end effector, interacts with a horizontal wood member L (j) of a ladder L in a first mode is implemented, then a control command is given to an actuator 41 that drives the hand 126 to cause the hand 126 to perform a grasping motion, thereby implementing a second interaction state, in which the hand 126 interacts with the horizontal wood member L (j) in a second manner. If the second interaction state is implemented, a control command is given to a brake 42 to maintain a motion halt state of the hand 126.
US10406682B2
According to an aspect of the invention, a motor operation control system configured to control an operation of a multi-axis mechanical apparatus including motors includes drive control units each of which is provided for one corresponding motor and a central controller configured to output an operation command to the drive control units. Each of the drive control units controls an operation of a motor based on the operation command from the central controller and transmits a response signal to another drive control unit and the central controller through asynchronous serial communication.
US10406681B2
A robot includes: a restricting member configured to restrict a horizontal movement of a predetermined workpiece; and a workpiece moving member configured to generate an action for horizontally moving the workpiece. The controller performs a control operation of positioning the workpiece at a stop position in such a manner that: based on predetermined size information of the workpiece and preset stop position information of the workpiece, the restricting member is positioned at a predetermined restricting position included in the stop position for the workpiece, and the workpiece moving member acts on the workpiece and is moved toward the restricting position to horizontally move the workpiece; and the workpiece is brought into contact with the restricting member.
US10406672B2
A drill press includes a main housing, a base coupled to the main housing, and a drill unit supported by the main housing for relative movement therewith. The base includes a bore formed in a top surface and a magnet to create a magnetic field for magnetically latching the base to a workpiece. The drill press further includes a holding force detection assembly having a plug and a sensor coupled to the plug to detect the magnetic field within the base. The holding force detection assembly is received within the bore formed in the top surface of the base.
US10406665B2
A setting device is provided, comprising a housing, a combustion chamber having an ignition apparatus, a storage container having a container wall for storing fuel, a dosing apparatus for adding a specified volume of fuel to the combustion chamber, an apparatus, such as a firing pin, for inserting a setting element into a setting object, wherein a setting force can be applied to the apparatus as a result of the pressure of combustion gas such that the apparatus is operable by combustion force, a control unit, and a temperature sensor for detecting the temperature of the fuel in the storage container. The setting device is designed such that, while the storage container is connected to the setting device, the temperature sensor mechanically contacts an outer surface of the container wall, for indirect detection of the temperature of the fuel.
US10406664B2
The present invention relates to the technical field of power-driven hammers, and more specifically, to an impact structure, which comprises a connecting shaft with two ends connected to first bearings and second bearings, wherein the shaft is sleeved around a control disc whose one end-face is connected to gears and the other end-face connected to a striking disc having keys along its circumference, a first stop ring around the shaft and a second stop ring around the shaft are provided respectively between the control disc and the first bearings and between the striking disc and the second bearings, and a spring is provided between the second stop ring and the striking disc; the present invention reciprocates by meshing between the control disc's driving teeth and the striking disc's driven teeth and under the spring's action in operation, effectively avoiding being stuck fast to ensure uninterrupted striking of nails.
US10406663B2
A detachment tool of the present invention is a tool for detaching a device attached to a wall portion. The detachment tool includes a member in which a first through hole and a second through hole are formed, a first screw that fixes the member to the device while inserted into the first through hole, and a second screw that pushes the wall portion while inserted into the second through hole. The first through hole is a threaded hole that screw-engages with the first screw or an unthreaded hole. The second through hole is a threaded hole that screw-engages with the second screw. According to such a configuration, the detachment tool in which operationality in detachment is good, flexible adaptation to a space can be made, and force applied in detachment is also easily managed, and a motor drive device provided with the same can be provided.
US10406661B2
A magazine is configured to be removably coupled to a power tool housing of a power tool. The magazine has a housing configured to be rotatably attachable to the power tool housing. An advancing mechanism is received in the magazine housing, and is configured to advance a strip of collated fasteners into position to be driven by the power tool. An indexing ring has a plurality of recesses and is configured to be non-rotatably attached to the power tool housing. A detent is biased to removably engage one of the plurality of recesses, and is configured to be non-rotatably attached to the magazine housing. The detent removably engages the recesses to allow for indexed tool-free rotation of the magazine housing relative to the power tool housing.
US10406658B2
An open-ended ratchet wrench having interchangeable jaws and selectable free rotation of the jaws.
US10406654B2
The present application is a new improvement in the fine-grained cubic Boron Nitride sintered compact which may be employed to manufacture a cutting tool. The compact contains at least 80 vol % cBN and is sintered under HPHT conditions. The invention has lower levels of unreacted cobalt in the final sintered material than conventions materials. The invention has proved beneficial in the machining of ferrous metal alloys such as sintered metal alloys.
US10406647B2
A skate sharpening system comprises an adjustor assembly and a skate holder assembly. A runner is releasably coupled to a template runner, and then clamped into the skate holder assembly. The template runner defines a pre-defined profile for the blank runner. An operator moves the skate holder assembly such that the template runner moves along a guide bearing of the adjustor assembly. The guide bearing is disposed proximate a grinding wheel. While the template runner remains in contact with the adjustable guide bearing, the runner remains in contact with, and moves along, the grinding wheel such that the grinding wheel simultaneously sharpens and contours the runner.
US10406642B2
A dual drive pressing apparatus for plural pressing heads is disclosed. The dual drive pressing apparatus includes a platform, a first rotation plate, a second rotation plate, a return set and a switch set. While the first rotation plate is driven by a first driving force, the first rotation plate rotates with the second rotation plate to a selectively specific angle relative to the platform, and the set of pressing columns is selectively aligned with a corresponding pressing head. While a second driving force is provided by the switch set to resist the resilience of the return set and push against the end of the supporting cylinder to move towards the second surface, the supporting cylinder of the second rotation plate drives the fourth surface separated from the first rotation plate, and the set of pressing columns on the third surface pushes the corresponding pressing head set.
US10406629B2
To provide a method for joining metal members, in which joining can be performed at relatively lower temperature, and deformation caused when joining the metal members can be reduced. The present invention includes a step of joining a plurality of metal members with a sheet sandwiched between the joining surfaces of the plurality of metal members, wherein the sheet is obtained by forming an organic acid metal salt film on the surface of a metal sheet; wherein aluminum or an aluminum alloy is used as the metal members, and a sheet made of any one of zinc, copper and magnesium is used as the metal sheet.
US10406627B2
By superposing a plurality of steel sheets including a high tensile steel sheet and performing pulsation conduction by an inverter DC type spot welding power supply and controlling the conduction time of the current pulses, intervals of the current pulses, that is, conduction idle time, and weld current applied at the current pulses in a variable manner, the optimum weld conditions are obtained. For resistance spot welding of the hot stamped steel sheet, resistance spot welding with a minimum weld current of a second pulsation step higher than the maximum weld current at a first pulsation step is used to suppress the occurrence of outer spatter and inner spatter and secure a broad suitable current range even if using an inverter DC power supply.
US10406617B2
A method for machining a workpiece, includes: rotating a rotary tool around a rotation axis, the rotary tool including at least one edge positioned on an outer periphery of the rotary tool around the rotation axis; relatively moving the rotary tool toward the workpiece in a first direction so that the at least one edge cuts the workpiece by a predetermined depth while the rotary tool is rotated around the rotation axis; and relatively moving the rotary tool with respect to the workpiece in a second direction that is substantially perpendicular to the first direction and that is inclined to a third direction substantially perpendicular to the rotation axis and the first direction.
US10406607B2
A clamp is disclosed for a key making machine. The clamp may have an anvil, and a door movable toward the anvil to sandwich a key blank therebetween. The clamp may also have a gate pivotally connected to the door and configured to engage the key blank.
US10406592B2
A method of inserting a rivet (2) into a workpiece (42, 44, 46) comprises moving the rivet (2) and workpiece (42, 44, 46) relative to one another, along a longitudinal axis of the rivet, so as to drive the rivet into the workpiece. The rivet is rotated about its longitudinal axis, relative to the workpiece, for at least part of the time during which it is in contact with the workpiece. The speed of said rotation, or the speed of movement along the longitudinal axis of the rivet, is altered at least once before driving of the rivet into the workpiece is complete.
US10406583B2
An apparatus for forming a metal workpiece having a first surface is described herein. The apparatus includes a trough containing a liquid. The apparatus also includes a support for positioning the metal workpiece in an impact-receiving position. In the impact-receiving position, the first surface is submerged in the liquid. The apparatus includes a driven member for applying multiple impacts to the first surface of the metal workpiece while the metal workpiece is in the impact-receiving position.
US10406577B2
A method of making mechanically-lined pipe with primary expansion by plastically expanding a liner sleeve within an outer pipe, under lining pressure applied internally to the liner sleeve. On relieving the lining pressure, elastic radial contraction of the outer pipe makes a mechanical bond between the outer pipe and the liner sleeve. Then, secondary expansion of the outer pipe is performed under fixing pressure, which may be greater than the lining pressure, applied internally to the liner sleeve at an end portion of the pipe. This makes or strengthens a mechanical bond at the end portion. The resulting pipe joint has an end portion and a body portion inboard of the end portion. The body portion has a first, lesser bonding pressure between the outer pipe and the liner sleeve. The end portion has a second, greater bonding pressure between the outer pipe and liner sleeve.
US10406572B2
A bioelectrochemical system device may be used to enhance groundwater pollutant chemical removal or degradation. Such a bioelectrochemical system may be inserted into the environment to be remediated through a variety of techniques, such as through insertion into wells or other access points, trench insertion, direct insertion, borehole insertion, or combinations thereof. In some aspects, the bioelectrochemical system device may have a hollow-tube configuration with an outer ring anode and inner ring cathode. In further aspects, the bioelectrochemical system device may have a modular form that can be combined with multiple other modules such one or more bioelectrochemical system devices.
US10406564B1
The sorting waste receptacle sorts and temporarily stores differing types of waste items. The sorting waste receptacle includes a hollow housing having a top wall, a bottom wall and at least one sidewall. The top wall has an opening formed therein for depositing a waste item, and a lower interior portion of the hollow housing is divided into a plurality of separate compartments, each compartment corresponding to a different type of waste. When the waste item is inserted through the opening formed in the top wall, the waste item is temporarily held within a movable chute inside the hollow housing. While in the chute, the waste item is weighed by a scale and at least one sensor determines its composition. Based on the composition of the waste item, the chute is moved above the corresponding one of the separate compartments for dispensing of the waste item therein.
US10406560B1
A disc for use in a disc screen is disclosed. The disc has a longitudinal axis and includes a hub extending a length along the longitudinal axis. The longitudinal axis is coaxial with the center of the hub and the hub further includes a hub surface, a major axis defined by a first cross section taken perpendicular to the longitudinal axis and through the center of the hub at and a minor axis defined by a second cross section taken perpendicular to the longitudinal axis and through the center of the hub. The first cross section is longer than the second cross section, and the first cross section is substantially orthogonal to the second cross section. A helical ridge structure extends away from hub surface and twists at least 360 degrees about the longitudinal axis for the length.
US10406559B2
A vibration actuator having a stationary element; a movable element that is supported elastically so as to enable vibration on the stationary element; and a driving source for causing reciprocating vibration of the movable element in relation to the stationary element, wherein: the movable element comprises an opposed face that opposes an opposing face of the stationary element; a magnetic fluid that has viscosity is filled into a gap between the opposing face and the opposed face and is attracted magnetically to at least either the opposing face or the opposed face; and on the other of the opposing face or the opposed face, a holding region for retaining the magnetic fluid is provided, and a lipophobic surface, for repelling the magnetic fluid is provided so as to surround the holding region.
US10406554B2
An ergonomic glue pen employs a spring-loaded advancing assembly for advancing a glue stick toward a heater. When the proper temperature is reached, a trigger is depressed to dispense glue through a forward nozzle. In some embodiments, the nozzle changes color when the proper temperature is obtained. A button at the side of the glue pen is manually displaceable by the user. The glue stick is loaded at the rear of the glue pen via a one-way collet. The trigger preferably interacts with the advancing assembly via a spring-loaded ratchet mechanism.
US10406551B2
A spray nozzle body has an upper end provided with a clamp arrangement comprising upper and lower clamp halves tightly clamped onto a fluid supply tube having a preselected first diameter. A removable tubular fluid delivery stem is received in a receiver hole extending vertically into the nozzle body from a clamping surface of the lower clamp half and has an upper end portion tightly received in a fluid outlet hole, of preselected size, provided in the supply tube. The clamp arrangement may be reconfigured for being clamped onto a smaller fluid supply tube by providing a replacement upper clamp half and a pipe-size adapter, each having appropriately sized clamping surfaces, with the adapter being seated within the clamping surface of the lower clamp half. The pipe-size adapter incorporates a suitably dimensioned fluid delivery stem.
US10406548B2
A trigger-type liquid dispenser, in which an upright and inverted dual unit includes a joint member, a pipe holding member, and a valve body. The joint member includes a through hole, which may be closed by the valve body, a valve-body-holding wall portion, which accommodates the valve body above the through hole in a manner such that the valve body is displaceable upward and downward, and an opening portion, which is formed in the valve-body-holding wall portion. In the inverted position, the upright and inverted dual unit permits content liquid contained in a container to be supplied to the dispenser main body by passing content liquid through a flow path from opening portion, through the hole, to the flow path defined between the joint member and pipe holding member sequentially. The valve body is inserted through the opening portion to be accommodated in the valve-body-holding wall portion.
US10406546B2
Suction device for a liquid product present in a dispenser has a container 6 provided with means for sampling the product 7. The device is developed about a central axis X and has a centralised product suction channel 8 coaxial to the central axis X and having an inlet 14 and an outlet; and annular suction means connected to the inlet 14 of the centralised suction channel 8.
US10406544B2
Powder-dispensing device and powder-coating installation for spraying articles with a powder coating
A powder-dispensing device in the form of a dense-phase powder pump or of a powder injector is provided to deliver coating powder from a powder reservoir to a powder-spraying device. To make the spray coating operation easier for the customer and to be able to make it more cost-effective, without having to compromise on good coating quality and good coating efficiency, a control device is integrated in the powder-dispensing device or is connected, in particular directly, to the powder-dispensing device and is designed to establish at least one parameter that is characteristic of a spray coating procedure carried out with the powder-coating device.
US10406540B2
An impact nozzle that atomizes fuel and minimizes liquefication at a supercharger intake manifold comprises a body defining an enclosed channel having proximal and distal ends, a means for attaching a jet to the proximal end, and a pedestal spanning the distal end. An impact pin extending proximally from the pedestal is spaced distally from the distal end of the channel. The impact pin may be mounted to a central longitudinal member having four contoured sides each having a maximum thickness at its distal end and a minimum thickness at its proximal end, the minimum thickness occurring along one of four straight edges that define a rectangular end of the central longitudinal member to which the impact pin is attached, and each border between any two contoured sides forming a sharp contoured edge for evenly dispersing atomized fuel.
US10406539B2
A remote switch combination shower head includes a first shower head, a second shower head and a switch mechanism, wherein further comprising a fixing seat assembled to a support arm, the fixing seat is disposed with an inlet waterway connected to the support arm, a first diversion waterway and a second diversion waterway; the first shower head is assembled to the fixing seat and is capable of connecting to the first diversion waterway; the second shower head is a hand shower head connected to the second diversion waterway by a flexible pipe; the switch mechanism comprises a switch component and an operation component, the switch component is disposed to the fixing seat and is coupled to the inlet waterway, the first diversion waterway and the second diversion waterway, so that the waterways are switched by the movement of the switch component.
US10406533B2
In at least one illustrative embodiment, an electromagnetic filter may include a transfer pipe and multiple electromagnetic filter elements positioned in an interior volume of the pipe. Each electromagnetic filter element includes a support comb, a solenoid coupled to the support comb, and multiple magnetic members arranged in a planar array positioned within an opening of the support comb. Each magnetic member may rotate about an end that is coupled to the support comb. The magnetic members may be magnetostrictive sensors and may include a biorecognition element to bind with a target microorganism. A method for fluid filtration includes coupling the electromagnetic filter between a fluid source and a fluid destination, energizing the solenoids of each electromagnetic filter elements, and flowing a fluid media through the transfer pipe of the electromagnetic filter. The fluid media may be liquid food such as fruit juice. Other embodiments are described and claimed.
US10406532B2
An arrangement for controlling a comminution process having a grinding circuit, includes an imaging system measuring 3D reconstruction measurement data for three-dimensional reconstruction of incoming ore; a particle size analysis equipment measuring particle size data for calculation of the particle size characteristic value of outgoing ore; an ore characteristics data calculation block receiving a particle size distribution profile of incoming ore and a particle size characteristic value of the outgoing ore, the particle size distribution profile being calculated and/or reconstructed from the 3D reconstruction measurement data for three-dimensional reconstruction, and the particle size characteristic value being calculated based on the measured particle size data, the ore characteristics data calculation block calculating ore characteristics data based on the particle size distribution profile and the particle size characteristic value; and a control block controlling the grinding circuit based on the calculated ore characteristics data.
US10406530B2
Machines and methods adapted to process, for example, to reduce the size of, disperse, or homogenize, a variety of materials and compositions. Such methods and machines are capable of reducing the size of a material and dispersing the material in a liquid by cutting the material with knives located along a perimeter of an annular-shaped cutting head, causing the cut material to flow radially outward from the cutting head through gaps between the knives, and flowing a liquid through passages in the cutting head that cause the liquid to cascade around the knives of the cutting head in an axial direction of the cutting head.
US10406527B2
The present invention provides a thermocycler comprising: a rotatable platform having a plurality of reaction wells or being adapted to receive a plurality of reaction containers, wherein the rotatable platform and/or the reaction wells are formed, at least in part, of a material which is adapted to be inductively heated by exposure to electromagnetic energy. An electromagnetic energy source is provided and is configured to direct electromagnetic energy at the rotatable platform, wherein the electromagnetic energy source surrounds a sufficient amount of the rotatable platform in order to heat the entire platform substantially simultaneously. In preferred embodiments, the electromagnetic energy source completely surrounds the rotatable platform. The invention further comprises a method of cycling a reaction mixture between predetermined temperatures utilising the novel thermocycler apparatus of the invention. The invention also comprises use of the novel thermocycler apparatus of the invention for conducting a nucleic acid amplification reaction such as the polymerase chain reaction (PCR) and the ligase chain reaction (LCR).
US10406523B2
The invention relates to a cartridge housing for forming a cartridge capable of measuring an analyte or property of a liquid sample. The housing including a top portion having a first substantially rigid zone and a substantially flexible zone, a bottom portion separate from the top portion including a second substantially rigid zone, and at least one sensor recess containing a sensor. The top portion and the bottom portion are bonded to form the cartridge having a conduit over at least a portion of the sensor. The invention also relates to methods for forming such cartridges and to various features of such cartridges.
US10406521B2
The invention provides a micro-droplet array formation apparatus. The apparatus includes a first plate configured for delivering and/or extracting fluids, a second plate aligned to the first plate and configured for preparing the fluid and a third plate removably aligned to the second plate and is configured for forming a micro-droplet array of the prepared fluid.
US10406518B2
The invention relates to a device and to a method for storing and transporting a bodily fluid sample, comprising a support element (2), which forms a main body. At least one sorption element (3), which has a defined filling volume and is suitable for receiving a drop of the bodily fluid, and an overflow reservoir (4), which is adjacent to the sorption element (3) and which receives the bodily fluid from the sorption element (3) as soon as the filling volume of the sorption element (3) is filled, are fastened to the support element. The technical solution according to the invention is characterized in that at least one predetermined breaking point (5) is provided, which is designed in such a way that the sorption element (3) can be manually detached from the support element (1) and/or from the overflow reservoir (4) without an auxiliary tool.
US10406516B2
The present invention provides an electrode for water-splitting reaction that is capable of increasing conductive path between a photocatalyst layer and a current collecting layer without inhibiting light absorption by photocatalyst, which comprises: a photocatalyst layer 10; a current collecting layer 30; and a contact layer 20 that contains semiconductor or good conductor and is provided between the photocatalyst layer 10 and the current collecting layer 30, wherein the contact layer 20 is provided along the surface shape of the photocatalyst layer 10 at the current collecting layer 30 side of the photocatalyst layer 10.
US10406505B1
The present invention provides a coating composition suitable for use in forming a coating that can reduce a concentration of pollutant gases in the environment. The coating composition includes from 0.01 to 10 vol.-% of mesoporous titania particles, relative to a total volume of the coating composition, and from 5 to 99.99 vol.-% of a polymeric material, relative to the total volume of the coating composition. The mesoporous titania particles have a continuous exterior convex surface, a particle diameter of ≥1 μm but ≤ to 50 μm, a BET specific surface area of from 30 to 350 m2/g, a modal pore diameter of ≥5 nm but ≤50 nm, and a pore size distribution so that 85% or more of a total pore volume is associated with pores having a diameter of 10 μm or less.
US10406504B2
The present invention provides a photocatalyst coated body which can realize a sufficient photocatalytic activity and adhesiveness with a substrate, without significantly impairing an appearance of a substrate, especially an exterior building material. The photocatalyst coated body has a structure including a substrate, an intermediate layer formed on the substrate, and a photocatalyst layer formed on the intermediate layer. The intermediate layer includes inorganic oxide particles having an average particle diameter of nanosize. The photocatalyst layer includes photocatalyst particles having an average particle diameter of more than 0 μm to less than 10 μm and inorganic oxide particles having an average particle diameter of nanosize. A sum of a film thickness of the intermediate layer and a film thickness of the photocatalyst layer is 0.3 μm or more to 1.5 μm or less.
US10406501B2
The present disclosure relates to systems and methods for electrochemical metal or other positive ion removal from polycrystalline diamond (PCD), such as PCD used in earth-boring drill bits. PCD used in the systems and methods described herein has an electrical conductivity-enhanced region.
US10406500B2
This invention relates to a production method for non-detonation synthesis nanodiamond by exposing carbonaceous feedstock to a dense plasma focus. The nucleated nanodiamond particles have characteristics that differentiate them from known forms of nanodiamond. For instance, the nucleated nanodiamond particles are substantially spherical and have a substantially smooth surface, as may be demonstrated by TEM. The nucleated nanodiamond particles are also free of graphite and detonation carbon contaminants. The identity of the nanodiamond particles has been confirmed through raman spectra, for example. The nanodiamond particles have also been found to be effective as a lubricant composition when combined with a carrier oil.
US10406488B2
A drink dispenser with detachable fizz infuser including drink bottle, characterized by and comprising a base, a main body, a main body support, a top cap, an exiting gas driving device, a gas exiting device, a gas transfer device, a gas inlet device, and a CO2 cylinder. The compartment for the CO2 cylinder in the said main body has an inlet and an outlet as well as a side cap that is connected to the main body and pin-jointed with the inlet and the outlet. With this structure, the gas exiting device can be activated simply by pressing the exiting gas driving device. Gas flows from the CO2 cylinder, enters the gas transfer device and the gas inlet device, and ends up in the drink bottle. The operation is simple and easy. The configuration of the safety device eliminates potential safety hazards and ensures safety by preventing the drink bottles from being over-pressurized. Provision of the side cap facilitates convenient replacement of the CO2 cylinder.
US10406478B2
Apparatus and methods for desulfurization of a sulfur-oxide containing gas by treatment with ammonia containing liquids. The apparatus and methods may utilize two distinct circuits of two different ammonia containing liquids which are applied in two distinct chambers. The gas may be cooled prior to entry into the circuits. There may be fluid communication between the two circulation circuits.
US10406467B2
An apparatus for contaminant reduction in a stream of compressed gas is disclosed. The apparatus includes an insert for directing the gas. The insert sits in a head portion which has an inlet leading to an inlet pathway for directing the gas towards the insert. The head portion also has an outlet leading from an outlet pathway for directing the gas from the insert towards the outlet. There is also a body portion sealed to the head portion for collecting contaminants removed from the gas. The insert includes a tubular portion connected to the head portion. Gas from the inlet pathway passes outside the tubular portion while gas going to the outlet passes inside the tubular portion. The insert has a baffle extending from the tubular portion for narrowing the gap between the insert and the body portion and has curved walls extending from the baffle causing the stream of gas to rotate thereby form a vortex.
US10406461B2
A water filter system for an appliance includes a filter head assembly, a first appliance control unit positioned proximate the filter head assembly and a water filter having a memory storage unit. The water filter is selectively placed in communication with the first appliance control unit to define a filter use state. The filter use state is further defined by a first potential fluid-flow rate through the water filter and a predetermined lifetime fluid filtration amount. A data transfer mechanism defines a second data-transfer protocol between the memory storage unit and the first appliance control unit when an actual fluid filtration amount of the water filter reaches the predetermined lifetime fluid filtration amount. The second data transfer protocol defines a notification state defined by a second potential fluid flow rate, the second potential fluid flow rate being less than the first potential fluid flow rate.
US10406460B2
A filter assembly includes a first filter member including a first filter panel which defines a central axial aperture and a second filter member including a second filter panel which defines a central axial aperture. The filter assembly further includes a first discharge blade which includes a body and a blade arm, the body defining a central axial bore hole and in contact with the first outer surface of the first filter panel. The filter assembly further includes a second discharge blade which includes a body and a blade arm extending radially from the body, the body defining a central axial bore hole and in contact with the second opposing outer surface of the first filter panel and the first outer surface of the second filter panel. The filter assembly further includes a washer in contact with the second outer surface of the second filter panel, and a shaft.
US10406458B1
A regenerative filter that includes a filter housing having inlet and outlet zones; a fluid path provided between the inlet and outlet zones; a plurality of filter elements each having an outer surface filter media applied thereto and functioning to filter particulate or contaminants from the fluid path; and a tube sheet that is supported across the filter housing, that is disposed just before the outlet zone and that provides the support for the plurality of filter elements. The plurality of filter elements are disposed in an array and includes bridging members or elements that connect between adjacent filter elements, and that forms with the filter elements, a closed interstitial space between adjacent filter elements for liquid flow; a nanoscale barrier on interior surfaces, including that of the regenerative media itself, providing a mechanism to disrupt the cell wall of microscopic viruses and organisms.
US10406457B2
A filter device has a support part (39, 43) receiving a filter part (1), a sealing device (17) acting between the support part (39, 43) and the filter part (1), and a securing device (53, 57, 61) releasably connecting the support part (43) to the filter part (1). The securing device has a circumferential collar part (53) that, under the action of an energy store (61), exerts a force on the sealing device (17). That force seals the support part (39, 43) and the filter part (1) in a fluid-tight manner with respect to one another. The support part (39, 43) has, on its end region oriented toward the securing device (53, 57, 61), another circumferential collar part (39). The collar part (53) of the securing device (53, 57, 61) is guided concentrically within the collar part (39) of the support part (39, 43) provided with a sealing system (41, 72).
US10406456B1
A modular distribution assembly comprises a top plate and a bottom plate, each of the top plate and the bottom plate comprises a plurality of recesses. A plurality of support members are slidably coupled to each of the top plate and the bottom plate, each support member of the plurality of support members comprising a protrusion on each of opposing sides thereof, each protrusion slidably coupled to a corresponding recess of the top plate and a corresponding recess of the bottom plate. Related assemblies comprising the modular distribution assembly and related methods of forming the modular distribution assembly and the assembly are disclosed.
US10406447B2
A system, computer-readable storage medium storing at least one program, and a computer-implemented method to load a game user interface is provided. A request is received from a second player to access a game user interface for a computer-implemented game. First player messaging activity information associated with messaging activity of the first player is accessed. During loading of the game user interface, a chat interface is displayed to enable text communication between the first and second player. Concurrently, a loading progress indicator is displayed.
US10406444B2
A program, an information processing apparatus, and a control method that can facilitate adjustment of game balance. The information processing apparatus may store information concerning game mediums; may change, with regard to one game medium of a user, a first parameter in accordance with a change of a second parameter or may change the second parameter within a range corresponding to the first parameter; may determine a characteristic value on the basis of the information concerning the game medium of a first user; may prepare a new game medium on the basis of information concerning a reference game medium of a second user and a ratio of the characteristic value to the first parameter of the reference game medium; and may transmit information required for execution of game contents which progress using the new game medium to a first terminal device of the first user.
US10406431B2
A hand-held controller includes a controller body having a front and a back, with at least one thumb control on the front of the controller body. A back shell on the back of the controller body has left and right portions, each having top and bottom regions. A first force sensitive resistor (FSR) underlies the top region of the left portion of the back shell. A second FSR underlies the bottom region of the left portion of the back shell. A third FSR underlies the top region of the right portion of the back shell. A fourth FSR underlies the bottom region of the right portion of the back shell.
US10406423B1
The invention is directed to a scorekeeping device for a beanbag game. The device provides a forked lower body and a cylindrical upper body. The fork points of the lower body may be inserted into mounting brackets on the bottom surface of the frame of a beanbag goal. The upper body provides scorekeeping discs which are movably mounted on two semicircular rings, and two cup holders which may be used to hold the users' drinks while the users throw beanbags at a goal. The lower body easily folds upward on the upper body for storage.
US10406415B2
An improved golf club head cover and hands-free method of use allow a user to hold a golf club normally by the handle with one or two hands while standing substantially upright and slide the golf club head into and out of the head cover while the head cover is sitting on the ground, without the user needing to bend down or touch the head cover. A rigid cover may include a concave main body pivotally connected with one or more rotating components that include tabs that close the rotating components around the golf club head and shaft when the club is inserted securely into the cover. Magnetically attractive and repulsive structures may be included to assist with keeping the cover shut and holding it open. Traction structures are provided to laterally engage grass-covered ground to resist lateral movement during hands-free use.
US10406412B2
A metal foil satisfies following conditional equations (1), (2) and (3) to smoothly increase rigidity in the longitudinal direction of the shaft main body from a distal end side to a base end side while increasing a weight of a wound part of the metal foil 0.50
US10406411B2
Embodiments of golf clubs with grooves and methods of manufacture thereof are described herein. In one embodiment of a golf club described herein, the golf club has a head with a body. The body has a strike face with channels and at least one insert located within at least one of the channels. At least one of the channels comprises a single groove, and the insert forms at least a portion of the single groove. At least one of the channels comprises an opening on the strike face that is narrower than a bottom of the at least one of the channels. Other embodiments and related methods are also disclosed herein.
US10406405B2
Methods and systems for packaging a plurality of objects are disclosed. The system includes a base tray having a first end and a second end, an object reservoir positioned at the first end, a dispensing guide positioned at the second end, and a column guide disposed between the reservoir and the dispensing guide. The column guide is configured to convey objects from the reservoir to the dispensing guide using gravitational forces via a plurality of longitudinally extending guiding columns. A tilt tray having a front edge and a back edge is positioned above the column guide. The tilt tray has a front edge and a back edge, and is anchored to pivot between a forward-engaged position and a backward-engaged position. When the tilt tray is in the backward-engaged position, the back edge is positioned to prevent object movement along the column guide, while the front edge is positioned to allow object movement along the column guide and into the dispensing guide. When the tilt tray is in the forward-engaged position, the front edge is positioned to prevent object movement along the column guide and into the dispensing guide, while the back edge is positioned to allow objects to pass underneath the back edge. The system is sized and configured for packaging golf balls in interchangeable object containers.
US10406403B2
Provided is a bismuth golf ball with improved carry distance and fracture strength by adding a nano bismuth reformed by using plasma or a nano bismuth alloy manufactured by using the nano bismuth to a resin composition as a base material as compared with a bismuth golf ball in the related art. Since the nano bismuth golf ball has a more densified internal structure due to a higher content of bismuth as compared with the bismuth golf ball, the resilient elasticity is improved, and thus, the carry distance is increased.
US10406402B2
Multi-layered golf balls having at least one layer made of a polyamide composition containing a plasticized polyamide are provided. In one preferred version, the polyamide composition consists essentially of a polyamide and plasticizer selected from the group consisting of polytrimethylene ether glycol and polytrimethylene ether glycol benzoate and monomers, oligomers, copolymers and blends thereof. Blends of plasticized polyamides and ethylene acid copolymer ionomers also can be prepared. The golf ball includes a core having at least one layer and a cover having at least one layer. The polyamide composition may be used to form any core, cover, or other layer in the golf ball. The polyamide compositions have a good combination of properties including Coefficient of Restitution (COR) and compression.
US10406397B1
A spinal treatment system includes a traction device, an exercise device adapted for imparting curvature to the lumbar or sacral spine of a user and for manipulating the spine and intervertebral discs with decompression force, and a cushion coupled to the traction device and configured to bear against one or both of a head of the user and the thoracic spine of the user. The exercise device includes a frame for placement on the floor. A pad or inflatable bladder is carried by the top surface of the frame. A body strap attachment portion encompasses the thoracic-sacral spinal vertebrae region of the user and secures the frame to the user. The cushion includes one or more pad sections or inflatable bladder sections.
US10406394B2
The potential for substance abuse involving residual amounts of abusable substances remaining in used skin-worn patches is reduced by the provision of a system and method for combining the abusable substance with a separate anti-abuse substance agent as part of a removal or disposal procedure.
US10406383B2
This invention relates to ultrasound delivery apparatus comprising flexible arrays of transducers and to methods and topical compositions for the treatment of skin, in particular for the treatment of cosmetic skin conditions and to improve the appearance of sun damaged and/or aged skin; the invention further relates to the use of such apparatus and compositions in methods of treating skin, which methods may incorporate the application of ultrasound. The composition may comprise one or more anti-gfycation agent, one or more anti-oxidant, a dermatologically acceptable excipient and optionally one or more substance capable of inducing expression of a molecular chaperone.
US10406373B2
An extra-cardiovascular implantable cardioverter defibrillator is configured to store a cardiac signal segment in response to sensing a cardiac event and obtain a notch filtered signal segment by notch filtering the cardiac signal segment. The ICD determines a count of crossings of the notch filtered signal segment by the cardiac signal segment and determines whether electromagnetic interference (EMI) is present in the cardiac signal segment based on a value of the count.
US10406366B2
A lead system and method of use for treating breathing disorders by the transvenous stimulation of the phrenic nerve. The lead is implanted in a vein near one portion of the phrenic nerve.
US10406363B2
A method of detecting an improvement in a seizure condition of a patient includes identifying a first EEG synchronization of the seizure condition of the patient; applying a therapy configured to improve the seizure condition of the patient; and identifying a second EEG synchronization of the seizure condition of the patient subsequent to application of the therapy, wherein an improvement of the seizure condition of the patient is demonstrated by a reduced EEG synchronization of the patient such that the second EEG synchronization is less than the first EEG synchronization.
US10406358B1
A device to relieve pain in the body of humans by inducing a controlled positive/negative electric charge at the painful site. Providing enhanced transport and targeted delivery of pain relieving classifications of drugs including nonsteroidal anti-inflammatory drugs (NSAID) and steroid drug compounds (corticosteroids), and important intrinsic anti-inflammatory agents. A shielded transmission electrode applies alternating positive and/or negative charge stimulating or repressing the enhanced delivery or repression of drugs to the injury site for increased therapeutic treatment dependent on known therapeutic properties of so prescribed drugs inputted to a charge generating micro-controller.
US10406353B2
An electrical stimulation lead includes a lead body having a distal end portion, a proximal end portion, and a longitudinal length; and electrodes disposed along the distal end portion of the lead body. The electrodes include a first set of electrodes and a second set of electrodes. The electrodes of the first set are spaced apart by a first distance and the electrodes of the second set are spaced apart by a second distance that is greater than the first distance and the first set is spaced apart from the second set by a third distance that is greater than or equal to the second distance. The lead also includes terminals disposed along the proximal end portion of the lead body; conductors electrically coupling the terminals to the electrodes; and anchoring units disposed along the distal end portion of the lead body and proximal to the first set of electrodes.
US10406352B2
An ophthalmic stimulator for temporarily constricting a pupil of an eye comprises an irradiation control system, to generate an irradiation control signal, an irradiation source, coupled to the irradiation control system, to generate an irradiation, and an irradiation delivery system, coupled to the irradiation control system, to receive the irradiation from the irradiation source, and to deliver a patterned irradiation to an iris of the eye, wherein the irradiation control system controls at least one of the irradiation source and the irradiation delivery system with the irradiation control signal so that the patterned irradiation causes a temporary constriction of the pupil of the eye, without causing a permanent constriction of the pupil.
US10406350B2
Described herein are microelectrode array devices, and methods of fabrication and use of the same, to provide highly localized and efficient electrical stimulation of a neurological target. The device includes multiple microelectrode elements arranged along an elongated probe shaft. The microelectrode elements are dimensioned and shaped so as to target individual neurons, groups of neurons, and neural tissue as may be located in an animal nervous system, such as deep within a human brain. Beneficially, the neurological probe can be used to facilitate location of the neurological target and remain implanted for long-term monitoring and/or stimulation.
US10406347B2
A system for wound treatment includes adjunctive wound therapy devices and substrates comprising multiple first reservoirs and multiple second reservoirs. Selected ones of the multiple first reservoirs include a reducing agent, and first reservoir surfaces of selected ones of the multiple first reservoirs are proximate to a first substrate surface. Selected ones of the multiple second reservoirs include an oxidizing agent, and second reservoir surfaces of selected ones of the multiple second reservoirs are proximate to the first substrate surface.
US10406346B2
A method and device for promoting healing of an injury in a living being are provided. Such method and device are based upon an injury covering portion, which portion comprises an electroactive polymer, such as poled polyvinylidine difluoride (PVDF) or a copolymer of PVDF. The electroactive polymer has either pyroelectric properties, piezoelectric properties, or both.
US10406344B2
A drug transfer assembly including a connector connectable to a portion of an intravenous line adapted for connection to a patient's bloodstream and an adapter cap removably connectable with the connector is disclosed. The connector is formed of a rigid material and the adapter cap is formed of a pliable material. With the adapter cap connected to the connector, the adapter cap protectively surrounds and shields the connector. The adapter cap provides a cushioning surface which prevents rubbing of the connector against the skin of a patient. In this manner, the adapter cap prevents the connector of a drug transfer assembly from causing irritation and/or infection to the skin of a patient. Furthermore, the adapter cap provides a protective shield which prevents the connector of a drug transfer assembly from becoming contaminated with undesirables.
US10406343B2
Cap and cleaning devices antiseptically maintain patient fluid line access valves to minimize the risk of infection via catheters. The devices have a cap that may contain a dry pad impregnated with an antimicrobial agent. The cap covers the access portion of the access valve when not in use. The devices have a hood that contains a wet pad impregnated with a cleaning solution and, optionally, an antimicrobial agent. The wet pad cleans the access portion of the access valve prior to and optionally, after the access valve is utilized to access the patient fluid line.
US10406338B2
In one embodiment, the nasal clip is infused with a volatile medicant and/or therapeutic aromatic that volatilizes under body temperature to permeate into the septum mucosa of a user's nose. In a second embodiment, the nasal clip has limbs that are pre-stressed to engage the septum mucosa so that the intermittent stimulation caused by the frequency of each heart beat and the heat in the inhaled warm breath help release the volatile medicants and aromatic materials. In a third embodiment, the nasal clip is integrated with an oxygen delivery cannula to allow delivery of oxygen with the medicant and/or therapeutic aromatic.
US10406332B2
Systems, devices, and methods may be used for delivery of an implant to a bodily cavity. The implant may include a hub and a plurality of legs, and may be moveable between a low-profile and expanded configuration. The systems may include a crimping device having a crimping member with a plurality of arms. The plurality of arms may engage the plurality of legs of the implant, and may move the legs to move the implant to the low-profile configuration. In some instances a delivery device may aid in crimping and/or delivery of the implant.
US10406329B2
Catheter having an elongate tubular shaft including an inflation lumen and a guidewire lumen defined therein, the guidewire lumen extending along at least a distal length of an inner tubular member of the elongate tubular shaft. The catheter includes a distal tip member having a proximal end and a distal end, wherein the distal tip member is monolithic and the proximal end of the distal tip member is secured to a distal end of the inner tubular member. The catheter includes a balloon having a proximal portion and a distal portion, the proximal portion of the balloon sealingly coupled to the distal portion of the elongate tubular shaft. The distal portion of the balloon is sealingly coupled to the distal tip member and the balloon defines an inner chamber in communication with the inflation lumen, wherein the proximal end of the distal tip member is disposed within the inner chamber.
US10406325B2
An anchoring mechanism and method for anchoring a device within a biological conduit include an expandable element configured for retaining the device at a desired angle relative to a central axis of the biological conduit. A steering mechanism is preferably provided for orienting the device prior to operation of the anchoring mechanism. The anchoring mechanism and method are employed in drug delivery devices, brachytherapy devices or for anchoring a catheter or sheath to provide a working channel for reliable guidance of a wide range of tools to a target location within the body.
US10406319B2
Catheters, sheaths, or other tubular devices are provided that include a proximal end, a distal end sized for introduction into a patient's body, and a steerable distal portion. The tubular device includes a primary lumen extending between the proximal and distal ends; an auxiliary lumen adjacent the primary lumen; and one or more reinforcement members including windings extending helically along at least the distal portion, at least some of the windings passing between the primary and steering element lumens and at least some of the windings surrounding both the primary and steering element lumens. In one embodiment, a steering element is slidably disposed within the auxiliary lumen. Apparatus and methods for making such tubular devices are also provided.
US10406318B2
Balloon catheter includes an outer shaft having a hypotube and a monolithic single-layer distal outer member, a balloon in fluid communication with an inflation lumen, and an inner tubular member having a guidewire lumen defined therethrough. The outer shaft has the inflation lumen defined therethrough. The monolithic single-layer distal outer member is necked to a reduced diameter along an entire length thereof. A proximal end of the monolithic single-layer distal outer member is coupled to the hypotube. A distal section of the hypotube comprises a skive defined by a first angled cut, an axial cut, and a second angled cut. The balloon has a proximal balloon shaft coupled to a distal end of the monolithic single-layer distal outer member. The inner tubular member extends distally from a proximal port in the monolithic single-layer distal outer member through at least a portion of the balloon.
US10406317B2
A microcatheter system is disclosed which may include a microcatheter, one or more microcatheter extensions, and/or a microcatheter hub. In an embodiment, the microcatheter has a plurality of zones where the outside diameter of each zone from the distal to the proximal end has an outside diameter that is the same as or greater than the previous zone while the inside diameter is constant throughout the microcatheter length. In a further embodiment, a unique joining mechanism is employed for coupling a microcatheter to a microcatheter extension or to a microcatheter hub. In a further embodiment, the microcatheter has at least one perforation along a sidewall of the microcatheter.
US10406315B2
There is provided an apparatus for controlling fluid flow, comprising a first component for holding or conveying fluid, the first component having a port for the passage of fluid, a fluid passageway (18) from the interior of the first component to the exterior of the first component through the port, a contact valve (1) located in the fluid passageway (18), a second component having an abutment means, and connecting means for connecting the second component to the first component, the contact valve (1) comprising a first valve arm (8) extending into the fluid passageway (18), the first valve arm (8) being movable between an open position in which fluid flow through the fluid passageway (18) is substantially permitted, and a closed position in which fluid flow through the fluid passageway (18) is substantially prevented, wherein, when the second component is connected to the first component, the abutment means moves the first valve arm (8) into the open position.
US10406314B2
An exhalation valve, an inhalation valve, a ventilator and a method for controlling ventilation are provided. An exhalation valve (10) or inhalation valve (10) for a medical ventilator (30) for controlling a flow of a fluid, especially a breathing gas, has an inlet (12) and an outlet (14) for the fluid. Between the inlet (12) and the outlet (14), a valve seat crater (16) and a diaphragm (18) are provided. The diaphragm (18) is movable relative to the valve seat crater (16) for influencing the flow through the valve seat crater (16). The valve seat crater (16) and the diaphragm (18) are arranged such that the valve seat crater (16) can partially be sealed by means of the diaphragm (18), with the diaphragm (18) and the valve seat crater (16) not closing completely on initial contact of the diaphragm (18) and the valve seat crater (16).
US10406313B2
A safety system for a breathing apparatus for delivery of an anesthetic agent having an anesthetic agent vaporizer having a reservoir for containing a liquid anesthetic agent has a reservoir for containing a liquid medical agent, a port for filling the reservoir with the liquid anesthetic agent, and a sensor device for sensing a filling action of the port. A change of position of a lid covering the port is can be detected, or insertion of a fill vessel into said the port is can be detected. Thus safety of said the equipment is improved by being able to de-pressurize the reservoir before opening a filling valve for communication of the port with the interior of the reservoir.
US10406312B2
A CPAP flow driver is adapted to split supplied breathable fluid into a first portion delivered to a venturi throat to generate a pressure drop to draw in ambient air to create a CPAP flow and a second portion that is delivered to a nebulizer to drive the nebulizer.
US10406307B2
A ventilator control signaling method includes recording an electromyogram signal of values following one another in time and transforming the electromyogram signal into an evaluation signal by applying an evaluation function. An evaluation signal value is assigned to a signal value of the electromyogram signal in the transformation. The evaluation function is determined by a main parameter set that defines which signal value of the evaluation signal is assigned to a particular signal value of the electromyogram signal when the evaluation function is applied in the transformation. A signal value height of the evaluation signal indicates whether the electromyogram signal corresponds to a first state or a second state. A control signal is generated from signal values and is set to switch a ventilator to an inhalation or an exhalation operating mode depending on the state of the evaluation signal. A ventilator is configured to perform the method.
US10406304B2
A dispenser for dispensing a pharmaceutical medium, including a sensor for sensing a dispensing operation and an electronic processing circuit for sensing and further processing a signal caused by the sensor. In order to simplify the design, the sensor is part of a sensor unit, which has a radio transmitter for producing a radio signal, and the processing circuit has a radio receiver designed to receive the radio signal produced by the radio transmitter.
US10406300B2
Devices and methods for sequential aerosolized administration of pharmaceutical agents. A portable device may be used to administer an initial dose of an active formulation comprising at least one first pharmaceutical agent and a subsequent dose of an active formulation comprising at least one second pharmaceutical agent that may have the effect of countering, enhancing, or mitigating the first pharmaceutical agent.
US10406283B2
An arrangement for connecting a syringe to an electromechanical pump for drug infusion is provided. The syringe comprises a syringe body having a first end for discharging a drug and a second end connected to the pump in a removable manner. An axially sliding plunger is housed in the syringe body for causing suction and injection of the drug through the first end. The pump comprises a pump body having a sliding rod that causes sliding of the plunger within the syringe body. The pump body has a collar axially extending around the sliding rod and provided with engaging elements. The syringe body has engaging elements arranged to cooperate with the engaging elements of the collar for firmly connecting the syringe to the pump. An annular flange extends radially around the syringe body. The flange cooperates with the collar to establish a tight sealing between the syringe body and the collar.
US10406282B2
Provided is a system and method for a removable syringe micro pump. More specifically, the removable syringe micro pump includes a pump housing having a first end and opposite thereto an attaching end, and at least one sidewall there between, the housing having a base proximate to the first end and, the attaching end having an attacher structured and arranged to temporarily engage a syringe. A volute spring is nested within the housing and attached proximate to the base, the volute spring having a compressed first position wherein coils of the volute spring are concentrically disposed under tension such that an initial height of the volute spring is equivalent to a width of a coil, and an extended second position wherein the release of tension extends the volute spring normally away from the pump housing. The volute spring has a diameter pre-selected to pass within a barrel of the engaged syringe. The volute spring further having a distal end structured and arranged to engage a plunger seal of the engaged syringe, wherein the release of tension between the first position and the second position permits the distal end of the volute spring to move the plunger seal towards a nozzle of the syringe. An associated method of use is also provided.
US10406277B2
A rectal drainage appliance is disclosed comprising a tubular element having an inflatable balloon at a distal end for anchoring the appliance in the rectum. The appliance includes one or more of: (i) first and second auxiliary lumens communicating with the inflatable balloon to provide independent inflation and pressure monitoring paths coupled to the balloon; (ii) a pressure state indicator defined by a mechanical element configured to flip between first and second states or shapes responsive to sensed pressure; and (iii) a collapsible auxiliary lumen larger than the inflation lumen, and configured to permit admission of irrigation fluid. The pressure state indicator may also be used in intestinal drains.
US10406273B2
A blood purification apparatus that is capable of performing a liquid spill prevention operation and uniformizing the amount of air introduced through an opened portion. The blood purification apparatus includes a dialysate introduction line that allows dialysate to be introduced into a dialyzer; a dialysate discharge line that allows the dialysate to be discharged from the dialyzer; coupling tools that allow free switching between a connected state which causes a closed circuit, and an opened state which causes the closed circuit to be opened to form an opened portion; and a control means that performs a liquid spill prevention operation in which external air is introduced through the opened portion. An air detection means, by which air introduced through the opened portion is detectable, is provided in the vicinity of the coupling tools, and the control means stops the liquid spill prevention operation when air is detected by the air detection means.
US10406267B2
Disclosed are systems and methods for use of an inductive link for a communication channel in a transcutaneous energy transfer system.
US10406263B2
An antibiotic-eluting article for implantation into a mammalian subject, produced by an additive manufacturing process wherein a polymeric material is concurrently deposited with a selected antibiotic. The additive manufacturing process may be a selective laser sintering process or a selective laser melting process or a selective heat sintering process or an electron beam melting process. The antibiotic-eluting article may be temporary or permanent orthopedic skeletal component, an orthopedic articulating joint replacement component, and/or an external hard-shell casing for an implantable device. One or more bone-growth-promoting compositions may be concurrently deposited with the polymeric material. The implantable device may be a cardiac pacemaker, a spinal cord stimulator, a neurostimulation system, an intrathecal drug pump for delivery of medicants into the spinal fluid, and infusion pump for delivery of chemotherapeutics and/or anti-spasmodics, an insulin pump, an osmotic pump, and a heparin pump.
US10406260B2
The invention provides tissue repair compositions and methods of making the tissue repair compositions. Also featured are methods of treatment using the tissue repair compositions and articles of manufacture that include the tissue repair compositions.
US10406256B2
Provided is a water absorbent resin that is useful to sanitary materials such as a disposable diaper, a sanitary napkin, and a blood absorbent for medical use each having a higher liquid permeability and a higher water absorbing speed. Further provided is a water absorbent resin powder that is useful to sanitary materials such as a disposable diaper, a sanitary napkin, and a blood absorbent for medical use each having increased in absorbency of a liquid and in heat retaining property. A gel grinding device to be used to produce a water absorbent resin, includes: a screw; a feed opening; an extrusion opening; a porous plate; and a barrel, the barrel including a return preventing member provided on an inner surface thereof, and the return preventing member satisfying at least one of specific parameters.
US10406249B2
Provided herein are compositions Gd(III)-dithiolane gold nanoparticle conjugates and methods of use thereof. In particular, compositions and method find use in in vivo imaging (e.g., magnetic resonance imaging (MRI)), for example, of pancreatic tissue.
US10406248B2
Cellular targets on cancer cells have been identified that can be used with targeted molecular imaging to detect the cancer cells in vivo. Non-invasive methods for detecting cancer cells, such as metastasized cancer cells, are therefore provided. Also provided are compositions and kits for use in the disclosed methods.
US10406243B2
A medicinal composition for diseases caused by dyslipidemia and/or autophagy dysfunction, etc., said medicinal composition comprising polyrotaxane that carries bulky substituents introduced, via intracellularly degradable bonds, into both ends of a linear molecule penetrating through plural cyclic molecules.
US10406237B2
There are provided for herein novel amine-containing transfection compounds and methods for making and using same. The compounds are generally obtained by reacting a primary amine with an unsaturated compound. Transfection complexes made using the amine-containing transfection compounds in combination with additional compounds to encapsulate biologically active agents such as nucleic acids are also provided for herein. Methods of using the transfection complexes for the in vivo or in vitro delivery of biologically active agents are also described. The transfection complexes of the present invention are highly potent, thereby allowing effective modulation of a biological activity at relatively low doses compared to analogous transfection compounds known in the art.
US10406229B2
Disclosed herein are compositions and methods for inhibiting viral entry.
US10406225B2
Antibodies that bind to tumor associated antigen CD44 or to tumor associated antigen EphA2, are disclosed herein, as well as related compositions and methods of use. Methods of use encompass cancer therapies, diagnostics, and screening methods.
US10406219B2
Provided herein is a multivalent Brucella vaccine expressing at least one heterologous M. tuberculosis antigen. The vaccines described herein serve as an environmentally safe bivalent vaccine for protection against Brucella and Mycobacterium infections simultaneously. In particular, a multivalent vaccine comprising a Brucella strain transformed with a vector that expresses at least one M. tuberculosis antigen, where the M. tuberculosis antigen(s) is codon optimized for the Brucella strain is provided. In some aspects, the Brucella strain is B. abortus strain RB51 leuB and the M. tuberculosis antigen is one or more of Ag85B, Rv2660c, and ESAT6.
US10406215B2
The present invention relates to cell-penetrating effector proteins of type III secretion system (T3SS)-containing bacteria of the genus Salmonella or Shigella and variants, fragments and immunomodulatory domains thereof, for use in immunotherapy. The present invention further relates to cell-penetrating effector proteins of type III secretion system (T3SS)-containing bacteria of the genus Salmonella or Shigella and variants, fragments and immunomodulatory domains thereof, for delivering cargo molecules into eukaryotic cells.
US10406212B2
The present invention relates to fibronectin-based scaffold domain proteins that bind to myostatin. The invention also relates to the use of these proteins in therapeutic applications to treat muscular dystrophy, cachexia, sarcopenia, osteoarthritis, osteoporosis, diabetes, obesity, COPD, chronic kidney disease, heart failure, myocardial infarction, and fibrosis. The invention further relates to cells comprising such proteins, polynucleotides encoding such proteins or fragments thereof, and to vectors comprising the polynucleotides encoding the proteins.
US10406209B2
Derivatives are synthesized of starting materials, usually polysaccharides, having sialic acid at the reducing terminal end, in which the reducing terminal unit is transformed into an aldehyde group. Where the polysaccharide has a sialic acid unit at the non-reducing end it may be passivated, for instance by converting into hydroxyl-substituted moiety. The derivatives may be reacted with substrates, for instance containing amine or hydrazine groups, to form non-cross-linked polysialylated compounds. The substrates may, for instance, be therapeutically useful drugs peptides or proteins or drug delivery systems.
US10406202B2
The invention provides non-hormonal vitamin D conjugated via the third carbon on the vitamin D backbone to parathyroid hormone (PTH) proteins that result in increased absorption, bioavailability or circulating half-life when compared to non-conjugated forms.
US10406200B2
The present invention provides compositions and formulations comprising glutathione with or without thiocyanate and methods of use thereof to treat diseases and disorders in mucosal/epithelial tissue.
US10406199B2
Provided herein are stable lisinopril oral liquid formulations. Also provided herein are methods of using lisinopril oral liquid formulations for the treatment of certain diseases including hypertension, heart failure and acute myocardial infarction.
US10406197B2
Disclosed are immunogenic peptides of the HTT protein and HTT specific antibodies for use in the prevention and/or treatment of Huntington's disease.
US10406196B2
Compositions for treating erectile dysfunction (“ED”), including age related erectile dysfunction (ARED), comprise in a preferred embodiment ginger and an amino acid. Preferably the amino acid is L-arginine and/or L-citrulline. Additionally, the compositions may comprise guarana (Paullinia cupana), Muira puama cortex magnoliae officinalis (CMO) and/or fructus aurantil immaturus (FAI). The compositions of the present inventions are administered in a pharmaceutically effective amount to treat erectile dysfunction. Essential ingredients in formulations of the present inventions for treatment of ED and ARED are ginger (or ginger derivative) and L-citrulline or L-arginine. A daily dosage of at least about 250 mg ginger and at least about 400 mg L-citrulline or L-arginine for a sufficient period of time will result in improved IIEF scores in a substantial number of patients.
US10406193B2
A composition for topical application with antifungal activity, containing Melaleuca alternifolia essential oil, oregano essential oil, lime essential oil and an ester of vitamin E is enclosed. Vitamin E acetate, n-propionate or linoleate, and is preferably alpha-tocopheryl acetate; preferably, these oils constitute at least 3% by weight of the composition and each of them constitutes at least 1% by weight of the composition; preferably, the composition contains from 10% to 97% of the ester of vitamin E and can consist of the three aforementioned essential oils and the vitamin E ester; alternatively, the composition can be in the form of hydrophobic gel, containing 10 to 50% of the ester of vitamin E, 20 to 60% of a vegetable butter or wax, from 10 to 30% of triglyceride of caprylic and capric acid and from 5 to 20% of a gelling agent for lipids and at least 3% of the aforementioned essential oils, each of which constitutes at least 1% by weight of the composition.
US10406184B2
Method of treating an inflammatory disease using lactic acid bacteria-derived extracellular vesicles
Provided is a composition for preventing, ameliorating, or treating inflammatory diseases, the composition including, as active ingredients, lactic acid bacteria-derived extracellular vesicles isolated from culture fluid of lactic acid bacteria; and a method for diagnosing atopic dermatitis. The composition including the lactic acid bacteria-derived extracellular vesicles as active ingredients is expected to be usefully used in development of drugs, cosmetics, or health functional food for preventing, ameliorating, or treating inflammatory diseases such as atopic dermatitis, chronic rhinitis, chronic rhinosinusitis, asthma, chronic obstructive pulmonary disease, sepsis, etc. Also, the composition will be usefully used for diagnosis of atopic dermatitis by measuring the distribution of lactic acid bacteria-derived extracellular vesicles in a urine or blood sample.
US10406173B2
A method of altering the targeting and/or cellular uptake efficiency of an adeno-associated virus (AAV) viral vector having a capsid containing an AAV9 cell surface binding domain is described. The method involves modifying a clade F cell surface receptor which comprises a glycan having a terminal sialic acid residue and a penultimate β-galactose residue. The modification may involve retargeting the vector by temporarily functionally ablate AAV9 binding in a subset of cells, thereby redirecting the vector to another subset of cells. Alternatively, the modification may involve increasing cellular update efficiency by treating the cells with a neuraminidase to expose cell surface β-galactose. Also provided are compositions containing the AAV9 vector and a neuraminidase. Also provided is a method for purifying AAV9 using β-galactose linked to solid support. Also provided are mutant vectors which have been modified to alter their targeting specificity, including mutant AAV9 in which the galactose binding domain is mutated and AAV in which an AAV9 galactose binding domain is engineered.
US10406169B2
Provided are methods for treating a neurodegenerative disease, such as multiple sclerosis, in a subject receiving a first estriol treatment regimen, comprising obtaining a measurement of the serum estriol concentration in the blood of the subject, and administering a second estriol treatment regimen to the subject if the serum estriol concentration is less than 6 ng/mL. The daily amount of estriol administered during the second estriol treatment regimen is preferably greater than the daily amount of estriol administered during the first estriol treatment regimen.
US10406140B2
Provided is a compound which is useful as an AMPK activator, represented by formula: wherein the symbols are defined in the specification.
US10406134B2
The invention generally relates in part to methods of effecting weight loss and/or improving glucose tolerance in a patient in need thereof, comprising administering a MetAP2 inhibitor.
US10406121B2
Provided is a novel compound having rapid and long-lasting therapeutic effects on diseases exhibiting depressive symptoms. Specifically, provided are an agent for prevention and/or treatment of a depressive symptom, consisting of R(−)-ketamine or a pharmacologically acceptable salt thereof, and a pharmaceutical composition for prevention and/or treatment of a depressive symptom, comprising R(−)-ketamine or a pharmacologically acceptable salt thereof in an effective amount for reducing a depressive symptom, and being substantially free of S(+)-ketamine, and a pharmacologically acceptable salt thereof.
US10406120B2
The present invention provides methods for treating glomerulosclerosis such as focal segmental glomerulosclerosis (FSGS) or glomerulonephritis such as immunoglobulin A nephropathy (IgAN) by cyclohexenone compounds.
US10406119B2
Compositions and pharmaceutical compositions including a dendrimer-resveratrol complex and methods for making and using the compositions are described herein. Methods of treating cancer, cardiovascular disease, cardiac failure, diabetes, Alzheimer's disease, Parkinson's disease and other brain diseases, fatty liver disease, obesity, cataracts, osteoporosis, muscle wasting, sleep disorders, acoustic trauma, inflammatory disease, psoriasis, arthritis, colitis, aging, viral disease, reproductive disease, and skin conditions or disorders including administering a therapeutically effective amount of the compositions to a subject in need are also provided. The compositions may be topically applied to skin or mucous membranes.
US10406115B2
Described are pressure-sensitive adhesive polymers (PSAs) useful, for example, for application to the skin, such as in the field of transdermal drug delivery. The PSAs include polar groups modeled on one or more polar portions of skin lipids, which contribute to good skin adhesion properties. Methods of making the PSAs, compositions comprising them, and methods of making and using them also are provided.
US10406113B2
The disclosure relates to compositions and methods for the preparation, manufacture and therapeutic use of combinations of immunomodulatory polynucleotides (e.g., mRNAs) encoding an immune response primer polypeptide (e.g., an interleukin 23 (IL-23) polypeptide or an interleukin 36γ (IL-36-gamma) polypeptide), and an immune response co-stimulatory signal polypeptide (e.g., an OX40L polypeptide).
US10406110B2
Provided is a nanoparticle-vitreous body-based protein complex, and more particularly, to a composition for inhibiting angiogenesis which includes the complex as an active ingredient, and a composition for preventing or treating an angiogenesis-related disease or a retinal disease. When the nanoparticle-vitreous body-based protein complex according to the subject matter is locally injected into the vitreous body, the complex exhibits significantly excellent binding strength with a vascular endothelial growth factor and thus can inhibit angiogenesis, thus being easily used to prepare a therapeutic agent for preventing, alleviating, or treating retinal and choroidal angiogenesis-related diseases.
US10406105B2
Pharmaceutical formulation in the form of agglomerates comprising A) an excipient content composed of a) 60-97% by weight of sugar or sugar alcohols, b) 1-25% by weight of a disintegrant, c) 1-15% by weight of water-insoluble, film-forming polymers d) 0-15% by weight of water-soluble polymers and e) 0-15% by weight of further pharmaceutically customary excipients the total of the components a) to e) being 100% by weight, and B) at least one active ingredient.
US10406092B2
The present invention relates to a method for producing a transparent or semi-transparent liquid glycerin derivative-modified silicone composition that comprises a hydration step of adding water to a liquid glycerin derivative-modified silicone or composition thereof. The present invention can provide a liquid glycerin derivative-modified silicone composition having a transparent or semi-transparent appearance can be provided.
US10406075B2
This invention relates to a dosage management system that comprises a container including a box with an opening towards the top. The box has a first side with an opposing second side and a third side. The box has a pair of parallel grooves in the first side and second side and a tray inside the box. There is also provided a resilient sliding lid. The lid has two parallel opposing edges that slidingly engage the grooves. At least one of the edges and grooves has a catch and notch combination that engage when the lid is in a closed position. The grooves have a first incline or decline part connected to a substantially horizontal part which is again connected to a second incline or decline part. When opening the box, the lid is pushed down the lid then bending into the horizontal part, the notch and catch disengaging and the lid is moved to the third side to open the box. Closing the box is accomplished by pushing the lid back towards the closing position and the catch is urged into the notch due to the lid regaining its shape.
US10406069B2
A method of increasing blood flow to the head includes causing an individual's blood to circulate while the individual's heart and head are at a first elevation position, elevating the individual's heart and head to a second elevation position that is above the first elevation position, and causing the individual's blood to circulate while the individual's heart and head are at the second elevation position.
US10406063B2
Medical equipment for High Frequency Chest Wall Oscillation treatment to be worn on a thorax, includes a plurality of pressure devices arranged to apply repetitive compressions to the thorax and each including a deformable chamber and at least a port communicating with the chamber configured to let a pressurized fluid flowing alternatively in and out the chamber so that the pressure device alternatively passes from an inflated configuration to a deflated configuration, the equipment including at least a frame for holding the pressure devices substantially perpendicular to the thorax, an outer face of the base being in contact with an inner face of the frame, wherein at least some of the pressure devices are aligned, two consecutive pressure devices being connected together by at least two tubes the distance (D) between the inner face of the frame and each tube connecting two consecutives pressure devices being inferior to 8 mm.
US10406046B2
Embodiments of a cot comprise a support frame, legs coupled to the support frame, at least one hydraulic actuator configured to raise or lower the legs, and a manual release system coupled to the at least one actuator and configured to lower the cot manually at a controlled descent rate. The manual release system comprises a manual actuation component, a manual release valve operable to be opened upon actuation by the manual actuation component, a fluid reservoir operable to receive hydraulic fluid from the at least one actuator upon opening of the manual valve; and a flow regulator configured to control the flow rate of the hydraulic fluid into the fluid reservoir, wherein the release of hydraulic fluid into the fluid reservoir at the controlled flow rate is configured to manually lower the cot at the controlled descent rate.
US10406044B2
A person support apparatus includes a base, wheels, a drive system, a support surface, a lift system, and a control. The control controls the drive system in response to forward/reverse forces applied thereto, and also controls the lift system in response to upward or downward forces applied thereto. In some embodiments, a controller compares a magnitude of the forward/reverse force to a magnitude of the upward/downward force and commands the drive system to drive the wheels if the magnitude of the forward/reverse force exceeds the magnitude of the upward/downward force. The control may include a user-engageable portion that is constructed to not move with respect to a force sensor when forward or reverse forces are applied to the user-engageable portion. The controller controls the drive system in response to the forward or reverse forces applied to the user-engageable portion.
US10406035B1
A sleep mask having a mask body with a central portion formed between two extension portions; an ear loop extending from each of the extension portions, wherein each ear loop is attached or coupled to the extension portion proximate terminal ends of the ear loop; and a scent diffusing area formed within each of the extension portions, wherein each of the scent diffusing areas is capable of being at least partially infused with an aroma compound.
US10406031B2
An applicator configured for cell treatment with pressure pulses has a hollow needle with a wall, which encloses a cavity and has a closed-off design at a closed-off end. A target is arranged or formed at the closed-off end on the inner side of the wall and a laser radiation emitter for emitting preferably pulsed laser radiation is arranged in the cavity of the hollow needle, at a distance from the target. The laser radiation emitter is arranged so that the emerging laser radiation impinges directly on the target through an interspace situated between the laser radiation emitter and the target. Under the formation of a plasma, at least one pressure pulse can be generated at the target by the target being impinged upon by laser radiation from the laser radiation emitter. The wall of the hollow needle has a lateral emergence opening for the emergence of the pressure pulse.
US10406029B2
Ocular implants, delivery devices and methods for treating ocular disorders are disclosed. One method involves inserting an implant on one side of an eye. The implant has an anchor on a distal end portion and an outlet opening that is disposed proximal of the anchor. The implant is advanced across the eye to the other side of the eye. The anchor is inserted into eye tissue on the other side of the eye. A therapeutic agent is eluted using the implant.
US10406027B2
An ophthalmic instrument includes a shaft comprising a lumen. The instrument also includes a first arm extending from the lumen, the first arm having a first distal portion having a first flat tip. The instrument also includes a second arm extending from the lumen, the second arm having a second distal portion having a second flat tip that is positioned such that the second flat tip contacts the first flat tip when the first arm is forced towards the second arm. The first arm and the second arm comprise at least in part, a first material that is substantially transparent to electromagnetic radiation having a wavelength within a range of about 700-1200 nanometers (nm) and is substantially opaque to electromagnetic radiation having a wavelength within a range of about 400-700 nm.
US10406022B2
A system for cooling the brain of a human subject, includes a cooling subsystem which inputs a flow of air or breathable gas, cool the air or breathable gas, and output cooled air or breathable gas which is delivered to a human subject. A flow control device to controls a flow rate of the flow of the air or breathable gas input to the cooling subsystem and a flow rate of the cooled air or breathable gas delivered to the human subject. One or more flow rate sensors measure at least a flow rate of flow of cooled air or breathable gas. One or more temperature sensors measure at least a temperature of a brain and the temperature of the flow of cooled air or breathable gas. A controller adjusts a cooling rate, the temperature, and the flow rate of flow of cooled air or breathable gas delivered to the human subject to cool the brain of the human subject.
US10406017B2
A device comprises an arm cover to be positioned under the arm before being closed thereover, a shoulder strap to be positioned under the shoulder and adapted to wrap the shoulder when attached, over the shoulder, to the closed arm cover and a longitudinal strap to be fixed to the table opposite to the head. The longitudinal strap can apply tension on the shoulder strap when shortened. A method for installing a device on an immobilized patient comprising positioning an arm cover under the arm and a shoulder strap connected to the arm cover under the shoulder, closing the arm cover over the arm and attaching the shoulder strap, over the shoulder, to the closed arm cover, fixing an end of a longitudinal strap, connected to the arm cover, to the table opposite to the head and pulling on the longitudinal strap to apply tension on the shoulder strap.
US10406014B2
Postural corrective device including a flexible back support system incorporated into a body suit that trains self-corrective habits through proprioceptive feedback, offering gentle reminders to create awareness of what the wearer's body is doing.
US10406013B2
A dorsal night splint has dynamic adjustable features that allow the patient to adjust the splint while in use to control the stretching of the plantar fascia and Achilles. A semi-rigid flexible frame is included along with a tightening strap that is anchored to the frame and by which the patient can tension the strap and adjust the structure of the frame to fit the patient's desired therapeutic or prophylactic needs.
US10406010B2
A system for treating a bifurcated vessel that includes a first delivery catheter and a second delivery catheter. The first delivery catheter carries a proximal first stent and a distal second stent. The first delivery catheter also has a first elongate shaft, a proximal first expandable member with the proximal first stent disposed thereover, and a distal second expandable member with the distal second stent disposed thereover. The proximal first expandable member and distal second expandable member are independently expandable of one another. The second delivery catheter carries a third stent. The second delivery catheter also has a second elongate shaft, and a third expandable member with the third stent disposed thereover. The third expandable member is independently expandable of the proximal first expandable member and the distal second expandable member.
US10405999B2
A prosthetic joint can include a first attachment member and a second attachment member coupled to the first attachment member. The second attachment member can include a cylindrical chamber. The prosthetic joint can include a fixation system disposed within the cylindrical chamber comprising at least one cam. The prosthetic joint can have an unlocked configuration, wherein in the unlocked configuration the first attachment member and the second attachment member can rotate relative to each other. The prosthetic joint can have a locked configuration, wherein in the locked configuration the first attachment member is substantially prevented from rotating relative to the second attachment member.
US10405996B2
A variable gain impedance controller for use in a control system for controlling a motorized prosthetic or orthotic apparatus provided with a joint. The controller comprises a sensor input for receiving a signal indicative of an interaction between the apparatus and the ground, a torque sensor input for receiving a signal indicative of the torque at the joint, and a variable gain scheduler in communication with the sensor input to receive data therefrom thereby providing a variable torque gain. The variable gain impedance controller adjusts its control on the apparatus based on the variable torque gain and the indicated torque to increase the joint resistance to motion when the signal received from the sensor input indicates an interaction between the apparatus and the ground, and decrease the joint resistance to motion when the signal received from the sensor input indicates an absence of interaction between the apparatus and the ground.
US10405995B2
Provided is an artificial limb structure having a magnetic lock device. The artificial limb structure includes: an artificial limb coupled to a magnetic lock device; and a socket liner unit detachably coupled to the magnetic lock device, wherein the socket liner unit includes an attachment and detachment member attachable and detachable to/from the magnetic lock device by a magnetic force, and the magnetic lock device includes: permanent magnets; a magnetic flux control unit provided on the permanent magnets and transmitting the magnetic force generated by the permanent magnets to the attachment and detachment member or interrupting a transmission of the magnetic force; a magnetic force interrupting unit provided at the magnetic flux control unit and interrupting magnetic forces between permanent magnets arranged at opposite sides of the magnetic force interrupting unit; and a switch unit adjusting an arrangement of the permanent magnets with respect to the magnetic force interrupting unit.
US10405994B2
A surgical referencing guide includes a body having a contact surface and a first foot extending away from the body. The first foot includes a first reference surface having a first area defined by a standard deviation of a first dataset extracted from a database and being comprised of a plurality of first data points each corresponding to an individual bone within a population of bones and each corresponding to a location of a preselected point on the bone within a predetermined coordinate system.
US10405990B2
A spinal implant comprises a body including a first vertebral engaging surface and a second vertebral engaging surface. The first vertebral engaging surface is rotatable relative to the second vertebral engaging surface. Systems and methods are disclosed.
US10405986B2
An orthopedic device for implanting between adjacent vertebrae comprising: an arcuate balloon and a hardenable material within said balloon.In some embodiments, the balloon has a footprint that substantially corresponds to a perimeter of a vertebral endplate. An inflatable device is inserted through a cannula into an intervertebral space and oriented so that, upon expansion, a natural angle between vertebrae will be at least partially restored. At least one component selected from the group consisting of a load-bearing component and an osteobiologic component is directed into the inflatable device through a fluid communication means.
US10405974B2
A replacement heart valve implant may include an expandable anchor member, a plurality of valve leaflets disposed within the anchor member, a seal member disposed about a distal portion of the anchor member, one or more whip sutures attaching a distal end of the seal member to a distal end of the plurality of valve leaflets at a joint, one or more distal lashing sutures attaching a distal portion of the seal member to a distal end of the anchor member, and a plurality of proximal lashing sutures attaching a proximal portion of the seal member to the distal portion of the anchor member, wherein the one or more distal lashing sutures does not extend through the seal member.
US10405970B2
A system and method of treating target tissue in a patient's eye, which includes generating a light beam, deflecting the light beam using a scanner to form first and second treatment patterns, delivering the first treatment pattern to the target tissue to form an incision that provides access to an eye chamber of the patient's eye, and delivering the second treatment pattern to the target tissue to form a relaxation incision along or near limbus tissue or along corneal tissue anterior to the limbus tissue of the patient's eye to reduce astigmatism thereof.
US10405965B2
Example stent grafts and methods for placement thereof are provided. An example stent graft may include (a) a main body stent graft defining a lumen that has a first end and a second end, (b) a diaphragm coupled to the main body stent graft, where the diaphragm defines at least three openings and (c) at least three stent graft extensions each defining a lumen, where a first end of each of the three stent graft extensions is coupled to one of the three openings.
US10405963B2
The present invention includes biomimetic nerve conduits that can be used as nerve regeneration pathways. The present invention further provides methods of preparing and using biomimetic nerve conduits. The disclosed compositions and methods have a broad range of potential applications, for example replacing a missing or damaged section of a nerve pathway of a mammal.
US10405960B2
The invention relates to a prosthesis (1) comprising a textile (2) of elongate shape defining a longitudinal axis A, and a resilient frame (3) connected to said textile along substantially the peripheral edge of the textile, said frame forming, in the area of each short side of the textile, at least one U-shaped bend (4) extending in the direction of the longitudinal axis, said frame being able to adopt an unstressed configuration, in which said textile is deployed, and a stressed configuration, in which said frame is subjected to a radial force directed towards said longitudinal axis and said textile forms at least one longitudinal fold.
US10405954B2
A compact oral hygiene device includes a unique mini constant jet pump which integrated with a motor, has three diaphragm chambers, draws the fluid from a reservoir and propels fluid out from a buffer room to tips at constant pulseless, high efficiencies and low noise; and a plurality of exchangeable tips cleanses teeth and the interdental area.
US10405949B2
The various embodiments described herein include a method for applying a set of orthodontic brackets to a set of teeth of a patient. The method includes: (1) for each tooth in the set of teeth, determining an optimal orientation for a respective orthodontic bracket in the set of orthodontic brackets to be mounted to the tooth; (2) producing a bracket applicator configured to mount each orthodontic bracket in the set of orthodontic brackets to the respective tooth in the set of teeth in the respective optimal orientation; and (3) mounting the set of orthodontic brackets to the set of teeth using the bracket applicator and a bonding material.
US10405932B2
Various embodiments of tool assemblies are provided having at least one rotary input coupling and at least one linear input coupling for allowing either a rotary output or a linear output (e.g., from a tool driver on a surgical robot) to activate at least one mechanism of the tool assembly. For example, mechanisms of the tool assembly can include a clamping assembly, a firing assembly, an articulation assembly, and a roll assembly. The clamping assembly can open and close jaws of an end effector, the firing assembly can translate a knife assembly through the end effector to fire staples and cut tissue, the articulation assembly can articulate the end effector, and the roll assembly can rotate the elongate shaft and/or the end effector.
US10405928B2
A computer-assisted surgery (CAS) system for tracking an orientation of a pelvis comprises at least one instrument, the instrument having an acetabulum abutment end adapted to be received in an acetabulum, a rim abutment adapted to be abutted against a rim of the acetabulum, and an indicator representative of a physical orientation of the instrument. An inertial sensor unit is connected to the at least one instrument, the inertial sensor unit producing readings representative of its orientation. A computer-assisted surgery processor unit comprises a coordinate system module for setting a pelvic coordinate system from readings of the at least one inertial sensor unit when the at least one instrument has the acetabulum abutment end received in the acetabulum, the coordinate system module setting the pelvic coordinate system by obtaining a plurality of orientation values from the at least one inertial sensor unit when the rim abutment is abutted against locations of the rim, one of said orientation values having the indicator aligned with a reference landmark, the coordinate system module defining an acetabular plane representative of the pelvic coordinate system from the plurality of orientation values; and a tracking module for tracking an orientation of the at least one inertial sensor unit relative to the pelvic coordinate system during movements thereof using the readings from the inertial sensor unit. An interface outputs orientation data as a function of the pelvic coordinate system.
US10405926B2
A method of planning a procedure to fasten an implant to a bone includes displaying a model of the bone and a model of the implant on a display device. The model implant is positioned on the model bone in a desired implant position. A first boundary volume of a first fastener configured to fasten the prosthesis to the bone is also displayed on the display device. The first boundary volume represents a range of possible positions that the first fastener may have with respect to the prosthesis when fastened to the bone. The boundary volume may be used to determine a desired size, shape, and/or positioning of the fastener with respect to the bone.
US10405925B2
Systems and methods are disclosed for creating an interactive tool for determining and displaying a functional relationship between a vascular network and an associated perfused tissue. One method includes receiving a patient-specific vascular model of a patient's anatomy, including at least one vessel of the patient; receiving a patient-specific tissue model, including a tissue region associated with the at least one vessel of the patient; receiving a selected area of the vascular model or a selected area of the tissue model; and generating a display of a region of the tissue model corresponding to the selected area of the vascular model or a display of a portion of the vascular model corresponding to the selected area of the tissue model, respectively.
US10405924B2
A system for ablation and removal of occlusions from blood vessels is provided. Laser cutting systems and mechanical cutting systems are provided in catheter devices, the cutting systems operable to ablate, cut, dislodge, and otherwise remove occlusions within a blood vessel that may limit or prevent proper circulation. Aspiration systems are further provided, the aspiration systems operable to remove ablated, cut, or dislodged material through a primary orifice at the distal end of the catheter and/or through an auxiliary orifice, which may be on the side of the catheter.
US10405921B2
Devices and methods for cooling microwave antennas are disclosed herein. The cooling systems can be used with various types of microwave antennas. One variation generally comprises a handle portion with an elongate outer jacket extending from the handle portion. A microwave antenna is positioned within the handle and outer jacket such that cooling fluid pumped into the handle comes into contact directly along a portion of the length, or a majority of the length, or the entire length of the antenna to allow for direct convective cooling. Other variations include cooling sheaths which form defined cooling channels around a portion of the antenna. Yet another variation includes passively-cooled systems which utilize expandable balloons to urge tissue away from the surface of the microwave antenna as well as cooling sheaths which are cooled through endothermic chemical reactions. Furthermore, the microwave antennas themselves can have cooling lumens integrated directly therethrough.
US10405914B2
A power source delivers oscillating electrical energy to an electrical conductor, such as a wire or catheter, which is coated circumferentially with a ferromagnetic material in a selected region. With high frequency electrical energy, the ferromagnetic material has a quick response in heating and cooling adjustable by the controllable power delivery. The ferromagnetic material can be used for separating tissue, coagulation, tissue destruction or achieving other desired tissue effects in numerous surgical procedures.
US10405912B2
An intravascular catheter for peri-vascular or peri-urethral tissue ablation includes multiple needles advanced through supported guide tubes which expand with open ends around a central axis to engage the interior surface of the wall of the renal artery or other vessel of a human body allowing the injection an ablative fluid for ablating tissue, such as nerve fibers in the outer layer or deep to the outer layer of the vessel, or in prostatic tissue. The system also controls the depth of penetration of the ablative fluid into and beyond the tissue of the vessel wall. The catheter includes structures which provide radial and lateral support to the guide tubes so that the guide tubes open uniformly and maintain their position against the interior surface of the vessel wall as the sharpened injection needles are advanced to penetrate into the vessel wall.
US10405909B2
A device for implanting heat deformable fixation elements of different sizes in a bone, comprises a hand piece extending from a proximal end to a distal end and including an internal optical waveguide connected to a laser source and open to the distal end of the hand piece and a light guiding tip extending from a proximal end to a distal end, the proximal end of the light guiding tip being removably mechanically and optically connectable to the distal end of the hand piece and the distal end of the light guiding tip being configured to permit removable attachment of a bone fixation element, the light guiding tip including an optical waveguide, wherein the light guiding tip is configured to control a total radiant energy Q transmitted from the laser source to the bone fixation element.
US10405904B2
An exemplary bone screw includes a proximal section including a first outer thread, a center section including a second outer thread, an unthreaded distal section on an opposite side of the center section from the proximal section, a channel extending from the proximal section to a distal opening of the unthreaded distal section, and at least one side opening extending from the channel to an outer surface of the unthreaded distal section. In some embodiments, the at least one side opening includes a cutting edge configured to cut a material as the bone screw is rotated in a direction for removing the bone screw. In other embodiments, the side opening is formed in at least one of the center section and the unthreaded distal section and includes a diameter that increases in a direction from the channel toward an outer surface of the center section or the unthread distal section. The exemplary bone screws may be used to treat bone fractures with or without a bone plate.
US10405902B2
The present invention provides a sternal closure and ribs approximator device, the device comprising: a substantially C-shaped shaft/bracket, said bracket comprising: a linear shaft and a pair of curvilinear arms at either ends of the shaft, respectively; and a pair of claw shaped clamping elements, each claw shaped clamping element coupling with an arm of the C-shaped shaft/bracket, near its end portion, said claw shaped clamping element being positioned such that the concavity of the claw faces the inner area determined by the arms of the C-shaped clamping shaft/bracket, the coupling being provided by means of a fastening mechanism such that angular displacement of the claw shaped clamping element about the pivoted fastening mechanism is provisioned, said claw shaped clamping elements adapted to be angularly displaced towards each other or away from each other.
US10405900B2
Disclosed herein is an apparatus for fixing a cervical spine. The apparatus for fixing a cervical spine includes a plate in which a plurality of screw insertion holes is formed, bone screws inserted into the screw insertion holes and screwed onto a bone fragment through rotation, and a locking part rotatably coupled to the plate to open or close a top of the screw insertion hole. A stepped part of a specific depth is formed on top of the plate. The stepped part includes a rotation area in which the locking part is capable of rotating. A locking part insertion hole is formed in the rotation area so that the locking part is inserted into locking part insertion hole.
US10405896B2
A rod reducer including a housing, a plurality of arm members, an anvil, a shaft, a sleeve, and a plurality of locking feet. The shaft and locking feet are coupled to the anvil. The housing is slidably disposed within a cavity of the sleeve and defines an opening to receive the shaft. The locking feet are additionally coupled to the sleeve and are pivotable between an engaged configuration with the sleeve in a distal position with respect to the anvil and a released configuration with the sleeve in a proximal position. In the engaged configuration an engagement surface of the locking feet couple to an outer housing of a dual layered housing of a bone screw such that proximal translation of the shaft drives the outer housing proximally with respect to an inner housing of the bone screw into a partially locked or locked configuration.
US10405886B2
The present invention relates to a fully integrated sterilizable one time use disposable tissue visualization device and methods for using such devices. Preferred embodiments of the invention facilitate the visualization of an internal tissue site while causing a minimum of damage to the surrounding tissue. Further preferred embodiments may allow for the delivery of fluids and other treatment to an internal tissue site.
US10405882B2
Embodiments disclosed herein generally relate to an access sheath and access systems. In some embodiments, the access sheath may be non-adjustable access sheath or an adjustable access sheath. For example, a length of the adjustable access sheath may be modified or customized (e.g., before insertion thereof in a patient) to a suitable length for a particular patient. In some embodiments, the access sheath and/or dilator may have a substantially fixed or predetermined length.
US10405876B2
A surgical apparatus includes a body, an ultrasonic transducer, a shaft, an acoustic waveguide, an articulation section, an end effector, and a restricting member. The ultrasonic transducer is operable to convert electrical power into ultrasonic vibrations. The shaft couples the end effector and the body together. The acoustic waveguide is coupled with the transducer. The articulation section is operable to flex to thereby deflect the end effector from a longitudinal axis defined by the shaft. The restricting member is operable to restrict lateral deflection of the end effector. The restricting member is further operable to cooperate with a translating member to rigidize the articulation section when the end effector is aligned with the longitudinal axis. Such rigidization includes removing any “play” or other small movement that might otherwise be provided by the articulation section due to manufacturing tolerances and/or looseness between parts.
US10405873B2
A surface digitizing tool has a film of micro-sensor elements, with each micro-sensor element related in a network affected by a shape of the film. The film is flexible to conform to a shape of a selected surface of an object. A processing unit receives signals from the micro-sensor elements of the network. The processing unit has a model generator producing a model of the selected surface of the object from the signals of the network of resistive elements. A positioning frame aligns a position and orientation of a drilling tool with respect to a bone element.
US10405872B2
A cutting head for use with an intramedullary reamer is described. The reamer cutting head is of a unitary body construction that comprises a conically-shaped body having a bone cutting portion spaced from a barrel portion for attachment to a drive shaft. The bone cutting portion comprises a plurality of blades having a tissue cutting edge that outwardly extends from the cylindrical body. The plurality of blades is positioned about the cutting head in a spaced apart manner. The various plurality of blades are arranged at prescribed angular relationship that increases cutting efficiency and debris removal, thereby reducing reactive torque, axial loading, and head pressure during a surgical procedure.
US10405869B2
A device 10 for gathering tissue in a patient includes an elongated catheter 14 and a capture assembly 13 at a distal portion of the catheter. The capture assembly has a closed side 18 and a door 20 rotatable between an open condition and a closed condition. The closed side 18 of the capture assembly 13 and the door 20 in the closed condition may collectively define a tissue capturing compartment 19. Movement of the door 20 from the open condition to the closed condition adjacent the tissue may capture a portion 44 of the tissue in the tissue capturing compartment 19. A clip may then be applied from the capture assembly 13 to the captured tissue 44 to hold the tissue substantially in a gathered configuration.
US10405863B2
A surgical stapling instrument comprising an elongate shaft assembly that defines a shaft axis and includes a surgical end effector that is operably coupled thereto by an articulation joint. The surgical instrument includes a longitudinally movable flexible firing beam that is configured to flexibly traverse the articulation joint and be selectively axially movable from a starting position to an ending position. A middle support member is movably coupled to the elongate shaft assembly and a portion of the surgical end effector. A proximal support link is located proximal to the middle support member and is configured to provide lateral support to a proximal portion of the flexible firing beam traversing the articulation joint. A distal support link is located distal to the middle support member and is configured to provide lateral support to a distal portion of the flexible support beam traversing the articulation joint.
US10405850B2
A suture passer comprising: a hollow tube, said hollow tube comprising a distal end, a proximal end, and a lumen extending from said distal end to said proximal end; and a suture manipulation rod slidably received in said lumen of said hollow tube and selectively projectable out said distal end of said hollow tube, said suture manipulation rod comprising a distal end and a proximal end, said distal end of said suture manipulation rod being bifurcated into a first arm and a second arm, wherein said first arm includes a hook comprising a proximally oriented hooking surface and a return extending proximally of said hooking surface; wherein said hollow tube and said suture manipulation rod are sized so that said suture manipulation rod may capture a suture disposed adjacent to said distal end of said hollow tube and draw the suture into said lumen of said hollow tube, and further wherein, after a suture has been drawn into said lumen of said hollow tube, distal movement of said suture manipulation rod causes the suture to be expelled from said hollow tube.
US10405835B2
The present invention relates to ultrasound imaging systems and methods, more particularly, to ultrasound imaging systems and methods for a multi-plane acquisition for single- or bi-plane real-time imaging modes suitable for ultrasound imaging applications, such as quantification of tumor blood flow and tumor fractional blood volume. An ultrasound imaging apparatus can determine a plurality of image planes to scan through a region of interest, acquire echo information corresponding to each of the image planes, generate image information for each of the image planes, store the image information corresponding to each of the image planes; and display an ultrasound image comprising the region of interest, wherein the ultrasound image is rendered from generated image information for a selected image plane of the plurality of image planes or a bi-plane that is at angle to the plurality of image planes.
US10405834B2
An anatomical structure is segmented from images generated in an anatomical scan. A user input device is configured for manually identifying two or more seed points on a plurality of the images. An image processor is configured to identify an optimal path through seed points on the plurality of images with a graph search. The optimal path between corresponding seed points on different images defines a boundary contour, and the anatomical structure includes two or more boundary contour. The image processor is further configured to interpolate the boundary contours over a three-dimensional volume using cardinal splines.
US10405830B2
A memory alloy is used during manufacture of a transducer. The memory of the alloy may correct for deviations or bending during manufacture, such as a superelastic alloy returning an array to a flat state after being twisted during handling. The memory of the alloy may cause a desired change in array geometry during manufacture, such as a shape memory alloy twisting an array into a curved or helix due to applied heat. The array may be fixed in place by the memory alloy or bonding after positioning by the memory alloy, preventing further substantial alteration.
US10405828B2
The invention relates to location determination apparatus for determining a location of a first object (2) like a catheter within a second object (3) being, for example, the heart of a person. The first object comprises a first ultrasound unit, and a second ultrasound unit (5) is located outside the second object. A location determination unit determines the location of the first object within the second object based on ultrasound signals transmitted 5 between the first ultrasound unit and the second ultrasound unit. This allows determining the location of the first object within the second object reliably in a way which is an alternative to using a transmission of electrical signals for determining the location and which may lead to an improved accuracy of determining the location.
US10405827B2
A three-dimensional reference image is displayed along with an ultrasound image (tomogram). The three-dimensional reference image has a first existing line representing a first puncture needle and a second prospective line indicating the prospective puncture path of a second puncture needle. The position and orientation of the probe are adjusted by the user with reference to the three-dimensional reference image so that the second prospective line has an appropriate position relative to the first existing line. After the adjustment, the second puncture needle is inserted into the body using a puncture adaptor provided on the probe. A second existing line is displayed in the three-dimensional reference image when the insertion of the second puncture needle is completed.
US10405820B2
A method for display of a fluoroscopic image sequence during ongoing image acquisition acquires and renders a first image of a subject on a display according to a first parameter setting, modifies the first parameter setting according to an operator instruction entered following acquisition of the first image, and applies the modified first parameter setting for acquiring and rendering one or more subsequent fluoroscopic images of the subject in the fluoroscopic image sequence.
US10405814B2
An X-ray imaging apparatus according to an embodiment of the present invention includes an X-ray generator that irradiates an object with X-rays during an exposure period; an X-ray detector that detects X-rays transmitted through the object; and a movement unit that moves the X-ray generator and the X-ray detector, wherein the X-ray generator is moved along an arc having a radius of curvature within a range with respect to a rotational axis, wherein the motion along the arc starts at a first time point and ends at a second time point, wherein the X-ray detector is moved in a linear direction having an angle with respect to a plane of the arc during at least a partial period of a period between the first time point and the second time point, wherein the motion in a linear direction starts at a third time point that is the same as or later than the first time point and ends at a fourth time point that is the same as or earlier than the second time point, and a first difference between the first time point and the second time point is larger than or equal to a second difference between the third time point and the fourth time point.
US10405808B2
Contactless blood pressure monitoring, includes: illuminating a blood vessel of a patient with infrared (‘IR’) light; receiving, by an IR camera through a polarizing filter, IR light reflected by the patient; capturing at a time based on a heartrate of the patient, a first IR image of the blood vessel of the patient when the blood vessel is distended; determining, from the first image, a maximum diameter of the blood vessel; capturing at a time based on the heartrate of the patient, a second IR image of the blood vessel of the patient when the blood vessel is contracted; determining, from the second IR image, a minimum diameter of the blood vessel; and calculating blood pressure of the patient in dependence upon the maximum and minimum diameters of the blood vessel.
US10405801B2
A display panel having health monitoring function, including a first substrate; a second substrate; and a monitoring unit. The monitoring unit is configured to monitor a change in human physiological information and is disposed on the first substrate or the second substrate through a patterning process. Such display panel having health monitoring function solves the technical problem that existing display panels having health monitoring function are poor in level of integration with incompact structures.
US10405798B2
A bio-information detecting apparatus includes: a band member curved in a C-shape, and attached around a neck part of an examinee from a back side of the neck part; and a pair of electrodes for cardiac potential measurement disposed at positions on the band member that come into contact with right and left skin surfaces of the neck part, and in the pair of electrodes, a position of the electrode on the right is located relatively more frontward than a position of the electrode on the left. The bio-information detecting apparatus further includes a substrate to optically measure a blood oxygen saturation for pulse measurement at a position on the band member that comes into contact with the neck part of the examinee, and a pressing force of the substrate against the skin surface of the neck part is 0.96 to 1.21 [N/cm2].
US10405795B1
A method and system for classifying different types of periorbital dyschromia is disclosed. The method includes providing at least one of a predetermined imaging characteristic and a biological characteristic for each of three different types of periorbital dyschromia, and then measuring the appropriate characteristic on a person exhibiting periorbital dyschromia. The type of periorbital dyschromia exhibited by a person can then be determined by comparing the measured value to the predetermined value and selecting the corresponding type of periorbital dyschromia.
US10405789B2
An apparatus for determining the volume of urine in a human bladder is described. The apparatus uses light to determine the length of a flexible tube attached vertically to the outside of the bladder, and converts the length into a fullness value that is transmitted to an external device that notifies a user about the state of the bladder.
US10405782B2
A photoplethysmographic device including at least one laser light source and further including a protective sensor connector that has a protective flap (350), a mechanism (340) for controlling movement of the protective flap, and a plurality of interconnections, at least one of which is an optical connection (240). The movement of the protective flap designed to provide at least a substantially open position and a substantially closed position.
US10405769B2
An electrical stimulation and bio-potential measurement device is provided. The electrical stimulation and bio-potential measurement device comprises at least one electrode module which comes into contact with the scalp of a user, a current supply unit, connected to the at least one electrode module, for supplying a current to the at least one electrode module so that the at least one electrode module can apply electrical stimulation to the user, and a signal processing unit, connected to the at least one electrode module, for processing bio-potential signals detected by the at least one electrode module, wherein the current supply unit comprises at least one switch which is arranged between the at least one electrode module and a voltage source for supplying the current.
US10405767B2
A portable medical device having an intravenous line flow sensor integrated into a cable. The portable medical device may be a defibrillator having an ECG or electrode cable couple to ECG or electrode leads. The flow sensor may be integrated into the ECG or electrode cable. The portable medical device uses the flow sensor to capture and store information about fluids delivered to a patient being treated with the portable medical device. The information may include total volume provided, flow rate, and the like. The information may then be used to evaluate the treatment provided to the patient.
US10405766B2
Methods and systems for mapping and displaying cardiac structures are disclosed. The method includes sensing cardiac electrical signals at a plurality of points and generating a cardiac map of at least a portion of one or more cardiac structures based on at least a portion of the sensed cardiac electrical signals. A surface map having a corresponding first position relative to the cardiac map is generated. The surface map includes a first surface point, where a first cardiac electrical signal feature is represented on the surface map at the first surface point if a corresponding first cardiac electrical signal is sensed at a point that is located within a threshold distance of the first surface point. The cardiac map and the surface map, at the first position, are displayed. The surface map may be repositioned to a second position.
US10405762B2
A system for non-invasively measuring cardiac output, stroke volume, or both comprises a pulse oximeter, a data processor, and means for generating an output reporting measured one or more CO or SV values to a user. A method for non-invasively measuring cardiac output, stroke volume, or both comprises collecting plethysmographic waveform data of a patient, providing the plethysmographic waveform to a data processor, and calculating measured values for CO or SV. The data processor comprises a mathematical model of the cardiovascular system integrated in a dynamic state space model (DSSM).
US10405756B2
An examination device for a heart. An afterload device connected to the aorta provides a counter-pressure by an annular space delimited between a rigid cylinder and an elastic tube inserted in the rigid cylinder. The annular space comprises a compressible medium, such as air, nitrogen gas or carbon dioxide and is connected to a reservoir providing a predetermined pressure corresponding to a diastolic pressure. The reservoir is connected to the annular space via a restriction and a back-flow valve. During diastole, the annular space is inflated by the reservoir and provides a diastolic counter pressure for providing coronary flow. During systole, the ejected fluid from the heart ventricle displaces the medium inside the annular space through the restriction to the reservoir, thereby removing energy from the fluid. The compressible medium forms a compliance. Also, there is a preload device comprising a vertical collapsible tube for preload of the atrium.
US10405754B2
System and methodology objectively capture clinical data on oral health and provide standardized scoring for quantifying oral health. The process of capturing clinical data is based on use of an intraoral camera with imaging software that has the capacity to capture digital images of all tooth surfaces. Digital plaque data are collected in a standardized manner per tooth, and with the ability to select optimal frames for analysis. Data are extracted per tooth into a software program. Color classification of each pixel is determined by the software program using an algorithm that makes use of red/green/blue color code combinations. These classifications are then quantitatively used within the software program and separate algorithms that automatically generate a range of oral health scoring techniques.
US10405752B2
An apparatus for skin imaging is provided. The apparatus is used in conjunction with a mobile device to obtain digital images using a digital camera and a light source provided by the mobile device. The apparatus includes an optical system for illuminating an object to be imaged with uniform ambient light and a light conduit for delivering reflected light to the mobile device digital camera. The apparatus is removably attachable to the mobile device and/or a mobile device case. One or more optical elements, such as lenses, films, filters, and light caps may be used to improve image quality and/or acquire magnified images.
US10405751B2
The present invention provides a non-invasive device and method of detecting or evaluating brain damage in a living subject.
US10405748B2
A device (901) is manufactured from a sheet layer (100) defining a plurality of panels (101,102,103). Each panel is connected to at least one other panel along a common edge (104). A perforation (105) extends along the common edge and defines a separation location allowing the each panel to be separated from adjoining panels when an applied force pulls each panel away from the adjoining panels. A score line (115) bisects each panel and is oriented orthogonally with the perforation. The score line allows a first portion (116) of each panel to fold about the score line to abut a second portion (117) of each panel. An adhesive (501), disposed along the first portion, retains the first portion to the second portion, as well as retains the filament between the first portion and the second portion.
US10405747B2
A glucose monitoring system, includes a glucose sensor strip or package of strips. The strip includes a substrate and a glucose monitoring circuit that has electrodes and a bodily fluid application portion of selected chemical composition. An antenna is integrated with the glucose sensor strip. A RFID sensor chip is coupled with the glucose sensor strip and the antenna. The chip has a memory containing digitally-encoded data representing calibration and/or expiration date information for the strip.
US10405723B2
A surface maintenance machine comprising a body having a forward section, a middle section and a rearward section, wherein the forward section is positioned to the front of a transverse centerline of the machine, the middle section is generally centered on the transverse centerline and a rearward section positioned to the rear of the transverse centerline. A storage chamber can be defined in the middle section and enclosed by a front wall, a rear wall, lateral walls, a generally planar top surface, and a generally planar lower surface, such that the storage chamber is generally isolated from components of the surface maintenance machine. The storage chamber can have a storage chamber bottom surface with or below a top surface of at least one battery positioned in the forward section.
US10405712B2
A cleaning apparatus for use in explosive atmospheres is disclosed, the cleaning apparatus being configured to conduct to earth any electrostatic charges generated in the components of the apparatus thereby preventing electrostatic discharge. The apparatus comprises a flexible hose member comprised of an electrically conductive material and having first and second open ends, the hose member being suitable for attachment at its first end to a port of an associated suction unit to mechanically and electrically couple said hose thereto; and a substantially rigid tubular pole member comprised of an electrically conductive material and having first and second open ends, said pole member being mechanically and electrically coupled at said first end to the second end of said hose member.
US10405710B2
A surface cleaning apparatus comprises a hand vacuum cleaner, a surface cleaning head and an air flow conduit extending from the surface cleaning head air outlet to the hand vacuum cleaner air inlet, the air flow conduit comprising a rigid wand and a flexible suction hose positioned downstream of the rigid wand and upstream of the hand vacuum cleaner air inlet.
US10405708B2
A handheld vacuum cleaner including a handle by which the vacuum cleaner is supported during use, a cyclonic separating unit including a separator having a cyclone chamber which defines a separator axis and an inlet duct having an inlet duct axis which is substantially parallel with the separator axis. The cyclonic separating unit extends at least partly around a portion of the inlet duct.
US10405702B2
Exemplary embodiments provide a prefabricated modular shower enclosure, including a base with a plurality of engagement feature along a peripheral surface of the base, a plurality of alignment supports, and a surround panel. In some embodiments, at least one alignment support is positionable in a preselected relationship relative to the engagement features of the base, and the alignment supports are configured to be independently made square relative to the base. Additional exemplary embodiments provide a prefabricated shower enclosure, including a base with a plurality of engagement feature along a peripheral surface of the base, and a plurality of surround panels that engage the base. The modular shower enclosure reduces installation time and complexity by using components that are fabricated and cut to size offsite prior to installation at a job site.
US10405699B2
The invention pertains to an accessory for adapting cooking grills, especially kettle and kamado style grills for better cooking of pizzas and other foods not typically thought of as appropriate for grilling. The accessory is an insert that is adapted to sit between the bottom and the top of the grill and is generally shaped with a horizontal cross-section substantially similar to the horizontal cross section at the junction of the bottom and the top of the grill with which it is adapted to work. The insert increases the height of the cooking chamber. The insert includes a side opening or window through which food may be inserted and removed from the expanded cooking chamber without the need to open or remove the top of the grill.
US10405698B2
Disclosed herein is a cooking system for cooking food, the system including a housing defining a hollow chamber configured to receive a food container. The housing has an upper portion defining an opening to the hollow chamber. A lid is movably attached to the housing. The lid is moveable about a hinged axis between an open position and a closed position. A foot for supporting the housing is substantially vertically aligned with the hinge axis to stabilize the housing when the housing is oriented at a 15 degree angle and the lid is in the open position.
US10405696B2
A cooking apparatus includes a cavity unit having a cooking chamber therein, and a rear wall plate with an introduction hole section therein; a door unit on the cavity unit, configured to open and close an opening of the cavity unit; a convection heater unit on the rear wall plate, configured to generate heat to be supplied to the cooking chamber through the introduction hole section; and an introduction opening and closing unit configured to open and close the introduction hole section and control an amount of heat to be supplied to the cooking chamber.
US10405694B2
In some embodiments, a cooking vessel cover device may include a body with a perimeter, upper surface, and lower surface. The body may be made from a flexible material so that portions of the body may flex to allow the device to move between the closed position and the open position. The perimeter and/or portions of the body bounded by the perimeter may contact the upper terminus of a cooking vessel when the device is in a closed position so that the perimeter and the body may be in a generally flat planar orientation. An aperture, which may be configured to receive portions of a food preparation apparatus and which may be disposed within the body, may pass through the upper surface and lower surface, thereby allowing the food preparation apparatus to operate with the cooking vessel cover in the closed position and the open position. A positioning fastener may be coupled to the body which is configured to be removably coupled to one or more objects thereby securing the device in an open position.
US10405692B1
A beverage dispensing valve may include a downspout assembly having a body having walls with a slot therein, a channel, an upper and a lower opening, with the slot in the channel between the upper and lower openings. The downspout assembly may include a lateral member extending laterally from the downspout assembly and engaging the wall adjacent the slot. A pinch member may be partly enclosed within the lateral member and dimensioned to move partially through the slot. A handle and the pinch member may move the pinch member in and out of the slot. A coil spring may engage the lateral member and the pinch arm urging the pinch arm at least partially through the slot of the body. A flexible insert may be dimensioned to tightly fit against the walls of the channel of the body, the insert having an open top and an open bottom.
US10405689B2
Beverage production device for preparing a liquid extract by interaction between a liquid and food ingredients to form the liquid extract by effect of centrifugation of the liquid passing through the ingredients comprising: a brewing unit (2) for receiving the food ingredients, a collecting unit (18) for collecting the liquid extract centrifuged outside the centrifugal unit, driving means connected to the centrifugal unit for driving the centrifugal unit in rotation, liquid supply means being connected to the centrifugal unit to supply liquid in the centrifugal unit, wherein the collecting unit (18) comprises a heater (10) for heating the liquid supplied in the centrifugal unit, said heater (10) being further arranged to heat the liquid extract after it leaves the brewing unit (2).
US10405680B2
A lid for a drinking cup enables drinking while inhibiting splashing and spilling. The lid features a drinking spout having an outer wall, an inner wall and a top wall. A dispensing well formed in the spout includes a bottom wall, two end walls, and at least two opposed sidewall openings. Nearly all vertical beverage splashes impinge upon the underside of the bottom wall, while the opposed openings allow splashes entering the dispensing well to be drained through the opposite opening. A plurality of vent holes can be provided to allow air to enter the cup as beverage is consumed. Vent holes near the dispensing well can be blocked during drinking, when the cup is full and the beverage is hot, but unblocked as the beverage cools and is consumed. Interior baffle walls around the dispensing well can inhibit swirling or laterally-splashing beverage from entering the dispensing well.
US10405678B1
Apparatus and method illuminate items of merchandise displayed at a point-of-purchase, wherein the items are suspended from a peg having a distal end placed at a support structure, the peg projecting in a longitudinal direction from the support structure to a proximal end placed adjacent the point-of-purchase. An adjacent bar extends from the support structure to a terminal end adjacent the proximal end of the peg and carries a plate secured to the terminal end, with the terminal end of the bar and the plate spaced from the proximal end of the peg. An elongate beam is provided with a track extending in lateral directions along a rearward surface of the beam. The track is located for confronting the terminal end of the bar, and the plate is captured within the track at a selected lateral location along the beam, thereby locating the beam adjacent the terminal end of the bar, proximate the proximal end of the peg, and a light source is extended laterally along the beam, arranged to project illumination toward the items of merchandise displayed at the point-of-purchase.
US10405672B2
Disclosed is a neonate medical wrap. In one embodiment, the neonate medical wrap is a wrap-style baby carrier that is particularly useful during the first 28 days after the baby's birth. Generally, the disclosed neonate medical wrap comprises a torso wrap and a shoulder strap. In use, the torso wrap and shoulder strap may be outfitted around the torso of a parent and, via a side opening, a baby may be installed against the parent's skin under the torso wrap. The shoulder strap may be provided over the shoulder of the parent to assist in supporting the baby's weight while standing.
US10405663B2
An air support article of air inflatable furniture comprises an air inflation device. The air inflation device provides an openable and closable opening into the sack that forms the majority of the article. The air inflation device comprises at least one pliable flap attached to the sack. The flap acts as a partial check valve that allows the article to be inflated simply by rapidly opening and closing the opening.
US10405662B2
A folding chair assembly having a seat framework and a backrest framework arranged in an X-frame arrangement. The backrest framework is joined to the seat framework at pivot joints. The seat framework and the backrest framework can move about the pivot joints between an open configuration and a folded configuration. Frame extensions are provided that are joined to the backrest frame with hinge joints. The hinge joints enable the frame extensions to be folded about the hinge joints between a first position, where said frame extensions abut against the backrest framework, and a second position, where the frame extensions extend away from the backrest framework and increase its effective length.
US10405655B2
A furniture assembly is disclosed that includes an article of furniture, two or more implements and an implement interlock system. The article of furniture includes at least one panel defining an implement-receiving cavity. The two or more implements are slidably-disposed within the implement-receiving cavity of the article of furniture. The implement interlock system includes: two or more cable guides attached to the at least one panel; a cable engagement device attached to each implement of the two or more implements; and a cable tensioning device, including a cable, attached to the at least one panel. A portion of a length of the cable extends through the two or more cable guides and is selectively-hooked by the cable engagement device attached to each implement of the two or more implements. An implement interlock system and a cable guide also are disclosed.
US10405648B2
A piece of furniture, such as a lectern, has a shell with an opening. A rack for electronic equipment is mounted within the shell. The rack can be slid between a stowed position in which the rack is entirely within the furniture and an access position in which the rack extends through the opening and is partially outside the shell.
US10405645B1
A tabletop having a first half and a second half that rotate about a central axis between an extended position and a storage position. The table includes a hinge disposed between first and second beams attached to the underside of the tabletop adjacent to the central axis. A first support rod is rotatably attached to the underside of the tabletop and has a proximal end attached to a first leg and a distal end having at least two first fingers projecting therefrom. A second support rod is rotatably attached to the underside of the tabletop and has a proximal end attached to a second leg and a distal end having one or more second fingers projecting therefrom. Upon rotation of the first and second legs between extended and collapsed positions, the at least two first fingers engage and disengage with the one or more second fingers.
US10405642B2
The invention relates to a toothbrush that is produced by AFT and has a head part and at least one carrier element connected thereto. A front surface of the head part is formed by the top surfaces of the at least one carrier element and has a non-planar three-dimensional configuration, or is capable of assuming such a configuration during intended use. The invention also relates to a process for producing such a toothbrush.
US10405640B2
Embodiments relate to visibility-enhancing objects and systems. These embodiments include visibility-enhancing portions can include a reflective portion and/or a light source. In some embodiments, a connecter is adapted to removably attach a visibility-enhancing portion to a container. Such containers can include at least one strap, and the visibility-enhancing portion can be arranged between the container and one a strap, to extend at least partially beyond a perimeter of the container to increase visibility of the wearer.
US10405639B2
A cosmetic organizer comprising in combination a solid base and a cosmetic package having affixed thereto a fastener. The solid base has a surface cover affixed to it. A top surface of the surface cover is one-half of a hook and loop fastener or one-half of a mechanical micro-fastening system employing a plurality of mating nanoscale fastening elements. There is at least one cosmetic package having affixed thereto a fastener wherein a top surface of the fastener is a fabric complement of a hook and loop fastener or a mechanical micro-fastening system employing a plurality of mating nanoscale fastening elements. A bottom surface of the fastener has an adhesive for attaching the fastener to a cosmetic package.
US10405637B2
An applicator device or dispenser includes a stone applicator tip and a housing which may, in some examples, have a reservoir for containing a product, such as a cosmetics product or a medicinal product. The stone tip comprises a material that is capable of storing and retaining and/or transferring thermal energy during application of the product.
US10405633B2
A cosmetic repurposing system and associated apparatuses to enable the extraction and reuse of cosmetic materials that otherwise would be wasted. The compact and portable nature of the cosmetic repurposing system allows for ease of use. Further, the standardization of sizes enable the specific application of the system for use within a variety of compacts, makeup kits and in association with a variety of other cosmetic containment vessels.
US10405627B2
A luggage having a luggage body with a fold out table is provided. The luggage body includes a top, a bottom, a front side, a rear side, a first side and a second side. The body further includes a slot formed along the rear side with an opening formed at the top leading into the slot. At least one wheel, such as a plurality of wheels are secured to the bottom of the body. A platform is slidably engaged with the slot. The platform includes a stowed position, a handle position, and a table position. The stowed position includes the platform substantially disposed within the slot, the handle position includes the platform extending from the slot and disposed vertically, and the table position includes the platform extending from the slot and disposed horizontally.
US10405623B2
A protective enclosure for an electronic device includes a structural member and a cushioning member permanently attached to the structural member. The structural member has a back portion with an inner surface and an outer surface. The structural member includes a cavity configured to extend between the inner surface of the back portion and the installed electronic device. The cushioning member has a top section configured to be in direct contact with and cover at least a portion of a front surface of the installed electronic device, a bottom section configured to be in direct contact with and cover at least a portion of the back surface of the installed electronic device, and one or more side sections each configured to cover a respective side of the plurality of side surfaces of the installed electronic device. The bottom section of the cushioning member at least partially bounds the first cavity of the structural member.
US10405620B1
A walking aid is provided for assisting a user during walking on a surface. The walking aid includes a handle configured to be grasped by a hand of the user; a surface contacting portion configured to contact the surface on which the user walks; a shaft having a first end and a second end, the shaft being positioned between the handle at the first end and the surface contacting portion at the second end; and a multi-chamber storage compartment located in the handle, the multi-chamber storage compartment having a plurality of individual chambers that are separated from one another.
US10405619B2
The invention relates to a method for mounting at least one decorative element (3) on a support (2) comprising the steps of: a. taking a support (2) provided with at least one cavity (4); b. taking at least one decorative element (3); c. filling said cavity with a composite filler material comprising at least one metal powder and at least one organic binder and having, at the moment of filling, a viscosity comprised between 1,000 mPa·s and 1,000,000 mPa·s; d. heating the composite filler material to a higher temperature than its melting point to make it liquid; e. allowing the filler material to cool to form a substrate (6); f. making at least one housing (8) in said substrate (6); g. mounting said decorative element (3) in said housing (8). The present invention also concerns a decorative support (2) provided with at least one cavity (4) filled with said filler material forming a substrate (6) in which at least one housing (8) is formed, said housing (8) being arranged to receive said decorative element (3).
US10405613B2
A seatbelt tongue includes a tongue plate, a latch plate, a guide pin and a first retention bump. The tongue plate includes a belt slot. The latch plate is slidably connected with the tongue plate and is translatable between a first position and a second position. The guide pin is fixed to one of the tongue plate and the latch plate. The guide pin slidably passes through a pin slot in the other of the tongue plate and the latch plate. The first retention bump in the pin slot defines a pin pocket receiving the pin in the first position.
US10405608B2
An article of footwear includes an upper and a tensioning mechanism operable to move the upper between a tightened state and a loosened state and including a tensioning cable having a first end disposed on one of a lateral side and a medial side of the upper. The tensioning cable is movable in a tightening direction to move the tightening mechanism into a tightened state and movable in a loosening direction to move the tightening mechanism into a loosened state. The article of footwear also includes a locking device disposed on the one of the lateral side and the medial side of the upper. The locking device is operable between a locked state restricting movement of the tensioning cable in the loosening direction and an unlocked state permitting movement of the tensioning cable in both the loosening direction and the tightening direction.
US10405604B2
The disclosure relates to articles of footwear (100) and components thereof, including outsoles (112), which can be used in conditions normally conducive to the accumulation of soil on the outsoles (112). In particular, the disclosure relates to articles of footwear (100) and components thereof including an outsole (112) with a material (116) including a polymeric network formed of a plurality of polymer chains, where the material (116) defines external ground-facing surface or side of the outsole (112). The outsoles (112) can prevent or reduce the accumulation of soil on the footwear (100) during wear on unpaved surfaces such as sporting fields.
US10405603B2
In general, certain embodiments of the present disclosure provide an augmented heel cup protective insert device for shoes. The insert device includes a posterior segment corresponding to the curvature of a heel of a shoe. The device also includes a medial wing, a medial parabolic formation that extends in a direction from top to bottom of the device, an inferior segment, and an angulated segment to meet the beginning of the edge of the heel on the medial side of the shoe.
US10405598B2
A forehead support band work or sports protective helmets, having a structure which is elongated and flexible so as to assume an arched configuration in the mounted condition on a helmet is provided. The structure has a first portion intended to permanently face, from the inside, towards the front part of a helmet on which the forehead support band is mounted and a second portion adapted to engage a user's forehead when the helmet is being used. The portions of the structure are removably engaged and disengageable to allow the separation of the same or the temporary removal of the second portion or the replacement of the second portion with another second portion identical to the removed one or different from the removed one.
US10405587B2
A nursing garment includes an interior front layer, an intermediate front layer, and an exterior front layer. The interior front layer includes soft cups for supporting breasts of the wearer and each defining an opening through the interior front layer providing access to a different one of the breasts of the wearer. The intermediate front layer includes two padded cups, is positioned immediately adjacent the interior front layer, and defines an intermediate front layer neckline edge and intermediate front layer underarm edges. The two padded cups overlie the soft cups such that each of the two padded cups covers a different one of the openings of the interior front layer. The exterior front layer extends over the intermediate front layer substantially covering the intermediate front layer and defines exterior front layer underarm edges each sewn to a different one of the intermediate front layer underarm edges.
US10405586B2
A collar shaping device having a U-shaped body adapted to be positioned under the collar of a shirt. The U-shaped body defines a central portion and first and second legs extending therefrom and undulates in a vertical direction. The central portion defines an upper rear contact region that engages the underside of the collar at the midpoint of the central portion. The first and second legs each have a proximate region connected with the central portion and a freely extending distal region. The proximate regions of the first and second legs defines a lower contact region that engages the upper shoulder area of shirt body while the distal regions of the first and second legs defines an upper forward contact region that engages the underside of the collar proximate the forward ends of the collar. Shirt assemblies and methods employing such devices are also disclosed.
US10405584B2
The present disclosure discloses an atomizing device for an electronic cigarette and an electronic cigarette having the same. The atomizing device includes a housing and an electromagnetic induction heating device disposed in the housing. The electromagnetic induction heating device includes a plurality of electromagnetic induction coils and an induction heater, the plurality of electromagnetic induction coils being disposed on the periphery of the induction heater, the induction heater is configured to generate a corresponding vortex in a magnetic field which is generated by the plurality of electromagnetic induction coils, and the induction heater is configured to radiate heat from the periphery to heat and bake tobacco materials in the electromagnetic induction heating device. The atomizing device for an electronic cigarette according to the present disclosure has a high heating efficiency and is capable of sufficiently decomposing tobacco materials.
US10405583B2
An electronic smoking article includes a liquid supply including liquid material, a heater operable to heat the liquid material to a temperature sufficient to vaporize the liquid material and form an aerosol, a wick in communication with the liquid material and in communication with the heater such that the wick delivers the liquid material to the heater, at least one air inlet operable to deliver air to a central air passage upstream of the heater, and a mouth end insert having at least two diverging outlets.
US10405580B2
A flavor assembly for an e-vaping device cartridge is configured to provide mechanically-adjustable flavorant elution to form a flavored vapor. The flavor assembly may include at least one flavor material holding a flavorant and a exposure control mechanism configured to adjustably expose the at least one flavor material to the vaporizer assembly to adjustably control flavorant elution from the at least one flavor reservoir into the generated vapor. The flavor assembly may be included in a flavor assembly module. The flavor assembly module may include an interface configured to couple with a vaporizer assembly and direct generated vapors formed by the vaporizer assembly to the flavor assembly. The flavor assembly may include multiple flavor materials holding different flavorants. The exposure control mechanism may adjustably expose a selected flavor material. The flavor assembly may be included in an e-vaping device that includes control circuitry configured to control the exposure control mechanism.
US10405578B1
A smoking device particularly suited for smoking vaporizable oils includes a bent portion of glass tubing, a resilient metallic portion including a concentrated oil reservoir, and a swivel element interconnecting the glass tubing and metallic portion.
US10405573B2
A wrapping paper for smoking articles has a basis weight of at least 10 g/m2 and at most 70 g/m2 and comprises a mixture of cellulosic pulp fibers comprising at least 90% of short-fiber cellulosic pulp fibers, based on the mass of the cellulosic pulp fibers in the cellulosic pulp mixture, or comprising at least 95% of short-fiber cellulosic pulp fibers, based on the number of cellulosic pulp fibers, with at least 10% of the short-fiber cellulosic pulp fibers being ground, based on the mass of the number of cellulosic pulp fibers of the cellulosic pulp fiber mixture, and with the wrapping paper having over more than 50% of its area, preferably at least 55% of its area and especially preferably at least 60% of its area, an air permeability of at least 30 cm3/(cm2,min-kPa), and where the wrapping paper comprises at least one burning salt.
US10405569B2
The present invention relates to a Lactobacillus plantarum HAC01 strain having anti-inflammatory efficacy and metabolic disease improving efficacy, a probiotic preparation, an anti-inflammatory composition, and a health food composition for improving a metabolic disease, which comprises, as an active ingredient, at least one selected from the group consisting of the strain, a culture product of the strain, a concentrate of the culture product, and a dried material of the culture product.
US10405567B2
A food additive for improving sensory characteristics and providing nutritional value to cereals or cereal mixture with irregular surface, which consists of collagen peptides of terrestrial and marine animal origin, the composition of which is, in % by weight, from 14% to 18% essential amino acids, from 10% to 14% aspartic acid and from 18% to 22% glycine, from 23% to 27% proline and hydroxyproline, from 9% to 13% glutamic acid, from 6% to 10% arginine, and from 6% to 10% alamine, dissolved in 5% to 50% aqueous solution, which is used as a carrier for adding ingredients, to form a uniform glossy coating on the surface of cereals or cereal mixture.
US10405566B2
A container (22) includes an oxygen-sensitive beverage, for example a vitamin C-containing beverage. A closure (40) seals the mouth (28) of container (22). The closure includes an oxygen scavenging structure, for example a closure, which comprises a hydrogen generating means and a catalyst for catalysing a reaction between hydrogen and oxygen.
US10405562B2
A machine for making liquid or semi-liquid food products includes a plurality of supply containers containing a basic mixture and deformable wall, so the space occupied by each first container depends on a quantity of basic mixture therein. A processing container includes a stirrer and thermal treatment system, operating with one another to convert the basic mixture into a liquid or semi-liquid product. A connecting system connects the supply containers to the processing container to transfer the basic mixture from one of the supply containers to the processing container and includes a plurality of pneumatically operated closing valves, where each of the valves is associated with one of the supply containers and can be activated and deactivated independently of the remaining valves to allow the placement of one of the containers in connection with the processing container.
US10405561B2
An edible jelly product, being a body formed from a mass of jelly-forming material by a progressive advancement of said mass to a forming station and progressive formation of the body at the forming station, wherein said mass comprises a sugar and a structure-forming agent selected from a hydrocolloid and modified starch, wherein the solids content of the jelly product, when formed into the body, is at least 60 wt %. A method is described of making such an edible jelly product which is transparent and contains air bubbles which are visible by eye; and which may be brought together with other such jelly products to form consolidated bodies such as twists, which can be easily peeled apart by consumers.
US10405554B2
Compositions comprising microbiological strains and cultures and methods of use thereof are provided herein. Certain strains, cultures, and compositions thereof are useful for the control of head blight disease, for example, of various crop plants. Biological control compositions, and methods of use thereof to prevent, inhibit or treat the development of plant pathogens or disease and for preserving plant yield, are also provided.
US10405546B2
The present invention provides an aqueous suspoemulsion comprising (a) an oil phase comprising (i) at least one triazole active compound as emulsified component, solid at room temperature, (ii) at least one alkyl carboxylic acid amide as a solvent and a crystal growth inhibitor, and (iii) a polymeric stabilizer, and (b) a continuous water phase comprising (i) at least one strobilurin active compound as suspended solid component, solid at room temperature, (ii) at least one dispersant selected from the group consisting of methacrylic acid-methyl methacrylate-polyethyleneglycol graft copolymer, tristyrylphenolethoxylates and/or propylene oxide/ethylene oxide block copolymer with 10% to 50% EO, preferably with 20% to 50% EO and most preferably with 30% to 40% EO, (iii) water, and (iiii) additives, if appropriate. a process for preparing the suspoemulsion and its use for applying the active compounds comprised therein to plants and/or their habitat are also provided.
US10405544B2
An aqueous disinfectant formulation comprising at least one phenolic compound of natural origin; a surfactant sufficient to form a solution or dispersion of the essential oil in an aqueous carrier; a solvent, and sufficient water to make 100 weight percent is described herein.
US10405543B2
The present invention provides microcapsules with good barrier properties and the ability to release encapsulated hydrophobic liquids at low and high pH.
US10405542B2
In an example, a polymeric material includes a fibrous substrate, a cyclic compound chemically bonded to the fibrous substrate, and a microcapsule. The microcapsule has an encapsulated payload and is reversibly bonded to the fibrous substrate via the cyclic compound.
US10405540B2
A composite filament includes a core particle comprising a styrene/acrylate polymer resin, and a shell comprising a styrene/acrylate ionomer resin, wherein the styrene/acrylate ionomer resin comprises a metal ion acrylate monomer, and methods of making thereof. Various articles can be manufactured from such composite filaments.
US10405539B2
In one aspect, the present invention relates to a composition for delivery of double stranded RNA to an insect having a basic pH within its alimentary canal, wherein the composition comprises double stranded RNA adsorbed onto a clay complex, and wherein the clay complex is configured to release the double stranded RNA at the basic pH. Other aspects of the invention relate to preparations including the composition of the invention, methods of delivering double stranded RNA to an insect and methods of protecting a crop against an insect.
US10405535B2
The various embodiments disclosed herein relate to identification of one or more specific objects among several other objects. Certain exemplary implementations relate to systems, methods, and devices for identification of one or more specific plant species among several different plants, especially real-time identification of weed plant species in a real-world environment such as a crop field. Other embodiments relate to identification systems, methods, or devices in combination with action components, such as a spraying system for spraying the weed plants identified in real time.
US10405524B2
An animal feeder includes a feed bin that is at least partially defined by a base, an interior panel extending upward from the base, and an exterior panel extending upward from the base. An intermediate structure is located between the interior panel and the exterior panel. The feed bin contains an opening that is covered by the intermediate structure when a predetermined weight is placed on the intermediate structure.
US10405523B1
An apparatus for holding a bag open at the end of a telescoping handle. The apparatus includes an elastomerically coated, illuminated ring for releasably holding a bag while collecting dog waste before it reaches the ground. Additional features include a clip or clamp to hold a full bag of dog waste to carry it away for proper disposal.
US10405517B2
A lamp assembly selectively engageable with a frame member of a cattle chute without using tools. The frame member is received into a channel of a mounting assembly of the lamp assembly. A locking mechanism is pivoted to lock the mounting assembly around the frame member. The orientation of the lamp is adjusted by pivoting a support assembly connected to the lamp into a desired position relative to the mounting assembly and engaging locking pins to retain the support assembly in the selected orientation. The lamp includes a plurality of LEDs that are actuated to shine light into the cattle chute. The lamp assembly is removed from the chute frame member by pivoting the locking mechanism back to an unlocked position and then moving the mounting assembly in a direction that causes the frame member to exit the channel.
US10405503B2
A trellis component includes a tubular portion, a connector adapted to be inserted within an upper end of the tubular portion, at least two support arms, and a crop line, which are arranged such that the connector is within the upper end of the tubular portion, the arms are within and extend outwardly from the connector, and the crop line is supported by the arms in an elevated disposition to in turn support a crop.
US10405502B2
A water and soil conservation and ecological restoration method of high and steep, abandoned slag piles at high elevation with large temperature differential in xerothermic drought valleys, comprises: preparing a mixed material; collecting and cutting a plant to obtain a plant ingredient; preparing a treated material; digging tree holes; planting; spreading the treated material, and watering. The water and soil conservation method adds gelling material for cover soil, and stirs to allow fine particles in the cover soil to be uniformly coated on the coarse particles to realize coherence, thus effectively avoiding water erosion and wind erosion on the loose cover soil on a slope and slag pile, reducing the cover soil falling into gaps of large slag pieces on the slope surface, thus controlling the water and cover soil conservation of a slag pile, and the scale of fill earth, and ensuring the survival rate and preservation rate of planted trees.
US10405491B2
A wear strip arrangement for an endless belt conveyor for a feederhouse of an agricultural combine includes a first body that is configured to be attached to a slat that in turn is attached to the endless belt.
US10405488B2
A method may include receiving map data descriptive of a plurality of zones located within a parcel of land and receiving information indicative of a plurality of reference coordinates or objects including at least a first and second reference coordinate or object located on the parcel, in which the first and second reference coordinate or object each has corresponding information for defining boundaries for a first workable zone and a second workable zone on the parcel associated therewith, respectively. The method may further include determining the boundaries of the first and second workable zones responsive to detection of at least the first and second reference coordinate or object, respectively. The method may also include receiving time-scheduling instructions for the first and second workable zones, and operating the robotic vehicle to remain within the first and second workable zones in response to the time-scheduling instructions.
US10405487B2
A mulching mower unit includes a mower deck, a rotary shaft, a blade, a shroud, and a deflector plate. The shroud has a circumferential wall including a rotational trajectory of the blade, and extends downward from a bottom surface of the mower deck to an area adjacent to the blade. The deflector plate is provided above the blade and radially outward of the rotary shaft in a running direction in an inner space of the shroud. The deflector plate includes a main body having an inner edge facing the rotary shaft and an outer edge spaced apart from the inner edge radially outward of the rotary shaft. The outer edge is positioned closer to the ground than the inner edge.
US10405486B2
A parallel arm furrow opener assembly defines upper and lower front pivot axes and upper and lower rear pivot axes oriented horizontally and perpendicular to a travel direction. A furrow opener and a packer wheel are attached to a rear link of the assembly. In operation the furrow opener and the packer wheel are in fixed positions with respect to the rear link member, and a bias element is operative to exert a downward bias force on the furrow opener assembly. A front pivot line connecting the upper and lower front pivot axes is parallel to a rear pivot line connecting the upper and lower rear pivot axes, and the front and rear pivot lines are oriented at a pivot angle with respect to a vertical orientation, and the pivot angle is adjustable to vary a furrow depth of the furrow.
US10405485B2
A meter roller for an agricultural metering system includes a flute and a recess positioned adjacent to one another along a circumferential axis of the meter roller. The flute and the recess are configured to meter flowable particulate material from a storage tank to a material distribution system via rotation of the meter roller. In addition, a first circumferential extent of the flute is at least 1.5 times greater than a second circumferential extent of the recess along an entire longitudinal extent of the flute and the recess, and the entire longitudinal extent of the flute and the recess is greater than the first circumferential extent of the flute and the second circumferential extent of the recess.
US10405474B2
An agricultural harvesting head for mounting on a feederhouse of an agricultural combine has an adapter frame coupled to and supported on a center frame section with four links. Each link extends between and is pivotally coupled to the center frame section at a forward end of the link and is pivotally coupled to the adapter frame at a rear end of the link.
US10412865B2
A vehicle electric apparatus installed in an extra-cabin space in a vehicle includes an electric circuit unit and a metal housing. The electric circuit unit includes a switching unit configured to switch a direct-current voltage. The metal housing houses the electric circuit unit. The metal housing includes multiple housing parts, and adjacent housing parts out of the multiple housing parts are secured to one another at multiple securing positions with respective bar-shaped securing members. An axial direction of at least one bar-shaped securing member out of the bar-shaped securing members used for at least one securing position out of the multiple securing positions is set so as to orient toward an outside of a cabin an emission direction of an electromagnetic wave from the electric circuit unit through the at least one bar-shaped securing member.
US10412863B2
A charging device for inductively charging an electrical energy store of a motor vehicle, having a primary coil, which is designed for inducing a voltage in a secondary coil of the motor vehicle for charging the electrical energy store; and having a lifting mechanism, which is designed for moving the primary coil between a stowage position and a charging position. The charging device has a fan unit, which is arranged in such a way that an air flow that can be produced by the fan unit flow around a power electronics of the charging device, and subsequently flows to the lifting mechanism.
US10412854B1
A server rack seismic restraint includes a rear restraint assembly configured to attach to a support surface that is operable to support a data center server rack. The rear restraint assembly includes at least one lateral member positioned to receive the server rack and restrain the server rack against lateral movement based on a force applied to the server rack; and an angled bracket positioned to receive the server rack and restrain the server rack against vertical movement based on the force applied to the server rack. The server rack seismic restraint also includes a front restraint assembly configured to attach to the support surface and engage the server rack to restrain the server rack against vertical movement based on the force applied to the server rack.
US10412853B2
A storage system includes a computer storage compartment, a first shelf, and a first power configuration unit. The first power configuration unit has a first base and a first bridge, the first bridge extending from the first base and spanning above the first shelf. A first plurality of dividers are connected to the first bridge and extend downward toward the first shelf, the first plurality of dividers forming first individual storage bays within the computer storage compartment and the first plurality of dividers do not contact the first shelf. The power configuration units are modular to enable the storage system to selectively contain power configuration units designed to provide AC power, DC power, or a mix of both AC and DC power within the storage system depending on the power requirements of the portable computing devices to be stored therein.
US10412845B2
A head mounted display including a main strap, a display part, an adjusting mechanism, a forehead pad, a plurality of holders and a lace is provided. The main strap surrounds a user's head. The display part is connected to the main strap and corresponds to the user's eyes. The adjusting mechanism is disposed on the main strap. The forehead pad corresponds to the user's frontal bone. The holders are disposed on the main strap and the forehead pad. A path of the lace in sequence passes through a retractable portion, a portion of the main strap near a first side of the display part, a first side of the forehead pad, a fixed portion of the lace, a second side of the forehead pad and a portion of the main strap near a second side of the display part. The adjusting mechanism connects the retractable portion and is adapted to adjust a magnitude of tension of the lace at the retractable portion. The lace is fixed at the main strap and the forehead pad by the holders.
US10412830B2
According to an aspect of the present inventive concept there is provided a system comprising: a conductive textile including conductive fibers, an electronic circuit unit arranged on a first main surface of the conductive textile and including circuitry and a carrier supporting the circuitry, the carrier having a first main surface and a second main surface facing the first main surface of the textile and including a through-hole extending from the first main surface to the second main surface, a conductive pin including an leg segment arranged at least partly in the through-hole, and a grip segment arranged to grip about at least one fiber of the conductive textile. There is also provided a method for mounting an electronic circuit unit on a conductive textile.
US10412826B2
The present application discloses a circuit board and a method for manufacturing the same, and a terminal test device. The circuit board includes a base substrate, and a plurality of conductive lines on the base substrate, each of the plurality of conductive lines having one end configured to be connected with a signal output bus of a signal generator and the other end configured to be connected with a terminal. A fuse is connected in series in each conductive line, and a breaking current IT of the fuse, a maximum operating current I of the conductive line and a fault current IF of the conductive line satisfy: I
