US11054496B2
A network connection method includes determining whether an electronic device is moving and obtaining position information of the electronic device from the positioning unit in response to determining that the electronic device is moving. The method also determines whether the electronic device is located within a preset range based on the position information, and accordingly generates a movement path in response to determining that a distance between the electronic device and the wireless device is within a preset value. The method further determines whether the movement path of the electronic device matches with a part of at least one stored path; and switches a state of at least one wireless communication unit in response to determining that the movement path of the electronic device matches with a part of the at least one stored path. A related electronic device and a non-transitory storage medium are also provided.
US11054493B2
In a method for generating an MR image of an object, k-space of the MR image is separated into blades. In each blade, parallel k-space lines are provided which are separated in a phase encoding direction (PED). Each blade has a different rotation angle around a common center relative to the remaining blades. A spatial extent of the object is determined. For the blades, the extent of the object in the corresponding PED is determined. A blade specific extent of a field of view (FOV) in the PED is determined for each of the blades based on the corresponding extent of the object in the PED. The extent of the FOV in the PED differs for at least one of the blades from the extent of the remaining blades, and sampling the k-space with the blades with the determined blade specific FOV as determined for each of the blades.
US11054487B2
The multiple redundancy position sensor device intended for detecting the position of a shifter lever in a shifter device, comprises a first magnetic sensor and a second magnetic sensor facing the first magnetic sensor, one of the sensors being a dual die magnetic sensor. A polarized magnet is arranged between the sensors such that the polarized magnet can be rotated with at least one degree of freedom. A signal based on the angular position of the polarized magnet relative to the first magnetic sensor and the second magnetic sensor corresponding to a shifter lever position is output to control a vehicle transmission.
US11054485B2
A power supply monitoring apparatus includes dual supply path controllers. The controllers continuously test the power supply and the supply paths by alternating power states and monitoring the response from the supply path. If an interruption in normal operation is sensed in one supply path, information regarding the abnormality can be sent to the other controller, thereby allowing for continued operation and monitoring despite the failure of a supply path.
US11054480B2
An electrical load assembly is provided for use by an electronic battery tester used to perform an electronic battery test on a storage battery. The electrical assembly comprises a load wire providing an electrical load resistance and a housing which at least partially encloses the load wire. An airflow passageway is provided in the housing adjacent the load wire. Electrical terminals connected to the load wire are configured to connect to the electronic battery tester.
US11054479B2
Certain embodiments are described that provide a method and computer readable media for testing battery cells. A unique identifier (e.g., barcode) is affixed to a battery cell which allows it to be tracked across separate tests as a cell, in a module, string, pack, etc. Using a GUI, the unique identifier is recorded in a database along with at least a battery cell manufacturer and a battery cell model. A designation of the particular tester channel or module or string location is entered into the database in association with the unique identifier. Test results of the first test are electronically transferred from the first tester to the database along with the corresponding channel designations.
US11054477B2
An apparatus, a battery system and a method for controlling a main battery and a sub battery. The apparatus includes a first main switch connectable between the main battery and an electrical load, a second main switch connectable between the sub battery and the electrical load, a sub switch connectable between the main battery and the sub battery, a main battery management system and a sub battery management system. The main battery management system transmits a first diagnosis message to the sub battery management system, when a fault of the main battery is detected. The sub battery management system induces the second main switch into a turn on state, in response to the first diagnosis message.
US11054472B2
A test paddle is provided that includes a body portion having a first end and a second end. The test paddle includes a plurality of adapters provided about the second end and a plurality of contacts provided about the first end, each of the plurality of adapters electrically coupled to one of the plurality of contacts. The test paddle includes a removable insulation plate selectively attached to the body portion. A method for testing relays is also provided.
US11054466B2
A semiconductor device test system and a semiconductor device test method are provided. The system includes a device under test (DUT) which provides an output voltage to a load connected to an output terminal, automatic test equipment (ATE) which supplies power to the DUT and measures the output voltage of the DUT, and a current mirror which is connected between the ATE and the DUT. The ATE outputs a reference current to the current mirror, and the DUT provides an output current to the current mirror. The output current is obtained by mirroring the reference current from the ATE.
US11054462B2
A semiconductor device and a method of testing the same are provided. A semiconductor device includes a Design Under Test (DUT), a processing core configured to execute test software to determine an optimum operating voltage of the DUT, and a protection circuit configured to block the transmission of undefined signals generated by the DUT while the processing core executes the test software.
US11054460B2
A soft error inspection method for a semiconductor device includes: irradiating and scanning the semiconductor device with a laser beam or an electron beam; and measuring and storing a time of bit inversion for each of areas irradiated with the laser beam or the electron beam of the semiconductor device.
US11054457B2
In one embodiment, a method generally comprises monitoring real-time electrical data for Power Sourcing Equipment (PSE) transmitting power over a cable to a Powered Device (PD), and identifying changes in the real-time electrical data indicating strain on one or more wires in the cable due to stretching in the one or more wires.
US11054456B2
System and methods for determining loading on supply lines of a three-phase power distribution system. Load meters are connected to the supply lines to receive power. A feeder meter is connected to a supply line designated the reference supply line having a known reference phase. A device generates a timing pulse received by the load meters and the feeder meter. The load meters and feeder meter each determine a respective time delay and feeder meter delay from receiving the timing pulse until a landmark value of the power received. The feeder meter delay corresponds to the reference phase. Each load meter and feeder meter includes a transmission device to transmit the time delay or feeder meter delay. An end server receives the time delays and feeder meter delay and assigns each load meter to a phase by comparing the time delay for a load meter to the feeder meter delay.
US11054452B2
A method for operating an electromagnetic compatibility testing system includes for selected frequencies, adjusting incrementally the lengths of each of the plurality of length-adjustable elements for selected combinations of length ratios between the driven element and other length-adjustable elements, including length ratios where the driven element is longer than the other length-adjustable elements, for each selected frequency storing in a table one of the incremental lengths at one of the selected combinations of length ratios having one of the lowest VSWR and a VSWR lower than a threshold value that has highest signal strength, for each selected frequency adjusting the lengths of each of the length-adjustable elements to the stored lengths, driving RF energy at the selected frequency at a EMC test power level into the EMC antenna generating an e-field in the equipment under test, and measuring behavior of the equipment under test in the presence of the e-field.
US11054451B2
An electrostatic discharge measuring device includes an integrated circuit including a collector, a discharge pad and an ESD detector circuit coupled to the collector and discharge pad. The ESD detector circuit includes a device that detects occurrence and magnitude of an electrostatic discharge between the collector and the discharge pad. In one embodiment, the device is a metal-oxide-semiconductor capacitor. In another embodiment, the device is a thin film storage bitcell. In one embodiment, the electrostatic discharge measuring device is contained in a test microelectronic package. A method includes running the test microelectronic package through a manufacturing process to determine location during manufacturing at which an electrostatic discharge occurs when an externally-similar production microelectronic packages is run through the same manufacturing process.
US11054450B2
A method of calibrating a measurement and analyzing device for measuring a frequency-converting device under test, comprises the steps of connecting a first port of the measurement and analyzing device with a radio frequency port assigned to the frequency-converting device under test as well as connecting a second port of the measurement and analyzing device with an intermediate frequency port assigned to the frequency-converting device under test. Further, a scalar-mixer calibration is performed at the radio frequency port and the intermediate frequency port, thus providing a precise calibration conversion amplitude. A relative calibration is performed between the radio frequency port and the intermediate frequency port by using a calibration mixer. At least one correction coefficient is determined by the difference between the results obtained from the scalar-mixer calibration and the relative calibration. The at least one correction coefficient is used to correct an error term applied.
US11054441B2
A laser beam adjustment unit adjusts a laser beam applied to a cantilever. Assuming that a direction of displacement of a spot of the laser beam on a light receiving surface when the cantilever is displaced during measurement of properties of a sample is defined as a first direction, and a direction orthogonal to the first direction on the light receiving surface is defined as a second direction, the laser beam adjustment unit adjusts the laser beam such that a length of the spot of the laser beam in the second direction during adjustment of a position of a detection unit is longer than a length of the spot of the laser beam in the first direction during measurement of the properties of the sample.
US11054439B2
The present invention relates to a scanning probe microscope having: (a) a scan unit embodied to scan a measuring probe over a sample surface in a step-in scan mode; and (b) a self-oscillation circuit arrangement configured to excite the measuring probe to a natural oscillation during the step-in scan mode.
US11054438B2
An example device for detecting acceleration using a spintronic Hall effect includes a spin Hall effect structure, a Magnetic Tunnel Junction (MTJ) element, a magnetic structure, and processing circuitry. The MTJ element includes a free structure, a pinned structure, and a tunnel barrier arranged between the free structure and the pinned structure. The magnetic structure is spaced apart from the spin Hall effect structure such that a magnetic field generated by the magnetic structure is moved relative to the spin Hall effect structure during acceleration. The processing circuitry is configured to generate electrical current through the spin Hall effect structure, measure a resistance at the MTJ element, and determine acceleration based on the resistance at the MTJ element.
US11054437B2
The present disclosure describes systems and methods associated with providing sideslip guidance for an aircraft. A sideslip offset based on aileron position is used to adjust an initial target sideslip, which is further modified using the actual sideslip of the aircraft.
US11054429B1
A kit, composition and method for detection of antibodies to severe acute respiratory syndrome related coronavirus (SARSr-CoV), and for diagnosis of SARSr-CoV infection.
US11054411B2
A method of controlling a blood analyzer for measuring platelets is provided. The method comprises: determining a relationship between at least one first measurement value obtained by detecting platelets in at least one previous test by an electrical type detector of the blood analyzer and at least one second measurement value obtained by detecting the platelets in the at least one previous test by an optical type detector of the blood analyzer, and controlling the blood analyzer to prepare the first and/or second measurement sample for a current test according to the determined relationship.
US11054410B2
An accessory (800) is provided for a mobile device (102) to measure characteristics of a test strip (808). The accessory (800) includes a test strip adapter (806), a phone adapter (802), and a coupler (804). The test strip adapter (806) includes a test strip attachment for a test strip type and a first interlock shared with other test strip adapters for other test strip types. The phone adapter (802) includes a phone attachment for a mobile device model and a second interlock shared with other phone adapters for other mobile device models. The coupler (804) includes a third interlock that forms a first mating pair with the first interlock of the test strip adapter (806), and a fourth interlock that forms a second mating pair with the second interlock of the phone adapter (802).
US11054408B2
The present subject matter discloses various exemplary projective capacitive micro structured electrode arrays for measuring the impedance and action potential of living cells in particular induced pluripotent stem cells that are subsequently differentiated into cardiomyocytes and neurons. In one exemplary system a projective capacitive electrode array with cardiomyocytes attached onto the electrodes is formed and electrical measurements of live cell responses when exposed to external stimulants, such as small molecule drugs or biologically active compounds is recorded.
US11054405B2
The invention discloses a testing device and method for simulating the flowback in the shut-in period of fractured wells, comprising a fracturing fluid tank, a flowback fracturing fluid tank, a hydraulic fracturing pump, a flowback fluid collection beaker, and a shut-in flowback testing system; the shut-in flowback testing system is composed of a box body and an acoustic wave testing device, a temperature control device, a fracturing string and a square rock block arranged in the box body; a stress loading plate and a hydraulic block are successively arranged between the four surfaces of the square rock block and the inner walls of the box body; the acoustic wave testing device consists of an acoustic wave transmitting probe and an acoustic wave receiving probe; the four outer surfaces of the box body are provided with hydraulic tanks.
US11054404B2
A system including an active ventilation device and a system controller. The active ventilation device is installed in an underground vault and generates an exhaust flow from the vault having an exhaust rate. The system controller is configured to determine that a reading received from a selected gas sensor indicates that a manhole event is occurring, and instruct the active ventilation device to change the exhaust rate when the reading indicates that the manhole event is occurring. The system controller is configured to receive at least one sensor reading after the exhaust rate has been changed, determine whether the selected gas sensor is exhibiting drift based at least in part on the sensor reading(s), and perform an action when the system controller determines the selected gas sensor is not exhibiting drift. The action includes notifying a user and/or instructing the active ventilation device to alter the exhaust rate.
US11054400B2
A method of inspecting a wing box of an aircraft. The wing box includes at least one rib partitioning the wing box in to two bays and at least one stringer attached along an inner surface of the wing box, generally perpendicular to the rib, and extending through an aperture of the rib. The method includes: providing an inspection device on the stringer such that it is movable along the stringer and controlling the inspection device to pass along the stringer, including through the aperture between bays, to perform an inspection of the wing box.
US11054398B2
An ultrasonic inspection method of scanning and inspecting an inspection object with ultrasonic waves includes collecting data obtained by scanning the inspection object with ultrasonic signals by using probes configured to transmit and receive the ultrasonic signals to and from the inspection object via a medium that propagates the ultrasonic signals; and processing and synthesizing the collected data. Synthesizing the data includes depicting an image including a surface of the inspection object in a region including pixels partitioned in a grid-like fashion based on the collected data of the ultrasonic signals, and extracting a pixel having maximum pixel intensity from the pixels arranged along a direction perpendicular to an extending direction of the surface of the inspection object in the depicted image to identify a position of the extracted pixel as a surface shape of the inspection object.
US11054393B2
A non-contact sensor is disclosed wherein magnetic circuits are constituted by an excitation coil, a first detection coil, and a second detection coil, and the first detection coil and the second detection coil are configured so as to be symmetrical with each other in terms of the magnetic circuits. An inspection system includes: a first input unit to which a signal from the first detection coil is input; a second input unit to which a signal from the second detection coil is input; a difference calculating unit that calculates a difference between a first signal from the first input unit and a second signal from the second input unit; a signal processing unit that processes a difference signal calculated by the difference calculating unit; and an oscillation unit that generates an excitation signal for the excitation coil and a reference signal for the signal processing unit.
US11054383B2
An electrochemical sensor device that is efficiently and economically produced at the chip level for a variety of applications is disclosed. In some aspects, the device is made on or using a wafer technology whereby a sensor chamber is created by said wafer and a gas port allows for a working electrode of the sensor to detect certain gases. Large scale production is possible using wafer technology where individual sensors are produced from one or more common wafers. Integrated circuits are made in or on the wafers in an integrated way so that the wafers provide the substrate for the integrated circuitry and interconnects as well as providing the definition of the chambers in which the gas sensors are disposed.
US11054381B2
A first gas sensor includes a main pump cell that pumps oxygen inside a main oxygen concentration adjustment chamber, by applying a main pump voltage between a main interior side electrode and an exterior side electrode, and causing a main pump current to flow, a preliminary pump cell that pumps the oxygen inside a preliminary adjustment chamber by applying a preliminary pump voltage between an interior side preliminary electrode and the exterior side electrode, and causing a preliminary pump current to flow, and a constant control unit that controls the preliminary pump voltage of the preliminary pump cell in a manner so that the main pump current of the main pump cell becomes constant.
US11054374B2
The application concerns a method of authenticating an object, the object comprising an identification substance including at least one amorphous phase, at least one crystalline phase and at least one complex metallic phase. The method includes the steps of: subjecting the identification substance of a candidate object to XRD analysis to determine an XRD signature thereof; comparing the XRD signature of the candidate object to a reference XRD signature, and concluding to the authenticity of the object when its XRD signature substantially matches the reference XRD signature.
US11054372B2
A system for non-destructive testing of an overhead energized electrical component. The system has a base, an X-ray source, an X-ray digital imager, and an imager controller. The system also has a removable electrically conductive flexible shield which is adapted to be operatively coupled to, and to encapsulate, at least the base, the X-ray source, the X-ray digital imager and the imager controller so as to form a shrouded system. In a use position, when the shrouded system is positioned adjacent the energized electrical component so as to non-destructively test the energized electrical component, the shield protects at least the base, the X-ray source, the X-ray digital imager and the imager controller from electric fields around the energized electrical component while allowing signal communication between at least the X-ray source and the energized electrical component.
US11054369B2
A sensor system and a method for optical analysis of bulk material, having a sample space for receiving the bulk material that is to be examined, wherein a measurement section extending in the bulk material is realized in the sample space. In this case, means for changing the length of the measurement section are present. A harvester equipped, a laboratory or mobile system equipped with the system is also provided.
US11054366B2
A device (1) for gas measurement in a measuring environment (7) with a first camera (3) configured to detecting an invisible image area (33) in the measuring environment (7) and with a second camera (5) configured to detecting a visible image area (55) in the measuring environment (7). A control unit (13) initiates a detection of invisible image information (33′) within at least one detection area (11, 33, 55) and a detection of visible image information (55′) in the detection area (11, 33, 55). The control unit (13) determines special image areas (66), which indicate individual persons (9) or a plurality of persons (9). The control unit (13) is configured to determine at least one gas concentration (21′) on the basis of the image information (33′), taking into account the special image areas (66).
US11054365B2
A microscopic analysis apparatus including a concentrating optical system 5 that concentrates measurement light emitted from a sample in a measuring area on a first concentration point, an aperture plate having an opening located at the first concentration point, an elliptical concave mirror 8 that reflects measurement light passing through the opening and concentrates the reflected measurement light on a second concentration point, a shielding plate disposed in front of the second concentration point, a through-hole having an end surface, whose shape coincides with a shape of a cross section of a light flux of measurement light at the position, being formed in the shielding plate, and a photodetector provided at the second concentration point. In this way, it is possible to allow more measurement light to enter the photodetector without allowing light outside the measuring area to enter the photodetector.
US11054353B2
The invention pertains to performing bonding strength testing between a test material and a container. A sample preparation device to make a test sample was disclosed. This device included a container with an insert on each end. The inserts have a portion that protrudes into the container. When test material is added to the sample preparation device, a groove was formed in test sample. These grooves reduce the amount of boundary effects that are present during testing. A system and method for performing bond strength testing was also disclosed. In this system, a test sample was formed using the sample preparation device. This is placed upon a support and a half-spherical force applier is placed on top of the test sample. A press is used to apply force to the force applier and indirectly to the test sample.
US11054349B2
A method for preparation of a dried blood sample for multiplexing of analytes includes the steps of mixing an Internal Standard solution with a first diluent in a vessel, the Internal Standard solution including a plurality of different Internal Standards, adding the dried blood sample to the vessel, sonicating the vessel containing the Internal Standard solution, the first diluent and the dried blood sample, and removing the dried blood sample from the vessel. The Internal Standard solution can include a plurality of Internal Standards. The Internal Standard solution can include at least 15 Internal Standards. The dried blood sample can be generated using less than 50 μL of blood. The dried blood sample can be generated using less than 10 μL of blood. The first diluent can include methanol or a mixture of water and methanol.
US11054334B2
A die casting machine melt leakage detecting device includes a pulling wire, multiple wire winding columns, a wire fixing member, an elastic wire connecting member and a trigger switch. The pulling wire is capable of withstanding temperature outside a mold during normal die casting and is melted and broken after making contact with molten metal. The multiple wire winding columns are arranged around the mold, an end of the pulling wire is connected with the wire fixing member, and another end of the pulling wire is sequentially wound around the wire winding columns and is connected with the elastic wire connecting member. The elastic wire connecting member is opposite to the trigger switch, the elastic wire connecting member is in a compressed or stretched state when the pulling wire is kept tensioned in the operating state.
US11054329B2
Aspects of the subject technology relate to electronic devices with pressure sensors. A pressure sensor in a portable electronic device may include an integrated heater or may be co-operated with an external heater for the pressure sensor. The heater may be operated to heat some or all of the pressure sensor for pressure sensor testing, calibration, or temperature-controlled pressure sensing operations.
US11054328B2
Methods and devices to mitigate time varying impairments in sensors are described. The application of such methods and devices to pressure sensors facing time varying parasitic capacitances due to water droplets is detailed. Benefits of auto-zeroing technique as adopted in disclosed devices is also described.
US11054326B2
In a physical quantity sensor, a first substrate has a recess depressed from a second surface to provide a thin film section adjacent to a first surface, and a second substrate has a first surface bonded to the first surface of the first substrate, and has a hollow depressed from the first surface and facing the recess. The recess and the hollow have such sizes that a projected line defined by projecting an end of a bottom surface in the recess to the first surface of the first substrate surrounds an open end of the hollow. When the thin film section is displaced toward the hollow, a maximum tensile stress is generated at a position on a rear surface of the thin film section intersecting an extended line along a normal direction to the first surface of the first substrate and passing through the open end of the hollow.
US11054310B2
A spectral sensing system includes an array of sampling optical elements (e.g. filters) and an array of optical sensors, and a deep learning model used to process output of the optical sensor array. The deep learning model is trained using a training dataset which includes, as training inputs, optical sensor output generated by shining each one of multiple different light waves with known spectra on the sampling optical element array for multiple different times, each time from a known angle of incidence, and as training labels, the known spectra of the multiple light waves. The trained deep learning model can be used to process output of the optical sensor array when light having an unknown spectrum is input on the sampling optical element array from unknown angles, to measure the spectrum of the light. The spectral sensing system can also be used to form a hyperspectral imaging system.
US11054304B2
An imaging device and method are provided. Light from an object is provided as a plurality of sets of light beams to a phase difference array having a plurality of elements. The phase difference array is configured to provide different optical paths for light included within at least some of a plurality of sets of light beams. The light from the phase difference array is received at an imaging element array. The imaging element array includes a plurality of imaging elements. Information obtained from hyperspectral imaging data based on output signals of the imaging element array can be displayed.
US11054299B2
A weighing device (1) has a load-bearing portion (10) that supports an object being weighed, a plurality of transition portions (20), and a separation portion (30). The transition portions are positioned on the separation portion, and the load-bearing portion is positioned on the transition portions, with the transition portions connected to the load-bearing portion and the separation portion. A plurality of weighing sensors (40) are provided at a bottom of the separation portion. A support portion (50) is below the weighing sensors to provide support therefor. The weighing device simplifies the loading condition of weighing sensors and isolates the horizontal mechanical deformation/distortion of the weighing load-bearing mechanism. It also reduces the influence of mechanical deformation/distortion, thereby improving the weighing performance and the effectiveness of the weighing device.
US11054297B2
A fluid sensing switch comprising a flex sensor having a plurality of conductive sensing areas and an energizing conductive area and a synchronous detector that detects a presence and a content of a bilge and produces a signal that is used to activate a pump.
US11054287B2
There is provided a signal processing method, for a photoelectric encoder, capable of correctly determining a bright part and a dark part of a bright/dark pattern having distorted light intensity distribution by setting an appropriate threshold. A detector unit includes a light source, a light-receiving detector that receives transmitted light from a scale to acquire a bright/dark image, and a lens arranged between the light source and the light-receiving detector. The detector unit classifies the bright/dark image acquired by the light-receiving detector into an image-forming region corresponding to a center region of the lens and a non-image-forming region corresponding to a region except for the center region of the lens, calculates a representative value reflecting a light intensity of the image-forming region, and obtains a pre-processed bright/dark image in which the light intensity of the non-image-forming region is replaced with the representative value.
US11054281B1
A meter casing can include a metal shield, and an outer casing that includes a display screen cavity that maintains a display screen, an optical port cavity that houses an optical port sensor assembly including a dongle, and a seal button cavity that houses a seal button and a sealing element. The seal button cavity can include one or more recess cavities formed in the communications module cover. The optical port cavity can include a circular port to securely mount the dongle. In addition, snap joints can be provided, which can hold an optical port cover that covers the optical port with respect to the optical port cavity.
US11054280B2
Displaying weather-based information for a flight path is disclosed. A data processing system receives a flight path and retrieves weather-related raster-based forecast data along the flight path. The data processing system then generates a vertical profile for the flight path for all altitudes along the flight path and all flight times along the flight path. The weather-related raster-based forecast data is then converted by the system into polygonal bands that are superimposed by the data processing system onto the vertical profile, resulting in a modified vertical profile. The modified vertical profile is then displayed by the data processing system with a selector in a graphical user interface (GUI) for selecting a flight time of the flight times along the flight path.
US11054271B2
An approach is provided for aligning one or more drive segments based on a consensus set of user defined inputs. The approach involves, for example, retrieving manual drive alignment data collected from a plurality of human users, wherein the manual drive alignment data indicates one or more regions of at least two drive data segments selected by the human users to align the at least two drive segments. The approach also involves processing the manual drive alignment data to determine a set of common drive alignment locations of the one or more regions. The approach further involves processing a plurality of subsequent drive segments to automatically align the plurality of subsequent drive segments based on the set of common drive alignment locations.
US11054268B2
Systems and methods described receive a request for a transportation plan for a user, wherein the request comprises a starting point and an ending point for a route. Systems and methods then generate a set of potential transportation plans for the route, determine an impact of a subset of plans in the set of potential transportation plans and estimate a likelihood of acceptance of the subset of plans in the set of potential transportation plans based on a personal preference model for the user. Systems and methods also select an influence strategy of the user based on a user model and generate a message recommending a selected plan from the subset of plans for the user, wherein the message is generated based on the selected influence strategy.
US11054267B2
A guidance apparatus, a guidance method, and a guidance program for safely guiding a user to a point deviated from a proper route when the user has deviated from the proper route. A guidance apparatus according to an embodiment includes: a positional information measurement unit configured to sequentially measure a position of the guidance apparatus; a controller configured to determine whether the position measured by the positional information measurement unit is a position on a proper route and generate first guidance information for guiding a user from a guidance start point, which is a point determined not to be a position on the proper route, to a first deviation point, which is one point determined to be a position on the proper route.
US11054265B2
Methods, systems, and apparatus, including computer programs encoded on non-transitory computer storage medium(s), are directed to improving completeness of map information and data related to maps created through sensor data. Map completeness can be improved by determining object completeness and coverage completeness of a generated map and reducing amount of unknown areas of the generated map.
US11054264B2
An advanced map matching algorithm is disclosed, which embeds the road topology inherently in a set of path candidates. Road connectivity is maintained even in special situations such as U-turns, reverse driving, and tunnels. Careful path candidate management is designed to reduce the candidate count while preserving well-matching candidates. Paths are treated and evaluated independently using multiple criteria, which makes the algorithm reliable and robust in different scenarios.
US11054263B2
A route setting device is provided, which may include a display controller, a user interface device, a waypoint detecting module, and a route setting module. The display controller having a display screen may display map data on the display screen. The user interface device may accept a route input operation using the display screen where the map data is displayed. Processing circuitry may detect a waypoint of a ship in the map data based on a trace of the route input operation in the map data. The processing circuitry may set a route of the ship based on the waypoint.
US11054260B2
A vibration type angular velocity sensor includes a substrate having a surface; a plurality of fixation parts, a plurality of weights, two linear drive beams, a plurality of supporting members, a drive part and a detection part. The two linear drive beams are disposed on opposite sides of the weights in one direction so as to be connected to each other through the weights. The supporting members join the fixation parts to the drive beams. The drive part drives the drive beams to vibrate. The detection part generates an electric output according to displacement of the weights caused by an angular velocity applied thereto while the drive beams are being driven to vibrate. The fixation parts are disposed between the two linear drive beams.
US11054248B2
A method of determination of deformation along a first direction of an equipment (1) in contact with hot material and including an inner face (3) in contact with the hot material and an outer face (4) opposite to the inner face (3) is provided. An equipment (1) in contact with hot material provided with means to determine its deformation along a first direction is also provided.
US11054243B2
A circuit for generating a swept source optical coherence tomography (SS-OCT) imaging calibration clock. The circuit comprises a first photodetector configured to convert an SS-OCT optical calibration signal to an SS-OCT electrical calibration signal, a first analog-to-digital converter (ADC) coupled to the first photodetector and configured to convert the SS-OCT electrical calibration signal to a sequence of SS-OCT calibration signal digital values, a processing unit coupled to the first ADC that, when initiated, is configured to demodulate the sequence of SS-OCT calibration signal digital values to obtain a sequence of SS-OCT wave number digital values, where each SS-OCT wave number digital value corresponds to one of the SS-OCT calibration signal digital values, and a level crossing sampler that is configured to track a wave number associated with the SS-OCT optical calibration signal and to generate an SS-OCT calibration clock pulse.
US11054241B2
A three-dimensional measurement device includes: an optical system that splits incident light into two lights and radiates lights to a measurement object and to a reference surface, and recombines the two lights to emit combined light; a first irradiator that emits first light including first polarized light and entering a first surface; a second irradiator that emits second light including second polarized light and entering a second surface; a first imaging system to which the first output light enters wherein the first output light is emitted from the first surface when the first light enters the first surface; a second imaging system to which the second output light enters wherein the second output light is emitted from the second surface when the second light enters the second surface; and an image processor that performs three-dimensional measurement based on interference fringe images obtained by the first and second imaging systems.
US11054240B2
A light interference unit includes a branching optical element, a multiplexing optical element, and at least one fiber device. The branching optical element branches a laser light with an emission wavelength temporally swept, into a measurement light and a reference light. The multiplexing optical element multiplexes the reference light and the measurement light reflected by a measured object, and causes them to interfere. The fiber device includes a reference light device. A transmission light path length is a light path length of the reference light transmitting the reference light device, from the reference light device to the multiplexing optical element. A reflection light path length is a light path length of the reference light reflected by a separation portion of the reference light device, from the reference light device to the multiplexing optical element. The transmission light path length is equal to or more than the reflection light path length.
US11054236B2
A tape winding device includes a fixed plate having a fixed plate side notch, a rotation plate having a rotation plate side notch which the linear member to be inserted into or removed from when a position of the rotation plate side notch is aligned with a position of the fixed plate side notch, a tape support unit and a position regulating member configured to regulate a position of the linear member in the fixed plate side notch and the rotation plate side notch such that the linear member is located at the bottom region of the fixed plate side notch and the rotation plate side notch, the position regulating member having a distal end arm portion, the distal end arm portion running across an opening of the fixed plate side notch and extending over two opposing inner edges of the fixed plate side notch at a regulation position.
US11054232B2
A firearm magazine holder that includes an L-shaped bracket that magnetically attracts holds two adjoining walls of a steel box magazine.
US11054227B2
A high impact strength lighted nock assembly for an arrow that is activated when the arrow is fired with a bowstring. The lighted nock assembly includes a nock molded from a high impact strength, transparent polymeric material containing at least 10% by weight reinforcing fibers. The nock includes a head configured to engage with the bowstring and a shank configured to couple with a rear end of the arrow. The shank includes a recess extending in a distal end of the shank toward the head. A light assembly including a light emitting device is located in the recess in the shank that is electrically coupled to a battery. A switch is electrically coupled to the light emitting device and the battery that is triggered when the arrow is fired to activate the light emitting device.
US11054215B2
A firearm retention mechanism is provided for a holster. The device comprises first and second arms that each have a first end and a second end, outwardly extending retention elements and trigger guard stops, and a fastener which connects the first and second arms so that they define an open top, with the retention elements and trigger guard stops facing one another, the trigger guard stops located below the retention elements. The arms are connected to sides of the holster with the open top facing upwardly to receive a trigger guard of the firearm, which is then pressed between the retention elements.
US11054213B2
A chest support sling for hands free transport with quick release of an elongated firearm or crossbow. In each instance, the sling includes a main strap adapted to being supported upon a shoulder of a wearer. The strap is connected at opposite ends to a pocket which is further adapted to be arranged to a side waist location of the wearer and to receive a butt end of the firearm or crossbow. A secondary support strap extends from the main strap and is adapted for engaging an extended location of the firearm or crossbow to maintain hands-free support when carried by the wearer.
US11054209B2
A two-wheel balancing vehicle includes a chassis including one or more mounting interfaces configured to detachably mount one or more fighting modules for robotic competition. The two-wheel balancing vehicle also includes two wheel assemblies respectively mounted at a left side and a right side of the chassis. Each of the two wheel assemblies includes a wheel and a driving motor drivingly connected with the wheel and mounted to the chassis. The two-wheel balancing vehicle also includes an inertial measurement unit. The two-wheel balancing vehicle further includes a control system communicatively connected with the inertial measurement unit and the driving motor, the control system configured to receive sensing signals provided by the inertial measurement unit and to control a balancing state of the two-wheel balancing vehicle. The inertial measurement unit and the control system are mounted to the chassis.
US11054197B2
A heat exchanger including a manifold body having at least one fluid passage, a cooling passage section having a body including a set of fluid passages extending through at least a portion of the cooling passage section, and a weld joint fluidly sealing the manifold body and the cooling passage such that at least one of the set of fluid passages is fluidly coupled to the at least one fluid passage of the manifold body and methods of forming.
US11054195B2
A heat exchanger includes a tube expansion portion provided on a heat transfer tube such that an outer peripheral surface of the heat transfer tube is pressed against an inner peripheral surface of a first hole provided in a side wall portion of a case, and a first concave surface portion that is provided in a part of an outer surface of the tube expansion portion and forms a first gap, into which brazing material of a first brazed portion advances, between the outer surface of the tube expansion portion and the inner peripheral surface of the first hole. Thus, the attachment strength of the heat transfer tube can be improved by means of a simple configuration.
US11054191B2
A device for heat exchange and positioning in a pipe. The device includes a central body containing a material for storing thermal energy by latent heat accumulation, to be placed in thermal exchange with a circulating surrounding fluid. The device also includes structure for positioning the central body in the volume. The positioning structure is connected to, and extends around, the central body The position structure is also connected to reserving passages that enable contact between the central body and the surrounding fluid and the circulation of the surrounding fluid.
US11054190B2
A heat insulating structure body comprising: a container which includes a first plate-like body, a second plate-like body facing the first plate-like body, a partition plate for dividing a space between the first plate-like body and the second plate-like body, a first cavity part formed by the first plate-like body and the partition plate, and a second cavity part formed by the second plate-like body and the partition plate, wherein a wick structure body and a working fluid are sealed in the second cavity part.
US11054189B2
A polymer-based heat transfer device comprising a polymer-based housing having housing walls defining a working fluid chamber, a porous structure extending in the working fluid chamber from at least one of the two opposed ones of the housing walls, and a plurality of housing wall spacers, such as support posts, extending between the two housing walls to maintain the two housing walls in a spaced-apart configuration with the working fluid chamber extending in between is provided. Also described is a polymer-based heat transfer device comprising a polymer-based housing having housing walls defining a working fluid chamber and a porous structure extending in the working fluid chamber from at least one of the two opposed ones of the housing walls, and heat-conductive metal or ceramic-based foam contacting at least one of the housing walls. A process for manufacturing the polymer-based heat transfer device is provided.
US11054186B2
Provided is a heat exchanger capable of ensuring both heat exchange performance and reliability against corrosion. The heat exchanger includes a plurality of fins each having a flat plate shape, openings provided in each of the plurality of fins, and cylindrical parts arranged on outer peripheries of the openings, each having an inner diameter larger than an outer diameter of each of the openings. The plurality of fins are stacked on one another with the cylindrical parts interposed between the plurality of fins. The openings and the cylindrical parts are configured to form a liquid passage pipe, and the openings protrude further inside than are the cylindrical parts.
US11054183B2
Disclosed herein is a novel medical implement drying apparatus and a method for holding and drying certain medical implements during a reprocessing sequence. This is accomplished by forcing air through the apparatus. The apparatus and method disclosed herein is useful for many medical implements having a hollow casing. The medical implement drying apparatus is particularly well suited for use with a drying cabinet containing one or more of the medical implements during the drying process which will facilitate drying of the exterior of each medical implement, while the disclosed apparatus removes water and water vapor from the interior of each medical implement. Specialized holders, racks, and drying gas pumping systems are also disclosed.
US11054176B2
A magneto-caloric thermal diode assembly includes a magneto-caloric cylinder. A plurality of thermal stages is stacked along an axial direction between a cold side and a hot side. Each of the plurality of thermal stages includes a plurality of magnets and a non-magnetic ring. The plurality of magnets is distributed along a circumferential direction within the non-magnetic ring in each of the plurality of thermal stages. The plurality of magnets and the non-magnetic ring of each of the plurality of thermal stages collectively define a cylindrical slot. The magneto-caloric cylinder is positioned within the cylindrical slot. In each of the plurality of magnets in one of the plurality of thermal stages, a first, second, third and fourth magnet segments are positioned and oriented such that the first, second, third and fourth magnet segments collectively form a closed loop high-field zone across the cylindrical slot.
US11054175B2
Prior art solar energy arrangements are typically structurally complex, have a limited concentration factor and temperature, and their dimensions are large. There is provided a solar energy arrangement and corresponding method for utilizing solar energy by directing sunrays or sunbeams with at least one solar concentrator towards at least one application, device or equipment utilizing solar energy, and a corresponding method, system and computer program product for implementing an arrangement for utilizing solar energy.
US11054174B2
Disclosed is an apparatus for collecting a by-product in a semiconductor process, the apparatus including: a housing; a heater plate; a heater power supply unit; first and second upper horizontal brackets collecting a part of a by-product in a powder form; a by-product collecting tower allowing the exhaust gas to pass vertically and collecting a part of the by-product in a powder form; a lower horizontal bracket guiding the exhaust gas toward a window and collecting a part of the by-product in a powder form; the window blocking the powder form by-product from introducing toward a gas collecting and discharging port and guiding the exhaust gas thereto; and the gas collecting and discharging port. Accordingly, the apparatus can increase capacity of collecting by-products with a simple structure, thereby extending a replacement period of the apparatus and collect a large amount of by-products efficiently over a long period of time.
US11054167B2
A control system is provided for controlling heating and/or cooling with a conditioning load such as fan coils and chilled beams. Based on user input and ambient conditions, the control system determines a desired temperature for the liquid entering the load and combines fresh supply liquid (e.g., from a chiller or boiler) with a portion of the liquid that has passed through the load, to achieve the target load input temperature for the liquid. A recirculation pump may be used to return a portion of the liquid exiting the load for mixing with the fresh supply liquid and a control valve may be used to adjust the ratio of fresh supply liquid and recirculated liquid to achieve the targeted temperature. The control systems can be compatible with a variety of liquid supply systems such as two- and four-pipe systems.
US11054149B2
A heating system for a floor is provided and includes a plurality of heating devices, where each of the heating devices includes a membrane, and a plurality of heating elements and at least one electrical coupling member attached to the membrane. At least one heating device coupling member is attached to the at least one electrical coupling member on adjacent heating devices of the plurality of heating devices, where the at least one heating device coupling member conveys electricity between the adjacent heating devices.
US11054145B2
A downdraft ventilation system includes a vertically movable chimney with two ventilation inlets and a baffle arranged within the chimney between the inlets. The combination of upper and lower ventilation inlets and internal baffle can function to increase the amount of cooking emission captured and exhausted by the downdraft system.
US11054134B2
A combustion/pyrolization system comprising a combustion/pyrolization chamber supported by the base frame, and a perforated grate forms a bottom surface of the combustion/pyrolization chamber and facilitates passage of char and boichar therethrough. The combustion/pyrolization chamber is open along at a top and an air manifold supplies a first source of combustion air across the top of the combustion/pyrolization chamber to form an air curtain. A char collection/transfer chamber is located below the perforated grate for collecting at least the char and boichar that passes therethrough, and a conveying mechanism transfers the char and boichar out of the combustion/pyrolization system for collection and use. An air plenum chamber cools the char collection/transfer chamber such that the supplied secondary air becomes heated, and the heated secondary air flows into the char collection/transfer chamber and through the perforated grate into the combustion/pyrolization chamber to provide secondary combustion air.
US11054133B2
A combustion device includes a first cover, a second cover, an infrared generating mesh, and a gas burner assembly, wherein the first cover has a plurality of through holes. A first half portion of the second cover has at least one hollow portion. A second half portion of the second cover is closed. The infrared generating mesh is disposed between the first cover and the second cover. A flame outlet of the gas burner assembly is located within a projection area of the second half portion. In this way, the intensity of the infrared rays generated by the combustion device could be increased and could be uniform.
US11054125B1
An LED module lighting signage system receives electricity from a power supply as well as data from a data processor source, via electrical power and data supply wiring, at least one power/data distributor, and quick connect, plug-in male and female connectors. The distributor has multiple ports which permit wiring to run from a power supply and data processor source to the distributor and from the distributor to multiple LED modules and fixtures, e.g. different channel letters, LED stringlights, etc. All connections between the power source, data processor source, electrical power/data distributor, and the modules or fixtures are accomplished easily by means of male to female quick connect plug-in connectors. In this manner, the power/data distributor can provide electrical power to LED module lighting signage and also transmit data from a data processor source to the signage in a single cohesive system.
US11054119B2
The invention provides a lamp (5) comprising a lamp body (6) and a mounting unit (8), for fitting through an opening in a substrate. The mounting unit has a front ring (10) for mounting against a front side of the substrate and an arrangement of lugs (12), sliders (20) and brackets (30). The brackets have a collapsed position in which the brackets fit through the opening; and an expanded locked position in which the brackets do not fit through the opening and the brackets are positioned for engaging with a back side of the substrate. The brackets are driven into their positions by a pushing/pulling arrangement rather than by using sprung arrangements. This enables damage to the substrate to be prevented.
US11054108B2
Disclosed is a lighting device (1) for generating a dynamically adjustable spotlight without moving parts. The lighting device comprises a planar array of individually addressable sets of light sources (11), each set comprising at least one light source, each of said light sources being arranged to produce a luminous distribution; a controller (20) arranged to individually address said sets of light sources; and an optical system (100) comprising a plurality of refractive lenses (110, 120, 130) common to the individually addressable light sources and arranged to shape the luminous distribution of each set of light sources into a spotlight (13) and project said spotlight in an angular direction that is a function of a position of said set in the array.
US11054100B2
An illuminance obtained by light passed through light diffusion type skylight windows is affected by the weather. This is to solve such problems by polarization of lighting devices and control technology in addition to improvements in the quality of skylights themselves, and the advantages of the high natural lighting offered by light diffusion type skylight windows are now being utilized. A set value that is the result of associating a required work surface illuminance for indoors with the work surface illuminance obtained by light passed through light diffusion type skylight windows and the generated power of a photovoltaic power generation panels is set as a reference for a light adjustment signal. In situations such as winter sunsets and rainy weather which are in a range equal to or less than the set value, light adjustment of lighting devices is performed by a signal transmitted from the photovoltaic power generation panels.
US11054098B1
A knock-down chandelier is separable into a plurality of partial assemblies and components. Each partial assembly includes a frame part having a channel therein, a light mount coupled to the frame part and configured for holding a lighting element, a connecting arm rotatably coupled to the frame part and having a channel therein, and wiring electrically connected to the light mount and extending from the light mount through the channels of the frame part and the connecting arm. The chandelier also includes a linking structure configured for connecting the frame part of one partial assembly to the frame part of another partial assembly.
US11054097B2
A sealed luminaire includes a light engine that has a housing assembly that defines a light emitting opening and a lightguide that is disposed in the housing assembly. The lightguide is configured to receive light from a light source through an edge thereof and emit the light through a major surface thereof and the light emitting opening. Further, the sealed luminaire includes a sealing assembly. The sealing assembly includes a protective lens that is coupled to the housing assembly of the sealed luminaire such that the protective lens covers the light emitting opening, and a gasket that is coupled to the protective lens. A mounting bracket is configured to mount the sealed luminaire in a mounting structure such that the sealed luminaire is clamped between the mounting bracket and the mounting structure and the gasket creates a seal between the sealed luminaire and the mounting structure.
US11054090B2
A white light emitting device includes a solid-state excitation source operable to generate excitation light having a dominant wavelength ranging from 440 nm to 455 nm; a first photoluminescence material which generates light having a peak emission wavelength ranging from 500 nm to 530 nm; and a second photoluminescence material which generates light having a peak emission wavelength ranging from 640 nm to 690 nm, where the device is operable to generate white light with an IEC TM-30 Gamut Index Rg ranging from 105 to 115. The device can be operable to generate white light having an IEC TM-30 Fidelity Index Rf which ranges from 85 to 95 and a sum of Gamut Index Rg and fidelity index Rf is greater than or equal to 195 and less than or equal to 200.
US11054085B1
Systems, apparatus, devices, apparatus, assemblies and methods for hanging a ceiling fan with a down rod to a ceiling canopy assembly with a floating hanger assembly which eliminates wobble effects, such as up and down motions and side to side motions while the ceiling ran is running. The floating hanger assembly an include a ceiling mounting bracket attached to a ceiling with an upper opening for supporting a floating hanger support to be supported therein. A down rod with an enlarged partial ball shaped upper end can be supported within the floating hanger support, and a lower end of the down rod attached to a ceiling fan.
US11054084B1
One embodiment provides a pre fabricated kit for assembling a supporting framework comprising a plurality of customized beams or supports with a connection openings/hole patterns selected from a set of connection hole patterns and using a plurality of generic connectors which fit on the interior of the customized beams or supports.
US11054083B2
A support assembly that includes a structural member that is delimited by a first end and a second end with a first end cap configured to be at least partially disposed within the first end of the structural member and a second end cap configured to be at least partially disposed within the second end of the structural member to mount the structural member to a structure. The support assembly allows for forces to be applied in all directions without causing rotation or disengagement of the support assembly from a mounting structure.
US11054078B2
A method of manufacturing a dry liner for reinforcing a pipe includes spirally winding a glass fiber-reinforced, continuous material around a mandrel such that a subsequent layer of the glass fiber-reinforced, continuous material at least partially overlaps a preceding layer of the material to form an overlapping region and affixing the subsequent layer of material to the preceding layer of material in the overlapping region prior to impregnating the dry liner with a resin to form a CIPP liner.
US11054071B2
A swivel knuckle assembly for interconnecting a motor and a supply line. The knuckle assembly may include a bearing member to reduce a coefficient of friction. A locking mechanism is disclosed to connect members of the knuckle assembly.
US11054070B1
A part of a gasket that conducts electricity across the otherwise nonconducting gasket. Versions of the insert provide an electrical connection when installed even if the parts sealed by the gasket deflect, and do not deform under compression due to their resilient nature. The gaskets can be used in pipe joints, among other uses, resulting in a pipe joint that conducts electricity between the pipe spigot and the socket of a pipe or fixture even if a deflection event occurs.
US11054032B2
A hole plug includes a cap and a securing frame. The securing frame extends from the cap. The securing frame includes first and second support legs, first and second connectors, and a lock body. The first connector is engaged with the first support leg. The second connector is engaged with the second support leg. The lock body is engaged with the first and second connectors.
US11054028B2
A CVT is provided with a primary pulley (1) and a secondary pulley (2) between which a belt (3) is wound, and hydraulic pressure control valves (5, 6, 7) which control pulley hydraulic pressures. A CVT controller (8) sets a base current indicated value to be output to solenoids (5a, 6a, 7a) of the hydraulic pressure control valves (5, 6, 7), on the basis of a pulley hydraulic pressure indicated value. A dither control unit (58) of the CVT controller (8) superimposes a dither current onto the base current indicated value to be output to the solenoids (5a, 6a, 7a) if, during pulley hydraulic pressure control, the situation is determined, on the basis of belt slip determination information, to be such that belt slipping is highly likely to occur.
US11054025B2
A jamming protection apparatus of a shift lever for a vehicle includes a shift lever rotatably provided in a housing. A contact portion is provided in the shift lever and is provided with an elastically behaving bullet. A detent portion is disposed such that the bullet of the contact portion is brought in contact with the detent portion in the housing. The detent portion is moveably seated in the housing and is provided with a grooved bottom configured such that the bullet moves over the grooved bottom when the shift lever is rotated. A behavior generator is connected to the detent portion and is configured such that the detent portion is moved by an operation of the behavior generator.
US11054023B2
The present disclosure relates to a parking brake system for a motorized vehicle, which uses a differential. Furthermore, the present disclosure relates to a differential for an automotive drive, which can be used by such a parking brake. The differential comprises a transmission housing, a transmission input, two transmission output shafts, and a rotary transmission for distributing performance effective on the transmission output shafts at the transmission input, the rotary transmission comprising at least four transmission elements, of which two transmission elements are configured as a central gear, at least one transmission element as a rotary gear, and a transmission element as a rotary gear carrier, wherein the rotary gear carrier is coupled with the transmission input and one of the central gears each is coupled with one of the transmission output shafts.
US11054020B2
A transmission includes an input shaft coupled to a prime mover, a countershaft, main shaft, and an output shaft, with gears between the countershaft and the main shaft. The shift actuator is mounted on an exterior wall of a housing including the countershaft and the main shaft. A shift control circuit operates a shift actuator using a first opposing pulse command and a first actuating pulse command, and releases pressure with shift actuating and opposing volumes of the shift actuator upon determining a shift completion event.
US11054019B2
An oil container for cooling and/or lubricating bearings of a drive train of a vehicle. The drive train has a driveshaft, a gear mechanism, a differential and a wheel driveshaft. The differential has a final drive gearwheel in engagement with a gearwheel of the gear mechanism and they splash at least partially in an oil sump region. The gearwheels of the gear mechanism and/or the final drive gearwheel form at least two gear stages. The structural complexity of a drive train is reduced or the efficiency of a drive train is increased when the oil container is functionally configured and/or arranged such that the oil container is arranged in the region between the two gear stages and substantially on the side of the driveshaft and/or the wheel driveshaft lying opposite the oil sump region.
US11054006B2
A motor device is provided. The motor device includes a motor, a lead screw, a transmission mechanism and a housing. The transmission mechanism is configured to transmit rotation of the motor to the lead screw. The housing includes a housing outer wall to define a housing cavity and a partition to define a transmission cavity for accommodating the transmission mechanism. The transmission cavity is inside the housing cavity. The housing cavity also accommodates at least a portion of the lead screw. The partition includes a first protruding sidewall and a second protruding sidewall respectively on either side of the transmission cavity, and the transmission cavity is sealed for a lubricant that is used for the transmission mechanism and contained in the transmission cavity.
US11054005B2
A retractable component actuator that comprises a first portion, fixable to a fixed component and comprising a first engagement feature, and a second portion, fixable to a retractable component and comprising a second engagement feature releasably supportable on the first engagement feature. The retractable component actuator further comprises an automated drive mechanism operable to move the first engagement feature upward and downward relative to the fixed component when the first portion is fixed to the fixed component. Downward movement of the second engagement feature relative to the first engagement feature is constrained by the first engagement feature. Upward movement of the second engagement feature relative to the first engagement feature is unconstrained by the first engagement feature. The second engagement feature is upwardly and downwardly co-movable, relative to the fixed component, with the first engagement feature.
US11054002B2
Provided is a planetary geared reducer with a dual reduction ratio. The reducer includes: a housing provided with a ring gear, and having one side where an input shaft is rotatably inserted and an opposite side where an output shaft is rotatably inserted; a sun gear provided at the input shaft; at least one planetary gear engaged between the sun gear and the ring gear; and a high reduction carrier provided at the output shaft to rotatably support the planetary gear by a rotation pin, wherein the high reduction carrier is coupled with a low reduction carrier, the low reduction carrier has a through-hole where the sun gear passes, the through-hole has a low reduction gear engaged with the sun gear, and the sun gear is selectively interlocked with the planetary or low reduction gear according to a forward or rearward movement of the input shaft to perform dual reduction.
US11053989B2
The present invention discloses a locking device, a power assembly, a power transmission system and a vehicle. The locking device includes: a first flange, the first flange being adapted to be fixed on the first shaft; a second flange, the second flange being adapted to be fixed on the second shaft; a synchronizing ring, the synchronizing ring being normally connected to the first flange to be adapted to rotate synchronously with the first flange, and the synchronizing ring being slidable relative to the first flange; and a driving component, the driving component selectively pushing the synchronizing ring to slide from an unlocked position to a locked position in an axial direction of the first flange. When the synchronizing ring is in the locked position, the synchronizing ring is connected to the second flange be adapted to rotate the second flange synchronously with the first flange. When the synchronizing ring is in the unlocked position, the synchronizing ring is separated from the second flange. The locking device according to embodiments of the present invention can realize the single-way locking function, and is simple in structure.
US11053981B2
A method of mounting a bearing to an air compressor including a shaft element having a first end defining a central cylindrical recess and a second is disclosed, which includes the steps of: fixing the second end of the shaft element to a center of a gear; inserting the first end of the shaft element through a central hole of a bearing to have an annular step of the shaft element abutted an inner ring of the bearing; and hitting the first end of the shaft element by a striking tool with a central pin to form an outwardly extending rim on the first end of the shaft element. With the method, the bearing can be firmly fixed between the outwardly extending rim and the annular step of the shaft element.
US11053980B2
A rolling-element bearing unit includes at least one outer ring, at least one inner ring, a plurality of rolling elements disposed between the at least one outer ring and the at least one inner ring that are in contact with the at least one outer ring and the at least one inner ring and at least one auxiliary ring attached to an axial end region of the outer ring. The auxiliary ring may include a seal assembly and may be connected to the at least one outer ring with a snap fit.
US11053972B2
The pivot joint assembly includes a housing with an opening which extends along an axis. A bearing is received in the opening and which has a cylindrical outer surface that is in slidable contact with another surface so that the bearing can slide in an axial direction relative to the housing. The bearing has a curved inner bearing surface. The pivot joint assembly also includes an inner ring with a curved outer surface that is in slidable contact with the curved inner bearing surface of the bearing so that the inner ring can rotate and articulate relative to the housing.
US11053969B2
A deformable insertion fastening arrangement for insertion into a planar ply structure and for retention thereon by subsequent deformation, including a retention component having a passthrough opening passing through it along a passthrough axis and having a fastening configuration for fastening a further component thereonto; the retention component having at least two portions that are radially displaceable relative to the notional passthrough axis that passes centrally through the passthrough opening, the retention component, when considered in its undeformed initial state, is embodied segmentedly in a circumferential direction around the passthrough axis; at least two segments, constituting the radially displaceable portions, being connected to one another by at least one connecting configuration deformable in a circumferential direction; at least one segment being displaceable in a radial direction away from the passthrough axis against a shape inertia force of the at least one connecting configuration, accompanied by enlargement of the passthrough opening.
US11053958B2
A regeneration valve includes a housing defining a first port, a second port, a third port, and a chamber fluidly communicating with the first, second, and third ports. The chamber has a valve element movable between a first position, in which the second port fluidly communicates with the first port, and a second position, in which the second port fluidly communicates with the third port. A resilient member biases the valve element towards the first position. In operation, a flow restrictor element moves between the first port and the second port for restricting fluid flow from the second port to the first port. At a predetermined flow rate between the second port and the first port, if a supply pressure of fluid at the actuation chamber exceeds the bias of the resilient member, the valve element moves to the second position for fluidly communicating the second and third ports.
US11053950B2
A centrifugal compressor impeller (60; 160) has a hub (62; 162) having a gaspath surface (64; 164) extending from a leading end to a trailing end. A plurality of blades (70A, 70B; 170) extend from the hub gaspath surface and each have: a leading edge (72A, 72B; 172); a trailing edge (74A, 74B; 174); a first face (80A, 80B; 180); a second face (82A, 82B; 182); and a tip (78A, 78B; 178). A plurality of flow splitter segments (120, 122; 320, 322) extend between associated twos of the blades and each spaced from both the hub gaspath surface and the tips of the associated two blades.
US11053949B2
A bleed valve includes a housing with an inlet coupled to an outlet by a duct. A guide tube is fixed within the housing between the inlet and the outlet. A piston with a piston orifice is slideably supported on the guide tube and movable between an open position and a closed position. The duct fluidly couples the inlet to the outlet in the open position, the duct fluidly separates the inlet from the outlet in the closed position, and the piston orifice fluidly couples the inlet with the outlet in the open position and the closed position to move piston between the open position and the closed position according to differential in pressure between the inlet and the outlet of the bleed valve. Compressors, gas turbine engines, and methods of controlling fluid flow are also described.
US11053946B2
A mixed flow fan includes a bottom base, an outer cover disposed on the bottom base, a motor disposed on the base, and a hub located between the outer case and the motor. The hub includes a first outer surface and a second outer surface connected to the first outer surface and inclined relative to the first outer surface. The slope of the first outer surface relative to the central axis is greater than the slope of the second outer surface relative to the central axis. The base includes a side surface adjacent to the second outer surface. The slope of the side surface relative to the central axis is equal to the slope of the second outer surface relative to the central axis.
US11053945B2
A self-regulating fire pump unit which can be controlled to operate under required conditions for sourcing a fire protection system such as sprinklers. The fire pump unit can be operated in accordance with a control curve based on detected pressure and flow. The control curve can include: a) a first setpoint of rated total value of the system load for the pressure and the flow, b) a second setpoint of a minimum partial percentage of the rated total value of the pressure at an over-percentage of the rated total value of the flow, c) a path which maintains the rated total value of the pressure for all values of the flow up to the first setpoint, d) a path between the first setpoint and the second setpoint, e) a path from the second setpoint which limits values of the pressure for values of the flow greater than the second setpoint.
US11053928B2
This assembly comprises a cup containing a thermally-expandable material, a piston designed to move in translation along an axis (X-X) under the action of the thermally-expandable material, a guide (40) for guiding the piston and intended to be fixed to the cup, and a buffer (60) made of an elastomer material and designed to be interposed between the thermally-expandable material and the piston. The guide is provided with a bore (41) that is intended to be centered on the axis and comprises a first bore portion (41.2) having a constant cross-section, a second bore portion (41.1) provided to receive the piston and having a cross-section that is both constant and smaller than that of the first bore portion, and a third bore portion (41.3) that continuously connects the first and second bore portions. According to the invention, the buffer consists of both first and second end portions (62, 61), which, in the assembled state of the thermostatic element, are respectively received in the first and second bore portions regardless of the translational position of the piston, and of a running portion (63), which coaxially connects the first and second end portions and which, before assembly of the buffer to the rest of the thermostatic element, is at least locally thinner relative to the first end portion, so that, in the assembled state of the thermostatic element, the running portion passes from one to the other of the first and second boring portions, via the third boring portion, and partially releases the internal deformation stresses of the buffer when the piston is translated.
US11053922B2
A turbine energy device having one or more rotors and one or more stators in one or more generator sets wherein said rotors and stators are adapted to be rotated in opposite directions, by means of gear stages adapted to produce counter-rotation in these elements and to produce high relative rotation rates between said elements according to the gear ratios involved, thereby obtaining increased power density.
US11053911B2
A serrated panel (70) for a wind turbine blade is disclosed. The panel (70) is configured to be attached to the trailing edge of a blade to form a plurality of serrations (71) at the trailing edge of the blade. The serrated panel comprises a base part (72) for attaching the panel (70) to the trailing edge of the blade. An exterior surface (78) of the base part comprises a corrugated surface in direction between longitudinal ends of the panel such that the exterior surface comprises crests (82) aligned substantially with midpoints of bases (80) of the serrations (71) and valleys (83) aligned substantially between serrations (71).
US11053908B2
A method of verifying a cylinder deactivation mode on an engine is provided. The method can include activating an ignition device in a deactivated cylinder during an exhaust stroke of the deactivated cylinder. The method can include measuring a voltage of the ignition device. The method can include comparing at least one of an amplitude and a timing of a measured spike of the voltage against a baseline voltage spike. The method can include indicating a status of the deactivation mode based on the comparison against the baseline voltage spike.
US11053899B2
A positioning feature includes a first member so that in an embodiment where the pins of a connector are perpendicular to a main axis, an incorrect angular orientation is prevented by the positioning feature that would contact one of the pins and, a correct angular orientation is assured by the engagement of the first member between the pins.
US11053895B2
The present disclosure relates to a pipeline for supplying a gas to an internal combustion engine, with a pipeline cross section forming a passage for the gas and a gas mass measuring device for measuring a gas mass flow. The pipeline is characterized in particular in that it comprises a mixing element made from a wire structure upstream from the gas mass measuring device and in that the mixing element serves for the thorough mixing of the gas in order to homogenize an inhomogeneous flow profile which is present upstream from the mixing element.
US11053888B2
An ultrashort nacelle configuration employs a fan cowl having an exit plane and a serrated trailing edge. A variable pitch fan is housed within the fan cowl. The variable pitch fan has a reverse thrust position inducing a reverse flow through the exit plane and into the fan cowl. The serrated trailing edge forms a plurality of vortex generators configured to induce vortices in the reverse flow.
US11053887B2
An assembly is provided for an aircraft propulsion system. This assembly includes a target-type thrust reverser and a tubular trailing edge body. The target-type thrust reverser includes a plurality of thrust reverser doors. Each of the thrust reverser doors is configured to pivot between a stowed position to a deployed position. The tubular trailing edge body is configured to at least partially form a gas path nozzle for the aircraft propulsion system. The tubular trailing edge body is configured to be displaced when the thrust reverser doors pivot from the stowed position to the deployed position.
US11053884B2
An internal combustion engine includes a hollow cylinder, a piston within the hollow cylinder, and a cylinder head. A base valve assembly at a base of the hollow cylinder permits or restricts fluid flow from an intake manifold into a sub-chamber below the piston. The piston includes at least one intake port connecting a combustion chamber above the piston with the sub-chamber, and a transfer valve that opens and closes the at least one intake port. When the transfer valve opens the at least one intake port, fluid is permitted to flow from the sub-chamber to the combustion chamber. The internal combustion engine operates according to a four-stroke piston cycle, wherein multiple intake stages are provided. The intake stages may include intake of air into the sub-chamber during a compression stroke, transfer of air from the sub-chamber to the combustion chamber during a power stroke, intake of air-fuel mixture into the sub-chamber during an exhaust stroke, and transfer of air-fuel mixture from the sub-chamber to the combustion chamber during an intake stroke.
US11053878B2
An abnormality determination apparatus for an internal combustion engine in which an intake passage upstream of a supercharger and a crankcase are connected by a breather line includes: an intake flow rate detection unit that detects an intake flow rate in the intake passage; and an abnormality determination unit that determines abnormality of the breather line. The abnormality determination unit calculates a rotation second-order component of a fluctuation waveform of the intake flow rate, accumulates a first number of times for which the rotation second-order component exceeds an upper threshold and a second number of times for which the rotation second-order component falls below a lower threshold, and determines the abnormality of the breather line by comparing an accumulated value of the first number of times and the second number of times with the number of revolutions of a crank.
US11053869B2
The present invention describes a fuel-management system for minimizing particulate emissions in turbocharged direct injection gasoline engines. The system optimizes the use of port fuel injection (PFI) in combination with direct injection (DI), particularly in cold start and other transient conditions. In the present invention, the use of these control systems together with other control systems for increasing the effectiveness of port fuel injector use and for reducing particulate emissions from turbocharged direct injection engines is described. Particular attention is given to reducing particulate emissions that occur during cold start and transient conditions since a substantial fraction of the particulate emissions during a drive cycle occur at these times. Further optimization of the fuel management system for these conditions is important for reducing drive cycle emissions.
US11053865B2
A compression ratio control device includes a compression ratio controller configured to control a compression ratio of a combustion chamber so that the maximum combustion pressure approaches a combustion pressure upper limit value (cylinder-internal-pressure upper limit value) based on a detection signal of a detector at least when an engine load is equal to or less than a predetermined load (engine full load).
US11053861B2
In accordance with one exemplary embodiment of the present disclosure, a method for providing overspeed protection for a gas turbine engine is provided. The gas turbine engine may include an engine core and an engine shaft. The method may include determining an overspeed condition of the engine. The overspeed condition may be indicative of an above normal rotational speed of the engine shaft. The method may also include reducing an airflow through the engine core of the gas turbine engine in response to the determined overspeed condition to reduce the rotational speed of the engine shaft.
US11053857B2
A method and decoupler for disengaging an output shaft from an engine in a back drive event with a backdrive decoupler. The backdrive decoupler includes a an output shaft, drive shaft, and a retention mechanism selectively coupling the output shaft to the drive shaft. In a backdrive event, the decoupler decouples the output shaft from the drive shaft.
US11053852B2
A multi-flow turbojet engine generally includes an upstream ducted fan driven by a gas generator, the gas generator having a first and a second compressor, which are coaxial, an inlet case forming a support for the rotors of the upstream ducted fan and of the first compressor, an inter-compressor case downstream of the inlet casing and forming a support for the rotors of the second compressor, attachment means for thrust take-up rods, which attachment means are arranged on the inter-compressor case. The turbojet engine includes at least one axial stress transmission rod for connecting the inlet case to the inter-compressor case.
US11053850B2
A gas turbine includes a turbine blade including a leading edge, a trailing edge, and a plurality of partition walls defining a cooling passage for passing cooling air inside the turbine blade, a first partition wall of the plurality of partition walls facing the leading edge; and an injection nozzle disposed in the first partition wall to cool an inner surface of the leading edge. The injection nozzle includes a nozzle protrusion protruding from the first partition wall toward the leading edge and surrounding an injection hole formed in the first partition wall. Thus, a flow direction of cooling fluid to be supplied to the leading edge can be guided, and deformation and damage to turbine blade components can be prevented.
US11053847B2
Solid-state thermoclines with internal baffle structures are used in place of heat exchangers in a closed thermodynamic cycle power generation or energy storage system, such as a closed Brayton cycle system. The baffles limit the conductive and/or radiative transfer of heat between a solid thermal medium within different zones defined by the baffle structures.
US11053842B2
An engine core including turbine, compressor, and core shaft connecting the turbine to the compressor, wherein a compressor exit temperature has an average airflow; and a fan upstream including a plurality of fan blades extending from a hub, each fan blade having a leading and trailing edge, wherein a fan rotor entry temperature has an average airflow across the leading edge of each blade at cruise conditions and fan tip rotor exit temperature has an average temperature of airflow across a radially outer portion of each blade at the trailing edge cruise conditions. A fan tip temperature rise as: the fan tip rotor exit temperature the fan rotor entry temperature . A core temperature rise as: the compressor exit temperature the fan rotor entry temperature , A core to fan tip temperature rise ratio of: the core temperature rise the fan tip temperature rise is in the range from 2.845-3.8.
US11053840B2
An internal combustion engine, in particular gas engine, with multiple cylinders, wherein in the cylinders a mixture of charge air and a gaseous fuel can be combusted, with a first turbocharger, in which exclusively the charge air can be compressed, and with a second turbocharger, in which exclusively the gaseous fuel can be compressed.
US11053831B2
An exhaust gas purification apparatus for an internal combustion engine includes a filter supporting the catalyst with an oxygen storage capacity, an air fuel ratio sensor to detect an air fuel ratio of exhaust gas at the downstream side of the filter, and a controller configured to change an air fuel ratio of exhaust gas flowing into the filter, to estimate an amount of particulate matter deposited in an interior of a partition wall of the filter, estimate a maximum storable oxygen amount of the catalyst from a change of the air fuel ratio of exhaust gas obtained by the air fuel ratio sensor at the time when the air fuel ratio of exhaust gas is changed by the controller, and correct the maximum storable oxygen amount of the catalyst based on the amount of particulate matter deposited in the interior of the partition wall of the filter.
US11053830B1
A vehicle exhaust system includes an exhaust gas aftertreatment component and an exhaust duct positioned downstream of the exhaust gas aftertreatment component. The exhaust duct defines an internal cavity and a mixer is positioned within the internal cavity. A sensor is configured to sample exhaust gas downstream of the mixer.
US11053829B2
An exhaust gas treatment system (10) for treating exhaust gases (12) of an internal combustion engine of a motor vehicle has an exhaust gas catalytic converter, a pipe piece (14) connected to an input side of the exhaust gas catalytic converter for feeding in exhaust gases (12) of the internal combustion engine, and a heating line (20) that opens into the pipe piece (14) for feeding heating gas (16) into the pipe piece (14) for heating the exhaust gas catalytic converter to the light-off temperature. The heating gas (16) is fed in as a vortex flow that rotates about a longitudinal axis of the pipe piece (14) to achieve homogeneous thorough mixing with the exhaust gas (12) with rapid heating across an entire cross-section of the exhaust gas catalytic converter.
US11053828B2
A skip fire engine controller and method of control is described wherein during transitions from a first firing density to a second firing density, a firing density and a pumping density are separately set so as to balance the conflicting demands of (a) torque control, (b) Noise, Vibration and Harshness (NVH), (c) air flow through the engine and (d) air-fuel ratio.
US11053821B2
An engine brake rocker arm assembly operable in an engine drive mode and an engine braking mode, the engine brake rocker arm assembly selectively opening first and second exhaust valves, includes: an exhaust valve rocker arm assembly having an exhaust rocker arm that rotates around a rocker shaft; and an engine brake actuation assembly including an actuator assembly; an actuator lever; and a mechanically controlled engine brake actuator that moves between a first position corresponding to the engine brake mode in which the second exhaust valve is opened prior to the first exhaust valve, and a second position corresponding to the drive mode in which the second valve is not opened prior to the first exhaust valve.
US11053819B2
A valve bridge system comprises a valve bridge configured to extend between at least two engine valves of an internal combustion engine. In one embodiment, a valve bridge guide is operatively connected to the valve bridge and configured to extend between at least two valve springs respectively corresponding to the at least two engine valves, the valve bridge guide defining a surface conforming to a valve spring of the at least two valve springs. In another embodiment, the valve bridge guide may comprise at least a first member maintained in a first fixed position relative to and at a predetermined distance from the valve bridge. In both embodiments, the valve bridge guide is configured to avoid contact with the valve bridge in a controlled state, but to permit contact with valve bridge to resist uncontrolled movement of the valve bridge.
US11053816B2
A front section for a gas turbine engine according to an example of the present disclosure includes, among other things, a fan section including a fan hub. The fan hub includes a hub diameter supporting a plurality of fan blades including a tip diameter. A transitional entrance passage is configured to communicate flow between the fan section and a compressor section. The transitional entrance passage includes an inlet disposed at an inlet diameter and an outlet to the compressor section disposed at an outlet diameter. A method of designing a gas turbine engine is also disclosed.
US11053809B2
A component, such as for a turbine engine, can include an airfoil with an outer wall defining an exterior surface bounding an interior and defining a pressure side and a suction side extending between a leading edge and a trailing edge to define a chord-wise direction and extending between a root and a tip to define a span-wise direction. The component can also include at least one cooling passage within the interior.
US11053804B2
A shroud for a turbine blade includes a shroud body having an outer side and opposite first and second Z-shaped side edges; a first sealing fin and a second sealing fin extending outwardly from the outer side and spaced apart from each other in a streamwise direction, the first and second sealing fins extending between the first and second side edges of the shroud body; a first ridge extending radially outwardly from the outer side, the first ridge extending from and connecting the first and second sealing fins along the first side edge and having a radial height which varies; and a second ridge extending radially outwardly from the outer side, the second ridge extending from and connecting the first and second sealing fins along the second side edge and having a radial height which varies.
US11053795B2
A compressor having a front housing in which a crank chamber is formed. A cylinder block is coupled to an opposite surface facing the front housing and includes reciprocating pistons in a plurality of cylinder bores. A rear housing is coupled to an opposite surface facing the cylinder block, the rear housing includes a suction chamber and a discharge chamber formed therein. A rotating shaft 400 is inserted via centers of the front housing and the cylinder block, the shaft inserted into a swash plate. A diameter maintenance part is configured to constantly maintain a diameter based on an axis direction of the piston 220. A sensor part is configured to sense a speed and a stroke of the piston in accordance with a change in position of a position determination part positioned on one side of the diameter maintenance part.
US11053793B2
A single layer antenna path profile is provided. An antenna assembly for the single layer antenna profile includes a bobbin having a cylindrical body defining an outer radial surface, an inner radial surface, and a central axis. The antenna assembly also includes one or more channels defined in the outer radial surface. In some aspects, each channel is defined by a continuously curved inner surface having a constant radius. In some aspects, the inner surface extends more than 180 but less than 360 and thereby defines an opening in the body. The antenna assembly also includes a coil including a wire wrapped about the bobbin and received within the one or more channels. In some aspects, an arcuate portion of the wire extends through the opening such that a portion of the wire protrudes out of the channel.
US11053776B1
A system for injecting chemicals into a subsea structure has a housing with an interior, a plurality of chemical injection metering valves positioned in the housing in which each of the plurality of chemical injection metering valves has an inlet and an outlet, a subsea connection plate connected to the inlet and the outlet of the plurality of chemical injection metering valves, an electrical system position in the housing so as to individually control the plurality of chemical injection metering valves, and a communication module positioned in the housing and cooperative with the electrical system so as to control an electrical signal passing through the electrical lines to the plurality of chemical injection metering valves.
US11053773B2
A system (10) delivers of a flowable substance S to a remote location through a conduit (144). The system (10) has a body 12 with first and second portions (14,16) and at least two plugs (P1, P2) associated with the body (12) so that in a first configuration the plugs (P1, P2) are spaced apart and form a sealed region (20) for holding a volume of the substance S, and, in a second configuration at least the second plug (P2) is disposed in the second portion wherein the substance S can flow in a downstream direction past or through the second plug and out of the body (12). A first valve (66) is coupled with the body (12) and has: (a) and opened state where the substance S is able to flow out of the body (12) and (b) a closed state where the first valve (66) prevents flow of the substance S out of the body (12) and prevents flow of a further fluid into or out of the body (12) while allowing a bypass flow of the further fluid in an upstream direction through a bypass flow path (110) of the first valve (66) to facilitate travel of the system (10) through a column of the further fluid in the conduit (144).
US11053749B2
A threaded joint for oil well steel pipe is provided. The threaded joint includes a pin provided with a male thread, and a box provided with a female thread threadedly engaged with the male thread, and at an outer periphery side sealing portion, a cross-sectional area S1 of the pin at a seal point, and a cross-sectional area S0 of a pipe body portion, which is an unprocessed pin portion, satisfy an expression (S1/S0)×100≥15(%), at an inner periphery side sealing portion, a cross-sectional area S2 of the box at a seal point, and a cross-sectional area S0′ of a pipe body portion, which is an unprocessed box portion satisfy an expression (S2/S0′)×100≥20(%), and a surface area S3 of a contact portion of an intermediate shoulder between thread rows and the cross-sectional area S0 satisfy the expression (S3/S0)×100≥10(%).
US11053748B2
An expandable connection is configured such that a metal-to-metal seal is created upon expansion, even under different expansion ratios. The creation of the metal-to-metal seal can rely on a spring-back effect after expansion. A high pressure rating of the metal-to-metal seal that is created can be achieved with an oversized box face thickness. The expandable connection can also be configured to achieve a high tensile efficiency.
US11053742B1
A rotating cutter for a fixed cutter type bit includes an annular sleeve with a retainer having a plurality of inwardly extending tabs and a spindle cutter rotatably coupled to the annular sleeve. The spindle cutter includes a spindle extending into the annular sleeve and rotatable about a central axis of the annular sleeve, a base portion positioned between the retainer and a proximal end of the annular sleeve, and a cutter portion coupled to the spindle. The rotating cutter further includes at least one pin disposed between adjacent tabs of the plurality of tabs of the retainer to prevent axial movement of the base portion through the retainer.
US11053741B1
A sidetrack assembly for forming a lateral wellbore includes a cutting device having a body having a passage, and a mill head configured to connect to the body so that an interior of the mill head and the body form a pressure chamber in fluid communication with the outlet passage. The mill head includes a first port in fluid communication with the pressure chamber, a second port in fluid communication with the pressure chamber, and a blade arranged on a face of the mill head. A whipstock connected to the cutting device includes a tubing having a first end removably inserted in the first port and the passage and a second end connectable to a downhole tool, an inclined surface for guiding the mill at a non-zero angle relative to a central axis of an existing wellbore, and an attachment section removably connecting the cutting device and the whipstock.
US11053731B2
A roller shade adapted to adjustably cover a structural opening comprising a pair of longitudinal side panel assemblies each comprising a tensioning assembly and adapted to be attached at opposite sides of the structural opening and a roller tube assembly adapted to be attached to and between the pair of longitudinal side panel assemblies. The roller tube assembly comprises a roller tube comprising at least one channel and a shade material attached to the roller tube and adapted to unroll from the roller tube from an opened position to a closed position. The roller tube assembly further comprises at least one cable cone secured to an end of the roller tube and comprising a lateral wall comprising a plurality of index slots disposed at radial intervals along the lateral wall. The roller shade also comprises at least one cable adapted to be wound about the cable cone, be tensioned by the tensioning assembly, and be attached to a free end of the shade material. The cable cone is adapted to be aligned with respect to the roller tube to an aligned position at which one of the index slots is substantially aligned with the at least one channel in the roller tube. An index insert is adapted to be inserted through the substantially aligned index slot and into the channel in the roller tube to lock the alignment between the roller tube and the cable cone.
US11053717B2
A hold open rod assembly includes an outer tubular structure and an inner tubular structure positioned for telescoping movement relative to the outer tubular structure. A locking mechanism retains the hold open rod assembly in an extended state to support a panel of an aircraft in an open position at the selection of a user.
US11053715B2
An openable side window for a motor vehicle is provided having an openable side window which covers a lateral vehicle opening when in its closed position and can be locked by a securing device, the securing device comprising a pivotable securing handle which can be pivoted between an unlocked position and a locked position and has an operating arm and a latch arm which, when in the locked position, interacts with a latch counterpart, wherein the latch arm comprises a functional element which is pre-loaded radially outward with respect to a pivot axis of the securing handle.
US11053710B2
A guard locking element (4) actuatable by means of an electric drive (6). By means of the electric drive (6), the guard locking element (4) can be brought into a blocking position such that an actuator (2) of a safety switch is locked by said guard locking element. The guard locking element (4) is connected to the electric drive (6) by means of a coupling (11) such that a rotary motion of the electric drive (6) is converted into a purely translatory motion of the guard locking element (4).
US11053706B2
The present invention extends to a double canopy covered wagon. Interior canopy frame supports support an interior canopy over a portion of a wagon flooring surface and under larger exterior canopy frame supports. The exterior canopy frame supports support an exterior canopy over the interior canopy. Including interior and exteriors canopies increases insulation relative to a single canopy. Further, since the exterior canopy frame supports are larger than the interior canopy frame supports, air can flow between the interior and exterior canopies. Air flow between the canopies in combination with increased insulation facilitates more effective climate control inside a wagon.
US11053705B2
To provide a method of toppling a tower structure more safely, simply and quickly than in the conventional manner. In a method of toppling a tower structure that is fixedly supported on a base 20 to demolish the tower structure 10, the method includes a base dividing step of dividing the base 20 into an upper base 22 and a lower base 26, by cutting the base 20 in a substantially horizontal direction, an upper base dividing step of dividing the upper base 22 into a support base portion 23 and a separated base portion 24 by cutting the upper base 22, in a longitudinal direction, from above to a substantially horizontal surface 20a, a removing step of removing the separated base portion 24, and a toppling step of toppling the tower structure 10 together with the support base portion 23 using, as a tumble axis 23a, a lower edge of a longitudinally cut surface 22a of the support base portion 23, in which the tumble axis 23a is located on a toppling direction side of the tower structure with respect to a center of gravity C. Thus, since the tumble axis 23a of the robust base serves as a tumble fulcrum by itself, there is no possibility that breakage of the base is caused even by the concentration of a buckling load, and the tower structure can be toppled in an intended direction.
US11053699B2
The present disclosure relates to a climbing shoe for a climbing safety screen, comprising: a support member for engaging a climbing rail of the climbing safety screen; a fork member with a first flange and a second flange; an outer member pivotally connected to the first flange and second flange about a transverse axis; an inner member mounted to the outer member and pivotable about a longitudinal axis with respect to the outer member.
US11053698B2
A formwork element has a theft protection, wherein a base layer is applied onto at least one surface of the formwork element, and wherein at least one signal module for communication with at least one base station is provided. The base layer being designed in a water-tight manner, and an at least partially porous concrete-repellent separating layer is provided above the base layer.
US11053696B1
Provided is a panel suitable for forming a floor covering. The panel has a substantially planar top side, a substantially planar bottom side, and at least four substantially linear side edges. The linear side edges have at least one pair of opposite side edges. The linear side edges may be provided with a locking means.
US11053694B1
A deck resurfacing material is made of a kiln-dried, southern yellow pine board. The board has had treatment with a non-metallic preservative and stabilizer system. The board has a top, a length, two ends and two sides with side edges. A grooved pattern on top includes flat areas at each side, two sets of grooves interiorly of the flat areas and another flat area interiorly between the two sets of grooves. The board has a transition from the top to each side edge that is radiused and the side edges are not tongue-and grooved. The two ends have end matching in the form of a tongue at one end of the board and a groove at the other end of the board so the board can be installed with end matching to a like board, and a transition from the top to each end that is a radiused.
US11053691B2
Floor panels are shown, which are provided with a mechanical locking system on long and short edges allowing installation with vertical folding and where the long edge locking system prevents separation of the short edges during the folding action. Floor panels with mechanical locking systems with a flexible and displaceable tongue allowing easy installation.
US11053684B2
A process for preparing roofing granules includes forming kaolin clay into green granules and sintering the green granules at a temperature of at least 900 degrees Celsius to cure the green granules until the crystalline content of the sintered granules is at least ten percent as determined by x-ray diffraction.
US11053673B2
In a toilet bowl composed of a plurality of resin-made components, at least one resin-made component includes a base material made of a foam synthetic resin, and a coating layer made of a polyurea resin covering a surface of the base material. A flush toilet tank includes a base material made of a foam synthetic resin molded in a tank shape, and a coating layer made of a polyurea resin covering a surface of the base material on an inner surface and an outer surface in the tank shape. A pipe body inserted, as a new pipe, into an aging already-existing pipe includes a base material made of a foam synthetic resin formed in a pipe shape, and a coating layer made of a polyurea resin covering a surface of the base material on an inner surface and an outer surface in the pipe shape.
US11053671B2
Sinks and drains for sinks permitting the attachment of the drain to the sink such that the drain is substantially disposed below the top surface of the sink basin, and such that there is no discernable separation between the base of the sink basin and the drain when viewed from above the sink. A method of making a sink such that there is no discernable separation between the base of the sink basin and the drain when viewed from above the sink.
US11053665B2
A dual mode control system for a work vehicle includes a hydraulic system configured to drive a loader assembly and a dozer assembly coupled to the work vehicle. The hydraulic system includes a fluid delivery system comprising a plurality of flow paths fluidly coupled to a hydraulic pump. The hydraulic system includes a valve assembly configured to regulate diversion of fluid into a first and a second hydraulic cylinders coupled to the fluid delivery system to adjust the loader assembly, or into a third cylinder coupled to the fluid delivery system to adjust the dozer assembly. The dual mode control system also includes a controller operably coupled to the valve assembly, and one or more user interfaces coupled to the controller to enable an operator to provide inputs to cause the controller to adjust the valve assembly, and to thereby adjust the loader assembly or the dozer assembly.
US11053661B2
A work machine includes: a satellite communication antenna for detecting a position of an upper swing structure; angle sensors detecting postures of two work devices; position computing devices that calculate postures/positions of the two work devices on the basis of outputs from the satellite communication antenna and the angle sensors; a display device on which the position of at least one work device of the two work devices and a position of a target surface are displayed; a display selection switch that outputs a first input signal for displaying a work device selected by an operator from between the two work devices on the display device; and a display changeover section that displays the work device corresponding to the first input signal input from the display selection switch out of the two work devices and the position of the target work object of the work device on the display device.
US11053648B2
A pneumatic fender monitoring system is provided. Image data captured by using at least one of a front view imaging device that successively images an external shape in a front view of a pneumatic fender used disposed between a vessel and a vessel or a side view imaging device that successively images the external shape in a side view of the pneumatic fender is successively input into a control unit and successively displayed on a monitor, and the control unit determines, on the basis of the image data, whether an amount of deformation of the external shape of the pneumatic fender is within a preset tolerance range or outside of a preset tolerance range.
US11053644B2
The invention relates to a tamping unit (1) for tamping sleepers (3) of a track (4), comprising oppositely positioned tamping tools (14, 17) which are connected in each case to a squeezing cylinder (9, 15) for generating a squeezing motion, wherein an eccentric drive (11) is provided for generating a vibratory motion. In this, it is provided that a first squeezing cylinder (9) is connected mechanically to the eccentric drive (11), and that a first pressure chamber (18) of the first squeezing cylinder (9) is connected hydraulically via a connecting line (22, 27) to a second pressure chamber (20) of a second squeezing cylinder (15) in order to transmit a pressure change, generated in the first pressure chamber (18) by means of the eccentric drive (11), to the second pressure chamber (20).
US11053642B2
Composition of precipitated calcium carbonate and method of producing the same and the uses of the composition. The composition comprises a plurality of essentially spherical granules having an average diameter of 1-50 um formed from primary precipitated calcium carbonate particles having an average diameter of 30 to 60 nm, capable of liberating at least a part of the primary particles by deagglomeration in aqueous suspension. The present compositions can be used for modifying binders of paints, printing inks, plastics, adhesives, sealants and surface sizes and pulp sizes. The invention further concerns a method for storing of precipitated calcium carbonate particles having an average diameter in the nanometer range.
US11053637B2
According to an aspect of the present disclosure, a method of treating a textile with an antimicrobial agent includes receiving a textile in a washer system. The textile includes an identification tag, which uniquely identifies the textile among a plurality of textiles. The method also includes detecting, in the washer system, the identification tag. The method further includes determining, based on the detected identification tag, one or more parameters for treating the textile with an antimicrobial agent. The antimicrobial agent includes a metallic ion. The method also includes washing the textile with a detergent, and, after washing the textile with the detergent, treating the textile with the antimicrobial agent based on the one or more parameters.
US11053625B2
In the washing machine according to the present disclosure, the reinforcing member for reinforcing the strength of the balancer housing of the ball balancer is disposed on the outer surface of the balancer housing and includes a plurality of ribs. When the reinforcing member and the balancer housing are injected, a plurality of bumps may be formed inside the balancer housing by the plurality of ribs to affect the rolling of the ball. To prevent this, the reinforcing member is disposed in the area of the outer surface of the balancer housing corresponding to the non-contact surface on which the ball does not contact.
US11053623B2
A washing machine appliance and related methods are provided. The washing machine appliance has a wash tub, a wash basket rotatably mounted within the wash tub, and a balancing system comprising a plurality of fluid chambers defined in the wash basket. The method includes rotating the wash basket within the wash tub at a basket speed. The method also includes receiving, with the balancing system, a first signal from a measurement device and receiving, with the balancing system, a second signal from a controller of the washing machine appliance. The method further includes opening a valve to provide fluid to at least one of the plurality of fluid chambers of the balancing system based on the first signal and the second signal.
US11053621B2
A washing machine appliance and method of operation for determining load size are provided herein. The washing machine appliance may include a cabinet, a tub, a wash basket, a measurement device, a motor, and a controller. The cabinet may include a front panel. The front panel may define an opening. The tub may be positioned within the cabinet. The wash basket may be rotatably mounted within the tub. The wash basket may define a wash chamber to receive an article load of one or more articles. The measurement device may detect movement of the tub. The motor may be in mechanical communication with the wash basket to selectively rotate the wash basket within the tub. The controller may be in operative communication with the measurement device and the motor.
US11053617B2
Woven fabrics are formed from high tenacity fibers or tapes that are loosely interwoven with adhesive coated filaments, to composite articles formed therefrom, and to a continuous process for forming the composite articles.
US11053614B2
Knit fabrics having ceramic strands, thermal protective members formed therefrom and to their methods of construction are disclosed. Methods for fabricating thermal protection using multiple materials which may be concurrently knit are also disclosed. This unique capability to knit high temperature ceramic fibers concurrently with a load-relieving process aid, such as an inorganic or organic material (e.g., metal alloy or polymer), both small diameter wires within the knit as well as large diameter wires which provide structural support and allow for the creation of near net-shape preforms at production level speed. Additionally, ceramic insulation can also be integrated concurrently to provide increased thermal protection.
US11053612B2
An improved system for fabricating alternating S/Z cabled yarn, for alternating S/Z twisted yarn and for (whether or not alternately) applying a torsion to a yarn, in which critical air flow conditions are obtained at least at the outlet of the torsion chamber of the devices. A method for fabricating alternating S/Z cabled yarn, for alternating S/Z twisted yarn and for (whether or not alternately) applying a torsion to a yarn under critical air flow conditions at least at the outlet of the torsion chamber used in the method, and a product according to these methods.
US11053610B2
A polyvinyl alcohol fiber that can easily be fibrillated at a low manufacture cost is provided. The readily fibrillative polyvinyl alcohol fiber contains a polyalkylene oxide in addition to a polyvinyl alcohol. A mass ratio of the polyalkylene oxide ranges from 3 to 40% relative to the total mass of the polyvinyl alcohol and the polyalkylene oxide. A method for manufacturing the polyvinyl alcohol fiber is also provided.
US11053606B2
A method of producing a silicon single crystal, including pulling a silicon single crystal by Czochralski method while a magnetic field is applied to a raw material melt, including: setting a diameter on pulling the silicon single crystal to 300 mm or more, setting a growth axis direction of the silicon single crystal to <111>, and growing the silicon single crystal so as to satisfy a relation of 1096/D−(0.134×M+80×R)/D>0.7, wherein D [mm] is the diameter on pulling the silicon single crystal, M [Gauss] is a central magnetic field strength at a surface of the raw material melt, and R [rpm] is a rotation rate of the silicon single crystal. This makes it possible to produce a <111> crystal with favorable macroscopic RRG distribution and microscopic variation of resistivity.
US11053598B2
An electrode material which may be used in an electrochemical cell used to convert carbon dioxide into useful products, such as synthetic fuel. The electrode material may comprise nano-sized core-shell catalyst (i.e., core-shell nanoparticles, or CSNs) having a catalytic core component encompassed by one or more outer shells, wherein at least one of the outer shells has a mesoporous structure. Electrochemical cells, electrochemical cell electrodes, and methods of making CSNs are also provided.
US11053596B2
Pickling a plurality of steel strips (2) having initial material properties (ME) on a pickling line: A computer (5) defines a number of sequences (Gi), which each contain the number of strips (2) to be pickled. For each of the defined sequences (Gi), the computer (5) determines an optimized mode of operation of the pickling line and, on the basis of the mode of operation, at least one measure (M), by means of a model (9) of the pickling line based on mathematical physical equations and by using the initial material properties (ME) of the strips. As long as a termination criterion (K) is not met, the computer (5) varies the defined sequences (Gi) and determines respective optimized modes of operation of the pickling line and associated measures (M) anew. As soon as the termination criterion (K) is met, the computer (5) either selects one of the last defined sequences (Gi) and initiates the control of the pickling line in accordance with the selected sequence (Gi) or offers to an operator (13) a plurality of the last defined sequences (Gi) together with the respective measures (M) thereof, receives a selection command (SEL) for selecting one of the offered sequences (Gi) from the operator (13), and initiates the control of the pickling line in accordance with the sequence (Gi) selected from the operator (13).
US11053593B2
Disclosed is a copper alloy article including: a substrate 10 made of a copper alloy; a polyester-based resin body 40; and a compound layer 20 for bonding the substrate 10 and the polyester-based resin body 40, wherein the compound layer 20 contains; a compound having a nitrogen-containing functional group and a silanol group, and an alkane type amine-based silane coupling agent.
US11053589B2
A multi-inlet gas distributor for a fluidized bed chemical vapor deposition reactor that may include a distributor body having an inlet surface, an exit surface opposed to the inlet surface, and a side perimeter surface. The distributor body may also include multiple-inlets evenly spaced from each other, wherein the multiple-inlets penetrate the distributor body from the inlet surface to a first depth. The distributor body may additionally include cone-shaped apertures connecting to corresponding ones of the multiple-inlets at the first depth and extend from the first depth toward the exit surface. An apex may be formed on the exit surface at the intersection of the cone-shaped apertures.
US11053588B2
A deposition apparatus including a frame and a cylindrical drum with a cylindrical surface that extends along a central axis. The drum has a first and a second end surface, which extend perpendicularly to the central axis. The drum is rotatably mounted in the frame and includes a plurality of gas zones positioned on the cylindrical surface. The included gas channels extend within the drum. At least a number of the gas zones are in gas connection with at least two channels. The deposition apparatus includes closing elements for closing off all but one of the at least two channels with which a said gas zone is in gas connection so that the type of gas supplied to the various gas zones along the drum surface is programmable.
US11053585B2
A reactor system and related methods are provided which may include a heating element in a wafer tray. The heating element may be used to heat the wafer tray and a substrate or wafer seated on the wafer tray within a reaction chamber assembly, and may be used to cause sublimation of a native oxide of the wafer.
US11053584B2
Systems and methods for supplying a precursor material for an atomic layer deposition (ALD) process are provided. A gas supply provides one or more precursor materials to a deposition chamber. The deposition chamber receives the one or more precursor materials via an input line. A gas circulation system is coupled to an output line of the deposition chamber. The gas circulation system includes a gas composition detection system configured to produce an output signal indicating a composition of a gas exiting the deposition chamber through the output line. The gas circulation system also includes a circulation line configured to transport the gas exiting the deposition chamber to the input line. A controller is coupled to the gas supply. The controller controls the providing of the one or more precursor materials by the gas supply based on the output signal of the gas composition detection system.
US11053581B2
An article comprises a body and at least one protective layer on at least one surface of the body. The at least one protective layer is a thin film having a thickness of less than approximately 20 microns that comprises a ceramic selected from a group consisting of Y3Al5O12, Er2O3, Er3Al5O12, and a ceramic compound comprising Y4Al2O9 and a solid-solution of Y2O3—ZrO2.
US11053577B2
A nickel-cobalt material and method of forming includes forming a doped nickel-cobalt precursor material. The method also includes heat treating the doped nickel-cobalt precursor material, wherein the heat treating includes at least heating within a temperature zone below the onset temperature for grain growth in the doped nickel-cobalt precursor material.
US11053576B2
The present disclosure relates to a method for producing an aluminum alloy rolled material for deformation molding, the method including: a step of performing homogenization treatment of an ingot including an aluminum alloy with predetermined composition; a step of cooling the aluminum alloy after the homogenization treatment so that an average cooling rate in an ingot thickness of ¼ part from 500° C. to 320° C. is 30° C./h to 2000° C./h; and a step of starting hot rolling at 370° C. to 440° C. and winding the hot-rolled aluminum alloy at 310 to 380° C., in which the method for producing an aluminum alloy rolled material for deformation molding further includes a step of retaining the aluminum alloy after the cooling step for 0.17 hours or more at a heating temperature before rolling set within a range of 370° C. to 440° C. before the hot rolling.
US11053572B2
Disclosed herein is an article comprising a metal alloy; where the metal alloy comprises a base metal, a second element and a third element; where the base metal is magnesium, calcium, strontium, zinc, or a combination thereof; where the second element is chemically different from the third element; and where the second element and the third element are scandium, yttrium, gadolium, cerium, neodymium, dysporium, or a combination thereof; and a protective layer disposed upon the metal alloy and is reactively bonded to the metal alloy; where the protective layer comprises a base non-metallic derivative, a second non-metallic derivative and a third non-metallic derivative of metals present in the metal alloy; and where the base non-metallic derivative, the second non-metallic derivative and the third non-metallic derivative are all chemically different from one another.
US11053571B2
We have developed a scalable approach to directly incorporate grain-refining nanoparticles into conventional hot-tear-susceptible pure aluminum or aluminum alloy powders. These aluminum alloy powders may be additively manufactured into high-strength, crack-free aluminum alloys with fine equiaxed microstructures by incorporating nanoparticle nucleants to control solidification during additive manufacturing. Some variations provide an additively manufactured aluminum alloy comprising aluminum and at least one grain-refining element, wherein the additively manufactured aluminum alloy has a microstructure with equiaxed grains. Pure aluminum or aluminum alloys, combined with grain refiners, are useful in many processes beyond additive manufacturing. Some variations provide an aluminum alloy comprising aluminum and grain-refining nanoparticles selected from zirconium, tantalum, niobium, or titanium, wherein the aluminum alloy has a microstructure that is substantially crack-free with equiaxed grains.
US11053568B2
The present invention provides a method of manufacturing a single-walled-carbon-nanotube-reinforced metal matrix complex material. The method includes (a) manufacturing a complex powder by performing ball milling of a metal powder and a single-walled carbon nanotube powder, and (b) manufacturing a metal-carbon-nanotube complex material by spark-plasma-sintering (SPS) the complex powder manufactured during step (a). According to the method of manufacturing the single-walled-carbon-nanotube-reinforced metal matrix complex material according to the present invention, in order to manufacture material parts requiring high strength and abrasion resistance, the single-walled carbon nanotube powder is added to various metal matrixes and ball milling is performed, thus manufacturing a complex powder having uniform dispersity. The manufactured complex powder is subjected to complexation in a short period of time using a spark-plasma-sintering (SPS) process, thereby easily manufacturing a bulk-type single-walled-carbon-nanotube-reinforced metal matrix complex material having excellent physical properties.
US11053565B2
A post-heating treatment device performs a post-heating treatment for a welded section of a rail, after an induction heating coil is automatically disposed at a predetermined position based on the welded section. The device includes welded section detecting unit for detecting the position of a welded section on a rail, a first coil and a second coil that form an induction heating coil, first coil moving unit for moving the first coil to a position spaced apart from the rail at a predetermined distance, second coil moving unit for moving the second coil to a position separated from the rail at a predetermined distance, where the second coil is contacted to the first coil, clamping unit for pressing against the contact portion between the first coil and the second coil, and current applying unit for applying a predetermined current to the formed induction heating coil.
US11053560B2
An integral high pressure rapid quenching vacuum furnace utilizing an electrical isolation transformer in the blower motor power control system in order to isolate the motor windings, reduce the possibility of gas ionization and eliminate ground faults, particularly when quenching in argon gas, is described. In order to achieve the desired mechanical properties of certain metal alloys being quenched using argon gas as a quenching medium in the high pressure gas vacuum furnace chamber, a 600 HP—460 Volt motor is required. A 460 Volt primary—460 Volt secondary [delta-delta] isolation transformer, having input and output windings separated by an electrostatic shield connected to ground is placed between the power source and the gas blower motor in the quenching chamber filled with argon gas. The 460 Volt power source is connected to a variable frequency drive (VFD) and the VFD is connected to the primary transformer winding. The secondary transformer winding connects 460 Volts to the blower motor windings. The full electrical isolation of the transformer secondary winding results in zero ground fault voltage.
US11053556B1
This disclosure pertains to a testing method for a target pathogen. The method uses biosensors with particular fluorescence characteristics, such that when the biosensor binds to a target pathogen, a fluorophore may emit light if excited. The biosensor may be an aptamer-based biosensor with a fluorophore reporter and a quencher. The excitation of the fluorophore and the detection of fluorescence may be made through the use of a flashlight source and a camera from a mobile device, such as a smartphone.
US11053551B2
A method of determining a probability that a human test subject has colorectal cancer as opposed to not having colorectal cancer is disclosed. The method comprises, for each gene of a set of one or more genes selected from the group consisting of ANXA3, CLEC4D, IL2RB, LMNB1, PRRG4, TNFAIP6 and VNN1: determining a level of RNA encoded by the gene in blood of the test subject, thereby generating test data; providing positive control data representing levels of RNA encoded by the gene in blood of human control subjects having colorectal cancer, and providing negative control data representing levels of RNA encoded by the gene in blood of human control subjects not having colorectal cancer; and determining a probability that the test data corresponds to the positive control data and not to the negative control data, where the probability that the test data corresponds to the positive control data and not to the negative control data represents the probability that the test subject has colorectal cancer as opposed to not having colorectal cancer.
US11053550B2
Methods for generating a prognostic and/or subtype signature for a subject with pancreatic ductal adenocarcinoma (PDAC) are provided. In some embodiments, the methods include determining expression levels for one or more genes listed in Tables 2-5, 9, 10, or 11, and/or the DE-S and/or DE-T subset of genes in PDAC cells obtained from the subject, wherein the determining provides a prognostic and/or subtype signature for the subject. Also provided are methods for classifying a subject diagnosed with pancreatic ductal adenocarcinoma (PDAC) as having an activated stroma subtype or a normal stroma subtype of PDAC and/or a basal subtype or a classical subtype of PDAC; and methods for identifying a differential treatment strategy for a subject diagnosed with pancreatic ductal adenocarcinoma (PDAC).
US11053547B2
Methods, compositions, and systems are provided for managing bovine subjects in order to maximize their individual potential performance and edible meat value, and to maximize profits obtained in marketing the bovine subjects. The methods and systems draw an inference of a trait of a bovine subject by determining the nucleotide occurrence of at least one bovine SNP that is identified herein as being associated with the trait. The inference is used in methods of the present invention to establish the economic value of a bovine subject, to improve profits related to selling beef from a bovine subject; to manage bovine subjects, to sort bovine subjects; to improve the genetics of a bovine population by selecting and breeding of bovine subjects, to clone a bovine subject with a specific trait, to track meat or another commercial product of a bovine subject; and to diagnose a health condition of a bovine subject. Methods are also disclosed for identifying additional SNPs associated with a trait, by using the associated SNPs identified herein.
US11053541B2
Methods, libraries, and kits for nucleotide sequencing are provided. For example, methods can comprise providing a plurality of partitions, the partitions comprising a set of two or more different primers and a target nucleic acid, wherein different partitions contain different sets of primers with a majority of primers in the sets being common with a different primer set but wherein any two different partitions having a common primer contain no more than one common primer; and hybridizing the target nucleic acid to the primers in the reaction partitions under conditions in which fully complementary primers hybridize to the target sequence and primers that are not fully complementary do not hybridize to the target nucleic acid.
US11053535B2
Devices, such as chips for DNA analysis, have at least one fluid transport nanochannel with at least one intersecting (e.g., transverse) sensing nanochannel that can be monitored for change in ionic current to determine characteristics or parameters of interest, e.g., molecular identification, length determination, localized (probe) mapping and the like.
US11053532B2
Methods for detecting and treating polymicrobial infections, wherein a mixed population of microbes (e.g., bacteria) are present in a patient sample and the microbes are not first isolated from the sample. For example, the present invention describes specific polymicrobial infections and methods of treating said infections, wherein a particular antibiotic or a group of antibiotics are selected based on the composition of the polymicrobial infections.
US11053510B2
The invention provides recombinant DNA molecules and constructs, as well as their nucleotide sequences, useful for modulating gene expression in plants. The invention also provides transgenic plants, plant cells, plant parts, and seeds comprising the recombinant DNA molecules operably linked to heterologous transcribable DNA molecules, as are methods of their use.
US11053501B2
A method of treating a subject suffering from a neurodegenerative disease characterized by insufficient autophagy is provided, the method comprising administering to the subject an effective amount of a composition that inhibits N-deacetylase N-sulfotransferase (NDST). Further provided is a method of identifying a modulator of autophagy.
US11053491B2
A protein construct including a gene encoding a light-sensitive protein fused to at least one of either a low complexity sequence, an intrinsically disordered protein region (IDR), or a repeating sequence of a linker and another gene encoding a light-sensitive protein. Among the many different possibilities contemplated, the protein construct may also advantageously include cleavage tags. This protein construct may be utilized for a variety of functions, including a method for protein purification, which requires introducing the protein construct into a living cell, and inducing the formation of clusters by irradiating the construct with light. The method may also advantageously include cleaving a target protein from an IDR, and separating the clusters via centrifuge. A kit for practicing in vivo aggregation or liquid-liquid phase separation is also included, the kit including the protein construct and a light source capable of producing a wavelength that the light-sensitive protein will respond to.
US11053490B2
The present invention relates to compositions comprising polypeptides having xylanase activity and polypeptides having arabinofuranosidase activity for use in, e.g., animal feed. The present invention further relates to polypeptides having arabinofuranosidase activity, polypeptides having xylanase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
US11053487B2
The invention relates to the use of an isolated arabinanase enzyme comprising the activities of (1-5)-α-arabinofuranosidic linkage endohydrolysis in (1-5)-α-L-arabinans (EC 3.2.1.99), and hydrolysis of (1-5)-α-arabinofuranosidic linkages at the non-reducing end of α-L-arabinans or α-L-arabinose-oligomers (EC 3.2.1.55), particularly an arabinan-degrading enzyme isolated from Arxula adeninivorans as feed additive in livestock breeding. Furthermore, the invention relates to the application of the arabinanase in the production of fruit juices or biofuels.
US11053475B2
Described herein are methods of expanding a population of hematopoietic stem cells by contacting the population of hematopoietic stem cells with an effective amount of an inhibitor of G-protein coupled receptor 65 (GPR65) and providing a population of expanded, substantially undifferentiated hematopoietic stem cells. Exemplary GPR65 inhibitors include siRNAs and certain sphingolipids. Also described are populations of expanded hematopoietic stem cells produced by the methods, media and kits containing GPR65 inhibitors, and methods for administering an expanded population of hematopoietic stem cells to patients.
US11053452B2
The present invention relates to a process for purifying renewable feedstock comprising fatty acids, said process comprising the steps, where the renewable feedstock comprising fatty acids comprises at least one acid oil and at least another renewable feedstock, and it is treated with an aqueous medium, to obtain a mixture, and a first stream comprising water is separated from said mixture and a second stream comprising fatty acids is obtained as purified renewable feedstock.
US11053436B2
Surface-modified nanoparticles are produced by associating ligand interactive agents with the surface of a nanoparticle. The ligand interactive agents are bound to surface modifying ligands that are tailored to impart particular solubility and/or compatibility properties. The ligand interactive agents are crosslinked via a linking/crosslinking agent. The linking/crosslinking agent may provide a binding site for binding the surface modifying ligands to the ligand interactive agents.
US11053427B2
A low density, high-strength, degradable temporary plugging agent which includes 60% by weight to 85% by weight of polylactic acid, 5% by weight to 20% by weight of a starch, 5% by weight to 10% by weight of polycaprolactone, 2% by weight to 5% by weight of a solubilizing agent, and 2% by weight to 5% by weight of a toughening agent, based on 100% by weight of the total weight of the agent. The rigid agent can result in bridge plugging in existing cracks, with a significant increase in pressure. The preparation method is simple, the process requirements are low, and industrial production can be realized. When applied to temporary plugging fracturing, under formation conditions, it can be completely degraded within a certain period of time and will not cause secondary damage to the reservoir, while preventing the agent from polluting the formation and the occurrence of pump accidents.
US11053422B2
A chain-reactive, heat-generating microcapsule comprises a first compartment including a first component and a second compartment including a second component. An isolating structure separates the first and second compartments. The isolating structure may rupture when heated above a normal ambient temperature and/or in response to a compressive force. The first component reacts with the second component to produce heat. The microcapsule may further incorporate a blowing agent that responds to heating. In some embodiments, a core within the first compartment comprises a blowing agent material that responds to the heat produced when the first and second components react. The microcapsules can be incorporated into a material comprising a heat-curable resin precursor such that heat generated by the microcapsules can be used to cure the resin precursor.
US11053410B2
A fluorochemical coating composition is provided comprising (A) a hydrolyzable group-containing silane modified with a fluorooxyalkylene-containing polymer and (B) a fluorooxyalkylene-containing polymer having an average molecular weight not higher than the average molecular weight of component (A) in a weight ratio (A)/(B) of 40/60 to 95/5. The composition forms on a substrate a water/oil repellent layer which does not detract from the visibility of the substrate.
US11053402B2
The invention relates to a black ink comprising a black dye dispersion in an aqueous vehicle comprising disperse blue 291 and/or 291:1, disperse red 82 and disperse red 54 and the use of such black ink in a method for digital inkjet-printing of a fabric, preferably on polyester.
US11053399B2
An object is to provide an ink composition for inkjet printing that permits inkjet printing, particularly on metal surfaces, wherein such ink composition possesses sufficiently high adhesion and heat resistance with respect to metal surfaces. As a means for achieving the object, a photocurable inkjet printing ink composition is provided, which contains, relative to the entire ink composition, 0.1 percent by mass or more of an acid-modified acrylic monomer and 10 to 30 percent by mass of a monofunctional monomer with a Tg of 100° C. or above, wherein the monofunctional monomer accounts for 80 percent by mass or more of all monomers.
US11053398B2
A printable ink mixture may include: a medium, orthophosphoric acid, at least one metal oxide, and at least one pigment. A method for producing a color print on a glass or ceramic surface may include: producing an ink mixture including a medium, orthophosphoric acid, at least one metal oxide, and at least one pigment, applying the ink mixture to the glass or ceramic surface, removing the medium from the ink mixture, and baking the ink mixture on the glass or ceramic surface to produce the color print.
US11053383B1
A cellulose/melamine-formaldehyde composite resin, the raw materials of the cellulose/melamine-formaldehyde composite resin comprise by weight percentage: 30-90% of melamine-formaldehyde resin, 5-60% of cellulose powder, 0.01-0.1% of curing agent, 0-20% of inorganic filler, 1-5% of surface modifier, 1-20% of dimer acid. A preparation method of the said cellulose/melamine-formaldehyde composite resin is also provided. The preparation method comprises the following steps: stirring the raw materials, then sieving and molding.
US11053379B2
A heterophasic propylene copolymer (HECO) comprising a polypropylene matrix having a melt flow rate MFR2 (230° C.) in the range of 45 to 75 g/10 min for the preparation of molde articles with low CLTE.
US11053378B2
A polyolefin resin composition includes 15-65% by weight of a polypropylene homopolymer, 5-35% by weight of a polypropylene copolymer, 5-65% by weight of a reinforcing filler, 0.25-5% by weight of a polypropylene compatibilizer, and 1-25% by weight of a surface active agent.
US11053373B2
Polymeric compositions include at least one polymer that is free of ester linkages and an additive that is a benzotriazole phenolate salt with substituents either ortho to the phenol hydroxide group and/or para to the phenol hydroxide group. The substituted benzotriazole phenolate salts can be prepared from substituted benzotriazole phenols. The ortho substituent group can be a simple hydrocarbon, alkoxy, or amino group, or the ortho substituent group can be a linking group, linking the benzotriazole phenolate to another benzotriazole phenolate group.
US11053370B2
Agglomerated superabsorbent polymer particles is provided and obtained by a method including the steps of (a) providing precursor superabsorbent polymer particles having a first mass average particle size 1mAvPS, a first particle diameter “1D10” of not less than 30 μm and a first particle diameter “1D90”, (b) mixing the precursor superabsorbent polymer particles with a solution including polymerizable monomers and/or oligomers, or crosslinkable polymers, and (c) polymerizing the mixed solution if the solution includes polymerizable monomers and/or oligomers or crosslinking the mixed solution if the solution includes crosslinkable polymers. The agglomerated superabsorbent polymer particles have a second particle diameter “2D10” and a second particle diameter “2D90”. The size ratio between the second particle diameter “2D90” and the first particle diameter “1D10” is determined by the following equation: 7 < SizeRatio = D 90 2 D 10 1 < 21 ( I )
US11053369B2
The present invention describes various methods for manufacturing gel composite sheets using segmented fiber or foam reinforcements and gel precursors. Additionally, rigid panels manufactured from the resulting gel composites are also described. The gel composites are relatively flexible enough to be wound and when unwound, can be stretched flat and made into rigid panels using adhesives.
US11053363B2
A random mat material including fiber bundles, said fiber bundles including fibers having an average fiber length of 5 to 100 mm, and having an average number N of fibers in the fiber bundle that satisfies: 1.5 × 10 5 D 2 < N < 4.5 × 10 5 D 2 wherein D is the average diameter of fibers in the fiber bundle, expressed in micrometers, and the standard deviation SDN of the number of fibers in a fiber bundle satisfies: 1,000
US11053361B2
A concentrate carrier system for adding colorants and/or other additives to resin formulations over a broad range of processing temperatures is described. The carrier system includes at least 20 wt. % of a base acrylate copolymer, such as ethyl-methyl acrylate, provided in combination with less than 30 wt. % of polycarpolactone, or a similar ring-opened cyclic ester or ether derivatives. The remainder, which may include an optional organic plasticizer such as epoxidized soybean oil, is dedicated to an additive package that may include colorants, property enhancers, and/or non-property fillers.
US11053357B2
The present invention provides a spherical powder having properties, such as an excellent strength, toughness, and deformation recovery, and provides a method for producing same. The present invention provides: a spherical powder containing a crosslinked body formed having (A) a polyrotaxane in which both ends of a pseudopolyrotaxane, which are formed by inclusion of the opening of a cyclic molecule by threading therethrough with a linear molecule, are provided with a capping group so that dethreading of the linear molecule is prevented, in particular, a spherical powder having an average particle diameter of 0.5 to 1,000 μm, preferably 1 to 500 μm, more preferably 1 to 300 μm, and still more preferably 1 to 150 μm; and a method for producing this spherical powder.
US11053347B2
A curing agent for epoxy resins, containing at least one amine adduct of formula (I) which can be obtained as an addition product of a mixture of a primary diamine, a monoalkylated other diamine and a polyepoxide. The curing agent makes it possible to produce low-odor, low-emission epoxy resin products, in particular coatings, which have a surprisingly low viscosity, a high curing rate, a high final hardness, and a surprisingly appealing surface.
US11053344B2
A hybrid composition includes an isocyanate, a polyester having at least one carbon-carbon double bond and at least one hydroxyl group, castor oil present in an amount of from 5 to 30 weight percent, a catalyst, and a solvent. The hybrid composition can be formed using various methods. The method may include combining the isocyanate and the castor oil to form a first adduct, combining the polyester, the solvent, and the catalyst to form a second adduct, and combining the first adduct and the second adduct. The method may alternatively include combining the castor oil, the solvent, and the polyester to form a third adduct, combining the third adduct with the isocyanate, and combining the catalyst with the third adduct and the isocyanate. The method may alternatively include combining the catalyst and the isocyanate component to form a fourth adduct, and combining the third and fourth adducts.
US11053341B2
A rigid polyurethane foam comprises the reaction product of an isocyanate and a thixotropic composition. The thixotropic composition comprises: a first polyether polyoi which is aromatic amine initiated and has ethylene and propylene oxide end capping; a second polyether polyoi having a viscosity at 25° C. of from about 500 to about 15,000 cps; a third polyether polyoi having a viscosity at 25° C. of from about 18,000 to about 60,000 cps and a functionality of from about 5 to about 7; and a hydrofluoroolefin. The thixotropic composition has a viscosity at 25° C. of from about 350 to about 5,000 cps. A method of forming a composite article comprising a substrate and the rigid polyurethane foam includes the steps of providing the thixotropic composition, providing an isocyanate, combining the thixotropic composition and the isocyanate to form a reaction mixture, and applying the reaction mixture to the substrate to form the composite article.
US11053337B2
The disclosure relates to a thermoset omniphobic composition, which includes a thermoset polymer with first, second, and third backbone segments, first urethane groups linking the first and third backbone segments, and second urethane groups linking the first and second backbone segments. The first, second, and third backbone segments generally correspond to urethane reaction products of polyisocyanate(s), hydroxy-functional hydrophobic polymer(s), and polyol(s), respectively. The thermoset omniphobic composition has favorable omniphobic properties, for example as characterized by water and/or oil contact and/or sliding angles. The thermoset omniphobic composition can be used as a coating on any of a variety of substrates to provide omniphobic properties to a surface of the substrate. Such omniphobic coatings can be scratch-resistant, ink/paint resistant, dirt-repellent, and optically clear. The thermoset omniphobic composition can be applied by different coating methods including cast, spin, roll, spray and dip coating methods.
US11053335B2
Novel methods and materials particularly useful for ophthalmic applications and to methods for making and using the same are disclosed herein. More particularly, relatively soft, optically transparent, foldable, high refractive index materials particularly suited for use in the production of intraocular lenses, contact lenses, and other ocular implants and to methods for manufacturing and implanting IOLs made therefrom are disclosed.
US11053332B2
Embodiments of the invention described herein relate to a polyethylene polymer composition suitable for use in the manufacture of packaging articles, flexible films and/or sheets. In one embodiment, the copolymer comprises a polyethylene resin with density 0.918 g/cm3 to about 0.935 g/cm3, G′ at G″(500 Pa) value, as determined from Dynamic Mechanical Analysis at 190° C., of less than 40 Pa, Mz/Mw of greater than 2, CDBI50 of greater than 60. Other embodiments relate to polymer compositions with defined molecular characteristics and formulations suitable for use in the manufacture of articles including films, sheets, bags and pouches with improved creep resistance and high toughness and a good balance of film stiffness and processability in monolayer and/or multi-layer film structures.
US11053331B2
The present invention relates to a cascade process useful for (fast) ionic polymerisation of liquid monomer(s) containing reaction mixture for the production of the corresponding polymer(s).
US11053324B2
Objects of the present invention are to provide a phosphoric acid-esterified fine cellulose fiber of which slurry shows superior transparency, and to provide a method for producing a phosphorylated fine cellulose fiber showing superior transparency with good efficiency and high yield. According to the present invention, there is provided a phosphoric acid-esterified fine cellulose fiber, of which 0.2 mass % aqueous dispersion shows a solution haze of 15% or lower.
US11053318B2
The present invention provides a bispecific construct comprising a first binding domain specifically binding to CD33 and a second binding domain specifically binding to CD3 for use in a method for the treatment of myeloid leukemia, wherein the construct is administered for a maximal period of 14 days followed by a period of at least 14 days without administration of the construct. Moreover, the invention provides a method for the treatment of myeloid leukemia comprising the administration of a therapeutically efficient amount of such bispecific construct and the use of such bispecific construct for the preparation of a pharmaceutical composition for the treatment of myeloid leukemia.
US11053316B2
The present invention is directed to optimized anti-CD3 variable sequences for use in a variety of bispecific formats, including those that utilize scFv components. The invention further relates to nucleic acids encoding for the polypeptide, to vectors comprising the same and to host cells comprising the vector. In another aspect, the invention provides for a pharmaceutical composition comprising the mentioned polypeptide and medical uses of the polypeptide.
US11053314B2
Described herein is the discovery that cancer stem cells (CSCs) can be induced to differentiate by altering CD47 signaling. Provided herein are methods and compositions for inducing differentiation of cancer stem cells, for instance irreversible differentiation, including methods of treating subjects with cancer such as breast cancer, colon cancer, lung cancer, ovarian cancer, or melanoma, and including metastatic as well as primary cancer. Also provided are methods for treating subjects with triple negative breast cancers involving forcing differentiation of bCSCs of the subjects through targeting of CD47.
US11053313B2
An object of the present invention is to provide a novel molecule which has high specificity to CLDN-5 and recognizes an extracellular domain of CLDN-5. The object is achieved by an antibody which specifically recognizes a three-dimensional structure or a primary structure of an extracellular domain of a Claudin-5 protein.
US11053311B2
The present disclosure provides a human antibody or antigen binding fragment thereof or an antibody construct comprising a human binding domain or antigen binding fragment thereof capable of binding to human CDH19 on the surface of a target cell. The disclosure relates to a nucleic acid sequence encoding the antibody or antigen binding fragment thereof contained in the antibody construct, a vector comprising the nucleic acid sequence and a host cell transformed or transfected with the vector. Furthermore, the disclosure relates to a process for the production of the antibody construct of the disclosure, a medical use or a method of treatment using the antibody construct and a kit comprising the antibody or antigen binding fragment thereof or the antibody construct.
US11053309B2
The present invention provides methods for treating, preventing or reducing the severity of active eosinophilic esophagitis. In certain embodiments, the present invention provides methods of increasing esophageal distensibility. The methods of the present invention comprise administering to a subject in need thereof a therapeutic composition comprising an interleukin-4/interleukin-13 (IL-4/IL-13) pathway inhibitor such as an anti-IL-4R antibody.
US11053307B2
This disclosure provides compositions and methods for controlling pain. In particular the disclosure provides a method for controlling pain comprising co-administration of an NGF antagonist and a TNFα antagonist. The NGF antagonist and the TNFα antagonist can be separate molecules or part of a multifunctional polypeptide, e.g., a multispecific binding molecule that comprises an NGF antagonist domain and a TNFα antagonist domain. This disclosure also provides multifunctional polypeptides, e.g., multispecific binding molecules, comprising an NGF antagonist domain, and a TNFα antagonist domain. The method provides improved pain control. Administration of an NGF antagonist and a TNFα antagonist as provided herein can control pain in the subject more effectively than an equivalent amount of the NGF antagonist or the TNFα antagonist administered alone.
US11053302B2
The present invention relates to single domain antibodies comprising at least one modification relative to the 4D5 antibody scaffold or human germline VH3 domain, the modifications selected from the group consisting of H35D, A78V, S93V, S93G and W103R, with the position numbering being according to the Kabat numbering scheme. Disulfide-free variants further comprise at least one additional modification selected from the group consisting of C22S, A24I, A24L and C92T, and with the proviso that at least one of C22S and C92T is present. Further encompassed are the multi-modular antibody molecules and antibody conjugates comprising single domain antibodies, as well as methods for producing them. The invention in particular provides a library of the single domain antibodies or multi-modular antibody molecules and a method for selecting an antibody that binds an antigen.
US11053297B2
Disclosed herein are methods of increasing numbers of monocytes to a tumor or cancer metastasis site in a subject. Non-limiting embodiments include administering or using a Nur77 polypeptide or subsequence thereof; a Nur77 agonist; a CX3CR1 agonist; CD14+ CD16+ monocytes and/or CD14dimCD16+ (CD115+CD11b+ GR1− (Ly6C−)) monocytes; CD14+ CD16+ monocytes and/or CD14dimCD16+ (CD115+CD11b+GR1− (Ly6C−)) monocytes contacted with a Nur77 agonist or contacted with a CX3CR1 agonist. Also disclosed herein are methods of increasing, stimulating, activating or promoting monocyte migration to or mobilization against a tumor or cancer metastasis in a subject. Non-limiting embodiments include administering a Nur77 polypeptide or subsequence thereof; a Nur77 agonist; a CX3CR1 agonist; CD14+ CD16+ monocytes and/or CD14dimCD16+ (CD115+CD11b+GR1− (Ly6C−)) monocytes; or CD14+ CD16+ monocytes and/or CD14dimCD16+ (CD115+CD11b+GR1− (Ly6C−)) monocytes contacted with a Nur77 agonist or contacted with a CX3CR1 agonist.
US11053293B2
The present disclosure encompasses compositions and methods for targeted cytokine delivery. The compositions disclosed herein comprise a cytokine linked to an NKG2D ligand or PD1 ligand and may improve immunotherapy by limiting side effects associated with immunotherapy. The present disclosure also encompasses compositions and methods for recruiting cytotoxic lymphocytes to target cells using NKG2D receptor ligands or PD1 ligands. The compositions disclosed herein comprise a NKG2D receptor ligand and a targeting molecule and may improve immunotherapy by limiting side effects associated with immunotherapy.
US11053281B2
Disclosed herein are peptoids and related compounds, including peptoid affinity ligands for binding and/or purifying immunoglobulins, immunoglobulin fragments or immunoglobulin fusion proteins thereof. Methods of making peptoid affinity ligands and using the same to bind, purify and/or isolate immunoglobulins and related compounds are also disclosed. Such peptoid affinity ligands comprise a peptoid compound consisting of sequentially coupled peptoid residues forming a peptoid backbone, with one or more functional groups appended to a nitrogen of the peptoid residues of the peptoid backbone configured to provide the desired binding affinity.
US11053280B2
The present disclosure pertains to compositions comprising aflibercept and methods for producing such compositions in chemically defined media and using chromatography to reduce amounts of certain aflibercept variants.
US11053279B2
The present invention relates to a method for site-selective coupling of a first agent to a second agent, comprising the steps of: contacting a first agent comprising at least one furan moiety with an activation signal and with a second agent comprising at least one hydrazine moiety or at least one hydroxylamine moiety, thereby activating said furan moiety to an activated furan moiety; and reacting said activated furan moiety with the hydrazine moiety or the hydroxylamine moiety, thereby site-selectively coupling said first agent to said second agent.
US11053274B2
The present invention relates to a process for the preparation of a compound of formula (I) said process comprising the steps of: a) reacting a compound of formula (II), with an acylating or a silylating agent to produce a compound of formula (III), wherein P1 and P2 are each independently a protecting group selected from R2—Si—R3R4, or R1CO—, wherein R1 is a group selected from C1-6alkyl or C3-6cycloalkyl, each group being optionally substituted by one or more substituents independently selected from fluoro or C1-4alkyl; R2, R3 and R4 are each independently a group selected from C1-6alkyl or phenyl, each group being optionally substituted by one or more substituents independently selected from fluoro or C1-4alkyl; b) reacting the compound of formula (III) in the presence of palladium acetate or a derivative thereof to produce compound of formula (IV); and c) reacting the compound of formula (IV) with a reducing agent to produce compound of formula (I).
US11053269B2
Unsymmetrical metallocene compounds based on cyclopentadienyl ligands are disclosed, as well as catalytic compositions comprising the compounds supported on solid support materials. The compounds and compositions are useful as catalysts in the polymerisation of olefins. In particular, the compounds and compositions are useful catalysts in the preparation of low molecular weight polyethylene (e.g. polyethylene wax) and copolymers formed from the polymerisation of ethylene and other α-olefins.
US11053265B2
An optically active 2,3-bisphosphinopyrazine derivative represented by the following general formula (1): wherein R1 represents a group selected from a branched alkyl group having 3 or more carbon atoms, an adamantyl group, an optionally substituted cycloalkyl group, and an optionally substituted aryl group; R2 represents a group selected from a branched alkyl group having 3 or more carbon atoms, an adamantyl group, and an optionally substituted cycloalkyl group, provided that when R1 is a tert-butyl group, R1 and R2 are not the same; R3 represents a monovalent substituent; n represents an integer of 0 to 4; and * represents an asymmetric center on a phosphorus atom.
US11053263B2
A trichlorogermanide of formula (I): [R4N]/[R4P]Cl[GeCl3] (I), where R is Me, Et, iPr, nBu, or Ph, tris(trichlorosilyl)germanide of formula (II): [R4N]/[RrP][Ge(SiCl3)3] (II), where R is Me, Et, iPr, nBu, or Ph, a tris(trichlorosilyl)germanide adduct of GaCl3 of formula (III): [Ph4P][Ge(SiCl3)3*GaCl3], and a tris(trichlorosilyl)germanide adduct of BBr3 of formula (IV): [Ph4P][Ge(SiCl3)3*BBr3]. Also, methods for preparing the trichlorogermanides of formula (I), the tris(trichlorosilyl)germanide of formula (II), the tris(trichlorosilyl)germanide adduct of BBr3 of formula (IV).
US11053258B2
The disclosure generally relates to compounds of formula I, including their salts, as well as compositions and methods of using the compounds to treat disorders associated with GSK-3.
US11053255B2
Disclosed herein are methods of synthesizing mahanine and related compounds. The synthesis features an intramolecular aryl-alkyne isomerization, transition metal catalyzed cross-coupling and intramolecular carbazole forming reaction.
US11053252B2
Fused cyclic pyrimidine compounds, including tautomers thereof, and pharmaceutically acceptable salts, prodrugs, solvates and hydrates thereof, are disclosed having the general Formula I: These compounds are useful in methods for treating cancer, selectively targeting cancerous cells via the proton coupled folate transporter, folate receptor alpha, and/or folate receptor beta pathways, inhibiting GARFTase in cancerous cells, and selectively targeting activated macrophages in a patient having an autoimmune disease, such as rheumatoid arthritis.
US11053244B1
Disclosed are compounds of Formula (I) N-oxides, or salts thereof, wherein G, A, R1, R5, and n are defined herein. Also disclosed are methods of using such compounds as inhibitors of signaling through Toll-like receptor 7, or 8, or 9, and pharmaceutical compositions comprising such compounds. These compounds are useful in treating inflammatory and autoimmune diseases.
US11053240B2
Described herein are 2-amino-quinoline derivatives that are agonists of toll-like receptors 7 and 8 (TLR7/8), pharmaceutical compositions, and methods of use of the compounds and compositions to treat various diseases, such as viral, cancer, and allergic diseases, in need thereof by administering a therapeutically effective amount of a 2-amino-quinoline derivative.
US11053236B2
Compounds, compositions, and methods for the treatment of infections, inflammation, cancers, tinnitus, Meniere's disease, hearing loss, or bipolar disorder, or for providing cytoprotection against Clostridium difficile toxins, are disclosed.
US11053217B2
The present invention provides: a methyl 1-{2-[(3S,4R)-1-[(3R,4R)-1-cyclopentyl-3-fluoro-4-(4-methoxyphenyl)pyrrolidine-3-carbonyl]-4-(methoxymethyl)pyrrolidin-3-yl]-5-(trifluoromethyl)phenyl}piperidine-4-carboxylate 1/2 ethane-1,2-disulfonic acid which is represented by formula (1) and is excellent in crystallinity; and a method for producing the same; and a production intermediate thereof; and a production method using this compound.
US11053214B2
The present invention provides new pseudo-polymorphs of the hemisuccinate salt of 2,4,6-trifluoro-N-[6-(1-methyl-piperidine-4-carbonyl)-pyridin-2-yl]-benzamide which are useful in pharmaceutical compositions, for example, for the treatment and prevention of migraine headache.
US11053212B2
Compounds of formula (I) and salts thereof: wherein R1, R2, R3, R4 are defined herein. Compounds of formula (I) and salts thereof have been found to inhibit the binding of the BET family of bromodomain proteins to, for example, acetylated lysine residues and thus may have use in therapy, for example in the treatment of autoimmune and inflammatory diseases, such as rheumatoid arthritis; and cancers.
US11053200B2
A method for producing a radiofluorinated compound having an aromatic or heteroaromatic ring carrying [18F] fluorine as first substituent, a bonding unit, which can bind to a peptide or peptide mimetic, and a spacer group connected via bond A1 to the bonding unit and via bond A2 to the ring, wherein the bonding unit has second substituent(s) —OH, —CONH, and/or —COOH. The steps include (a) providing a precursor having the ring carrying a substituent Y, bonding unit with the second substituent(s), and spacer group, wherein substituent Y is —N+(R1R2R3), —NO2, —Cl, —Br, —F, or —I, and R1, R2, and R3 are independently C1-C6 alkyl; and (b) reacting the precursor with a [18F] fluoride anion in the presence of an activation salt to the radiofluorinated compound, which has a cation N+(R4R5R6R7) with R4, R5, R6, and R7 being independently C1-C6 alkyl, wherein the substituent Y is replaced by [18F] fluoride.
US11053186B2
A process for the production of glycolic acid or a derivative thereof comprises: reacting formaldehyde with carbon monoxide and water in a carbonylation reactor in the presence of a sulfur catalyst, said reactor operating under suitable conditions, such that glycolic acid is formed; recovering a first product stream comprising glycolic acid, impurities and a sulfur species in the carbonylation reactor; passing the first product stream to an esterification reactor where it is subjected to esterification to form an alkylglycolate and wherein the esterification is catalysed by the sulfur species recovered in the first product stream; recovering a second product stream comprising the alkylglycolate, sulfur species and impurities from the esterification reactor; separating the sulfur species from the second product stream and recycling it to the carbonylation reactor in step (a) to form a sulphur depleted second product stream; separating the alkylglycolate from the sulphur depleted second product stream in a distillation zone; and recovering the alkylglycolate and converting the alkylglycolate to glycolic acid.
US11053180B2
The method according to this disclosure is a method for separating an unsaturated hydrocarbon having 2 or 3 carbon atoms and a halogenated unsaturated carbon compound formed by replacing at least one of hydrogen atoms included in the unsaturated hydrocarbon with a fluorine atom, from each other and is a method for selectively adsorbing either the unsaturated hydrocarbon or the halogenated unsaturated carbon compound by a porous coordination polymer that includes a metallic ion having a valence of 2 to 4 and an aromatic anion having 1 to 6 aromatic ring(s).
US11053178B2
A multi-stage dehydrogenation process including contacting, in a first stage, a feed stream comprising a hydrocarbon and steam with a dehydrogenation catalyst under dehydrogenation conditions to yield a first stage effluent, heating the first stage effluent, and contacting, in a second stage, the heated first stage effluent with a dehydrogenation catalyst under dehydrogenation conditions to yield a second stage effluent comprising a dehydrogenation product, wherein the first stage includes a first reactor and a second reactor arranged in parallel, and wherein the second stage includes a third reactor connected in series with the first reactor and the second reactor. A multi-stage dehydrogenation system for carrying out dehydrogenation is also provided.
US11053174B2
The present application relates to systems and methods for processing organic material. The methods may include extraction of biochemical nutrients from organic material, such as food scraps. The method can include comminuting the organic material to form a slurry from components comprising liquid and organic material; combining the slurry with microorganisms, such as a yeast, under aerobic conditions to form a mixture of the slurry and yeast; aerating the mixture; and forming a biomass and a nutrient-rich broth, in which the biochemical nutrients are stabilized and anabolized. The systems may, in some embodiments, be configured to perform the methods of processing organic materials.
US11053171B2
Biochars and methods for treating biochars are provided that are useful in various applications, including, but not limited to, applications related to the raising, care, maintenance, disease prevention, disease treatment and odor control of animals.
US11053164B2
A solar control glass article includes a transparent substrate provided with a thin multilayer coating having solar control properties. The thin multilayer coating includes an absorber layer sandwiched between a first and second transparent dielectric layers, a functional layer protected by an upper and lower blocker layers and a third transparent dielectric layer provided over the upper blocker layer. The thickness of the functional layer and the thickness of the transparent dielectric layers are adjusted to give a gold colored reflection on a surface opposite to the first surface of the transparent substrate provided with a thin multilayer coating.
US11053162B2
A method of reworking lithium containing ion exchanged glass articles is provided. The method includes a reverse ion exchange process that returns the glass article to approximately the composition of the glass from which the glass article was produced, before being subjected to ion exchange. The reworked glass articles exhibit a K2O concentration profile comprising a portion wherein a K2O concentration increases to a local K2O concentration maximum.
US11053154B2
An additive manufacturing process includes forming an object material stack using sheet materials without use of binder material between the sheet materials and forming features of the cross-sectional layers of a 3D object in the corresponding sheet materials. Another process involves forming features of the cross-sectional layers of a 3D object in soot layers of a laminated soot sheet. A manufactured article includes three or more glass layers laminated together without any binder material between the glass layers. At least one of the glass layers is composed of silica or doped silica, and at least one feature is formed in at least one of the glass layers.
US11053148B2
A device and method for shortcut nitrogen removal and nitrite-oxidizing bacteria activity inhibition are disclosed herein. An embodiment of the present invention provides a yarn fiber diffuser comprising: a plurality of yarn fibers on which bacteria can be attached and grow; and an inlet capable of supplying gas to one sides of the plurality of yarn fibers, wherein the gas includes oxygen and carbon dioxide, nitrite can be produced by the oxygen, and the concentration of oxygen in the gas is adjusted by the oxygen and the carbon dioxide.
US11053142B2
The exemplary embodiments provides a desalination device comprising an electrochemical cell comprising a porous positive electrode, a porous negative electrode, and a membrane positioned between the porous positive electrode and the porous negative electrode, the electrodes comprising a network of conductive material comprising a plurality of electrode active materials dispersed throughout the conductive material, the porous negative electrode and the porous positive electrode have the same electrode active material, a power supply to supply a current to the electrochemical cell, an inlet for providing a feed stream to the electrochemical cell, a first outlet line for removing a concentrated effluent and a second outlet line for removing a desalinated effluent. Also provided is a desalination device having a plurality of electrochemical channels with alternating anion and cation selective membranes, and a porous negative and positive electrode having the same electrode active material.
US11053140B2
A water disinfection system preferably includes a battery compartment, a control printed circuit board (PCB) to manage several parameters including timing, voltage rate, and user-interface. A high voltage power supply is coupled to a set of electrodes to cause an electric discharge. The electric discharge results in a series of reactions in the water that eliminate bacteria and viruses, dissolves organic material, and oxidizes inorganic compounds.
US11053134B2
Synthesizing lithium lanthanum zirconate includes combining a reagent composition with a salt composition to yield a molten salt reaction medium, wherein the reagent composition comprises a lithium component, a lanthanum component, and zirconium component having a lithium:lanthanum:zirconium molar ratio of about 7:3:2; heating the molten salt reaction medium to yield a reaction product; and washing the reaction product to yield a crystalline powder comprising lithium lanthanum zirconate.
US11053131B2
The invention relates to a process for the preparation of alkali metal cyanides as a solid substance, comprising the steps of: i) an absorption step in the form of an absorption of hydrogen cyanide from a hydrogen cyanide-containing synthesis gas in an aqueous alkali metal hydroxide solution; ii) a crystallization step in the form of introducing said alkali metal cyanide solution into an evaporative crystallizer; iii) a separation step; iv) a recycle step; v) a drying step.
US11053124B2
Disclosed herein is a conductive grease composition that includes a functionalized carbon nanomaterial and/or boron nanomaterial and a base oil. The nanomaterial and base oil forms hydrogen bond network in the disclosed composition. Because of the formed hydrogen bonds, the disclosed grease exhibits enhanced thermal or electrical conductivity. Also disclosed is a method to improve thermal or electrical conductivity of an existing grease composition.
US11053122B2
A continuous combustion production equipment for synthesizing ton-grade fullerenes and a synthetic process therefor. The continuous combustion production equipment is equipped with a gas supply and flow control system, a liquid supply and flow control system, a vaporization and preheating system, a combustion furnace, a combustor, a spray nozzle, an ignition system, a filter tank, a product collection system, a vacuum control system, a vacuum measuring and displaying unit and a circulation water cooling system. Opening the supply line of gas fuels, arranging the tip of a metal electrode of the ignition system near the gas fuel outlet of the combustor, opening the ignition system, igniting the gas with an electric spark to generate a flame; initiating the vacuum pump set; opening the supply line of liquid raw materials, adjusting to a suitable flux with a constant flow pump; adjusting the pressure of the system to keep it below 5000 Pa.
US11053116B2
The present invention discloses a Micro-Electro-Mechanical System (MEMS) acoustic pressure sensor device and a method for making same. The MEMS device includes: a substrate; a fixed electrode provided on the substrate; and a multilayer structure, which includes multiple metal layers and multiple metal plugs, wherein the multiple metal layers are connected by the multiple metal plugs. A cavity is formed between the multilayer structure and the fixed electrode. Each metal layer in the multilayer structure includes multiple metal sections. The multiple metal sections of one metal layer and those of at least another metal layer are staggered to form a substantially blanket surface as viewed from a moving direction of an acoustic wave.
US11053115B2
A transducer modulus, comprising: a substrate; a cap on the substrate, defining a chamber; and a sensor modulus in the chamber, integrating a first MEMS transducer facing the chamber, and a second MEMS transducer facing the supporting substrate. The cap has a first opening that forms a path for access of the first environmental quantity exclusively towards a sensitive element of the first transducer, and the supporting substrate has a second opening that forms a path for access of the second environmental quantity exclusively towards a sensitive element of the second transducer.
US11053104B2
A boom for a pipelaying machine includes a pair of posts located in a first plane and disposed in a tapered configuration with respect to a second plane transverse to the first plane. The boom also includes a cross-brace disposed between the pair of posts and located partway along a length of the pair of posts. The cross-brace includes a first link member and a second link member disposed along the first plane. Further, each of the first and second link members are angularly offset from each other and the second plane respectively. Furthermore, ends of the first and second link members are rigidly attached to the pair of posts. The cross-brace further includes a first rib member and a second rib member disposed along the second plane and rigidly attached to the first link member and the second link member respectively.
US11053093B2
Disclosed is a wind-up system and a method for winding-up a strip. The wind-up system includes a first work station and a first supply member for supplying the strip to said first work station. The first work station includes a first collection area for holding a first collection reel to collect and wind-up the strip; a first liner area for holding a first liner reel to unwind a liner, and a first guide area extending from the first liner area into the first collection area, wherein the unwound liner is unwound from the first liner reel through the first guide area onto the first collection reel. The wind-up system further includes a pick-and-place member for picking-up a leading end from the first supply member and for placing the picked-up leading end of the strip onto the liner within the first guide area.
US11053089B2
A printing apparatus includes a conveyance unit configured to convey a tray on which a printing medium is placed, a printing unit configured to perform printing on a print surface of a printing medium on the tray based on a print job, and a first detection unit configured to detect a relative position relationship between the tray and a printing medium placed on the tray. In addition, a control unit is configured to control the printing unit not to perform printing in a case where the first detection unit detects that the printing medium is not placed at an appropriate position, and a selecting unit is configured to select whether to continue printing irrespective of results of the detection by the first detection unit.
US11053087B2
The present invention related to a method and a device for removing food products from a belt conveyor, comprising a belt conveyor comprising two ends, an endless belt and a drive, for transporting food products on the endless belt from a feed location towards a discharge location, wherein the endless belt comprises a transporting side and a returning side; a removing device for removing food products from the endless belt, comprising: a roller, facing the returning side of the endless belt, wherein the roller is arranged at a predetermined distance from the endless belt; and a frame part, for holding the roller at the predetermined distance; wherein the endless belt is configured to rotate in a first direction and wherein the roller is configured to rotate in the same direction as the endless belt.
US11053076B1
Technology for optimizing carton induction in an order fulfillment picking system is described. In an example embodiment, a method, implemented using one or more computing devices, may include receiving scan data reflecting status of cartons being conveyed by a conveying system, receiving confirmatory input reflecting pick completion for a subset of the cartons being conveyed by the conveying system, and generating an estimated time of arrival for one or more cartons not yet inducted into the conveying system based on the scan data and the confirmatory input. The method may further include generating a load forecast based on the estimated time of arrival and inducting one or more of the one or more cartons into the conveying system based on the load forecast.
US11053073B2
A storage system is described where goods are stored in containers and the containers are stored in stacks. Above the stacks runs a grid network of tracks on which load handling devices run. The load handling devices take containers from the stacks and deposit then at alternative locations in the stacks or deposit then at stations where goods may be picked out. The framework may be provided with one or more of the following services: power, power control, heating, lighting, cooling, sensing, and data logging. A method of partitioning the storage system prevents the spread of fire or prevent damage caused by sprinkler activation.
US11053071B2
A trash container lid locking apparatus comprises a pivot device including a mounting plate configured to be secured to a side edge of a trash container close to a front of the container, a pivot arm having a first end pivotally coupled to the mounting plate and a second end, the second end having an attachment portion to couple to an elongated bar which is longer than the front of the trash container, the pivot arm including a hole therein, and a housing including a rotating lock mechanism having a movable element that is operable by the rotating lock mechanism into and out of the hole of the pivot arm to lock and unlock the pivot arm and bar with respect to the hinged container lid of the trash container.
US11053069B2
The invention relates to a capsule (10) designed for food or beverage preparation, the capsule (10) comprising a cup-shaped base body (1), a top wall (2) and a bottom retaining wall (3) for holding food or beverage preparation ingredients, wherein the base body (1) is made of one single injection-molded piece and wherein a side wall (4) of the base body comprises at least one co-injected multilayer section (5) having two outer layers (5a) being made from a different polymeric material than a core layer (5b), and wherein the base body (1) further comprises a bottom structure (6) which is integrally molded with the side wall (4) and comprising opening means (7) allowing the capsule to be opened at the time of its use.
US11053066B2
A syringe propellable by propellant that boils at a predetermined temperature, the syringe including a barrel having an outlet at a front end, and a stopper axially moveable in the barrel. The stopper separates a first chamber and a second chamber, the first chamber being axially forwards of the stopper and being configured for containing a medicament, and the second chamber being axially rearwards of the stopper and being configured to receive propellant for acting on the stopper to move the stopper axially forwardly in the barrel to expel medicament through the outlet upon actuation of the syringe. The syringe further includes a third chamber for containing propellant. Upon actuation of the syringe, liquid propellant is released from the third chamber and boils outside of the third chamber at or above the predetermined temperature to provide an increasing vapor pressure in the second chamber that causes the stopper to move axially forwardly and begin to expel medicament through the outlet. At least one trigger for triggering an action is provided, the trigger activated in response to the pressure in the second chamber satisfying a predetermined condition.
US11053065B2
A dispensing assembly, including a case including at least one aperture, a drive gear operatively arranged to engage the case, a tablet disc rotatably arranged in the case and including a plurality of compartments, and an electronics assembly, including a motor engaged with the drive gear, and a housing operatively arranged to engage the tablet disc, wherein the motor is arranged to rotate the electronics assembly and the tablet disc with respect to the case to align the plurality of compartments with the at least one aperture.
US11053063B2
The invention comprises a dispensing device having an elongated body, a sidewall which is elliptical in at least a portion of its cross-section, an open top end, and a dispensing bottom end. The device comprises a ratchet, ratchet support member, dial, telescoping members, and an elliptical plunger. The ratchet support member and dial each engage the ratchet to allow movement in certain directions and prevent movement in other directions, beyond a certain point. A first telescoping member having the smallest diameter is affixed to the ratchet. The interior diameter of a second telescoping member is larger than the exterior diameter of the first telescoping member, such that the first telescoping member is configured to nest within the interior of the second telescoping member. The first telescoping member may be extended a distance through the dispenser body via rotation of the ratchet. The plunger is affixed to the telescoping member having the largest diameter.
US11053060B2
A substantially moisture tight container and lid assembly for storing and packaging moisture-sensitive items comprising an assembly with a container and a lid, the lid is attached by a hinge to an upper housing portion of the container, the lid includes a lip seal member that depends downwardly from the lid, the lip seal member is configured to abut at least a portion of the interior side of the container when the lid is in the closed position resulting in a substantially moisture tight seal between the lid and the lid, and the container assembly further comprising a base portion and an upper housing portion, the upper housing portion is capable of being snap-fit into the base portion by employing a lip seal mechanism to form a substantially moisture-tight seal.
US11053059B2
The present application discloses a vacuum sealed container, including a container body, a container lid, a vacuum generator, at least one magnifier and an indicator. The container body includes a first wall and a bottom surface, wherein the first wall and the bottom surface define an accommodation space. The container lid is coupleable to the container body. The vacuum generator is coupled to the container lid to evacuate fluid from the accommodation space. The at least one magnifier is coupled to the container body. The indicator is coupled to the container. A method for using the aforementioned vacuum sealed container is also disclosed.
US11053049B1
A size adjustable box is disclosed herein. The size adjustable box includes a plurality of box sections slidably adjustable relative to one another, the plurality of box sections configured to collectively define a box interior and an upper box rim; and a plurality of lid sections slidably adjustable relative to one another, the plurality of lid sections configured to be received on the upper box rim so as to generally enclose the box interior. The slidable adjustability of the plurality of box sections and the plurality of lid sections allows a user to adjust an overall size of the box.
US11053043B2
The present invention relates to a method and an arrangement for emptying a flexible container (30) of bag contents (31) therein. Such a flexible container includes a bottom opening (34) in its lower end and a top opening (37) in its upper end. When this container is to be emptied of its contents, it is placed in an emptying arrangement in such a way that the container's bottom opening lies below the top opening. The flexible container is then turned around an axis of rotation that unites said bottom opening and top opening. The turning motion produced is gradually propagated from the container's upper end towards its lower end whereby the container is twisted into a tight string (32). This twisting contributes to removing the bag contents (31) from the flexible container via the bottom opening (34) provided or made therein.
US11053041B2
An automatic packing device (1) for cushioning element (s) (2) in a carton (C) is mounted along a conveyor (4) directed along a longitudinal axis (Y, Y′). The packing device (1) includes a robotic cell (3) associated with a cushioning element storage zone (2), the robotic cell (3) including at least one gripping device fo a cushioning element (2). The storage zone includes at least one magazine (18) with at least one cassette (8) movable along a transverse axis (X, X′) from a loading position to an unloading position.
US11053036B2
A process and apparatus can be used to vacuum skin package a product arranged on a support comprising providing a film portion above said support with the product being arranged between the support and the film portion; air tightly fixing the film portion to the support; removing at least a portion of air from a volume underneath said film portion through said at one nozzle inserted in an interspace between the film portion and the support.
US11053032B1
A lidding station for containers, including a conveyor structured and arranged for moving unrestrained containers in a conveyance direction; a lid infeed chute above said conveyor; and first, second and third compression rollers positioned above said conveyor and downstream of said lid infeed chute, and methods for affixing lids to containers.
US11053029B1
A modular spacecraft is provided. The modular spacecraft includes a bus module and a payload module. The bus module provides additional thermal radiative capacity for the payload module by including a bus-panel payload thermal zone that couples operational components of the payload module to a radiator panel in the bus module. The bus module also includes its own operational components that are thermally coupled to the radiator panel but that are thermally isolated from the payload module and the bus-panel payload thermal zone.
US11053021B2
An unmanned aerial vehicle (UAV) has: a body for carrying an article; at least one rotor; and a light source for generating a light beam to indicate the landing zone for the UAV. The UAV, in use, is flown to a desired location, that might be a site of an emergency with no defined landing zone. The UAV descends, and, while descending the light source is operated to illuminate and to define a landing zone. The UAV can be provided with lights and an audio source to warn and advise bystanders that the UAV is landing and to stand clear of the landing zone.
US11053018B2
An inlet for a flight vehicle engine, such as for a supersonic or hypersonic engine, includes an internal flow diverter to divert boundary layer flow. The flow diverter is configured to minimize disruption to flow outside the diverted boundary by being configured through use of a flow field that is also used to configure the walls of the inlet. The flow field that is used to configure an inlet-creating shape and a diverter-creating shape has the same flow generator, contraction ratio, compression ratio, mass capture ratio, pressure ratio between entrance and exit, and/or Mach number, for example. The internal diverter may be configured so as to allow arbitrary selection of a leading edge shape for the internal diverter, for example to use a shape that helps avoid radar detection.
US11053011B2
Ice detection systems for aircraft and related methods are disclosed. A disclosed example ice detection system includes a thermochromic device to sense a temperature of freestream air relative to a temperature threshold, and a hydrochromic device to sense an amount of moisture in the freestream air relative to a moisture threshold. A controller to detect an icing condition in response to the thermochromic device sensing a temperature that is less than or equal to the temperature threshold and the hydrochromic device sensing an amount moisture that exceeds the moisture threshold.
US11052994B2
A turbine engine module including an upstream propulsive unit including a propellers doublet that are upstream and downstream, respectively mounted around an axis, a power turbine shaft with axis of rotation intended for rotating the propellers doublet, a speed reducer connected to the propellers doublet and driven by the shaft, and, a pitch-changing system including a cylinder that controls the pitch of the blades of the upstream propeller the rotational axis of the propellers doublet is shifted in relation to that of the shaft. The cylinder is placed downstream of the reducer, and the pitch-changing system includes a shaft for controlling the pitch of the blades that connect the cylinder to the blades of the upstream propeller.
US11052986B2
An aeronautical glazing unit includes at least one sheet of modified acrylic, wherein the sheet is combined with at least one other sheet of modified acrylic, and/or at least one sheet of cast poly(methyl methacrylate) (PMMA), and/or at least one sheet of another transparent polymer such as polycarbonate (PC), and/or at least one sheet of glass in particular that is chemically strengthened, as a laminated and/or multiple glazing unit.
US11052980B2
An underarm float for infants, comprising a main body, the main body is composed of a front part and rear parts, which are connected to each other, wherein rear parts are connected to both ends of the front part, and rear parts at the two ends of front part are oppositely arranged; a first arc groove and second arc grooves are formed at the joint between front part and a rear part, first arc groove is downwards recessed along the upper surface of the front part and the rear part, and the second arc grooves are inwards recessed along the side surface of the front part and the rear part; a shoulder strap is arranged at the joint between the front part and the rear part, and the shoulder strap is located above the first arc groove; and the oppositely arranged rear parts are provided with an elastic cord.
US11052977B2
A tubular installation apparatus (1) including a lay tower (2) mounted to a support structure (4). The lay tower (2) is configured to lower a tubular section along a firing line (L) extending along the lay tower (2). A magazine (3) is removably mounted to the lay tower (2) and configured to be pre-loaded with a plurality of tubular sections. A feed mechanism (23, 25) is configured to feed one or more tubular sections from the magazine (3) to the firing line (L) of the lay tower (2) for connection to the end of a catenary.
US11052968B2
An electric bicycle comprises a removable battery pack (1) for storing electrical energy, and a frame element (5) to which the battery pack (1) is intended to be fixed. The battery pack comprises a housing and a lock arranged in said housing and the frame element (5) comprises a projecting locking element (21), said locking element (21) penetrating into the housing of the battery pack (1) through an entry opening so as to co-operate with said lock with a view to fixing said battery pack (1) to said frame element (5).
US11052963B2
A throttle tube assembly including a throttle tube, a throttle body, a bearing, and a stop collar. The throttle tube extends along a central axis from a proximal most end to a distal most end, the throttle including a lumen extending through the throttle tube. The throttle body is connected to the throttle tube, at the proximal end of the throttle tube, the throttle body having a bearing seat aligned along the central axis with the throttle body. The bearing being disposed in the bearing seat and axially aligned with the throttle body and partially axially aligned with the throttle tube. The stop collar is fixed to the throttle body configured and arranged to actuate a throttle by wire system.
US11052955B2
A spare wheel catcher in a vehicle comprises a base adapted to be connected on a rear differential and a catcher plate. The base includes a support extending along a longitudinal direction of the vehicle at an assembled position and a connection member; and the catcher plate is connected with a first end of the support and forms an obtuse angle with a forward moving direction of the vehicle.
US11052949B2
Provided is a rear vehicle body structure that includes: a right and left pair of frame members each extending in a front-rear direction and having a damper supporting part; rear wheel wells; a rear floor panel; a rear cross member upper part connecting the right and left pair of frame members to each other on a front side of the damper supporting parts; front side reinforcements provided along a vehicle cabin inner side of each of the rear wheel wells and extending in an up-down direction on the front side of the damper supporting parts; and a reinforcing member mounted on each of the frame members and having a reinforcing member main body that reinforces the damper supporting part and a reinforcing member coupling part that couples together the rear cross member upper part and the front side reinforcement.
US11052935B2
A motor-adjustable steering column for a vehicle includes a supporting unit attachable to a vehicle body and by which there is held an adjusting unit in which a steering spindle is mounted so as to be rotatable about a longitudinal axis. An adjustment drive is connected to the supporting unit and to the adjusting unit and is adjustable relative to the supporting unit. The adjustment drive includes a drive unit and a threaded spindle which engages in a spindle nut and which has a threaded spindle axis. The threaded spindle and the spindle nut can be driven to rotate relative to one another about the threaded spindle axis by the drive unit. To prevent slipping or spinning of the spindle drive in a crash situation the adjustment drive includes a blocking device which can be brought into a blocking position for blocking the threaded spindle relative to the spindle nut.
US11052922B2
An information processing apparatus is provided with a controller comprising at least one processor. The controller is configured to execute: displaying presentation information to be presented to a user of a vehicle at an inside or an outside of a window formed in a vehicle; switching over between displaying and non-displaying of the presentation information displayed at the inside of the window according to an instruction received from the user; and displaying the presentation information at the outside of the window in cases where the vehicle is located in a specific place.
US11052915B2
A sobriety ignition interlock system including an engine control device and a method for managing available vehicle engine power using the sobriety ignition interlock system. The engine control device includes an engine control processor (ECP) that is electronically connected in between an engine control unit (ECU), an engine sensor assembly, and a sobriety processor. The sobriety processor determines a sobriety level of a vehicle driver and sends a corresponding sobriety signal to the ECP. The ECP intercepts an engine signal transmitted from the engine sensor assembly to the ECU and manipulates the engine signal according to the sobriety signal, in order to manage the available power of the vehicle engine.
US11052911B2
The speed control device is equipped with: an actual speed acquisition unit; an actual position acquisition unit; an acceleration/deceleration control unit; and a travel resistance calculation unit. When in a situation in which an target speed increases from a first target speed to a second target speed, the target speed in the second road section is set such that an actual speed increases with a first-order lag from the first target speed to the second target speed over a period between the start position and end position of the second road section, and the target speed in the second road section is set such that the amount of change in the speed, which increases with the first-order lag, with respect to the travel time of the vehicle is decreased as the travel resistance calculated by the travel resistance calculation unit increases.
US11052898B2
Systems and methods for operating a vehicle that includes an engine that may be automatically stopped and started are described. In one example, a requested driver demand power may be filtered via a first order low pass filter in response to a powertrain speed. The filtered requested driver demand power may be a basis for automatically stopping and starting an engine.
US11052892B2
An electronically controllable pneumatic brake system. The brake system includes at least two brake circuits, wherein a first of the at least two brake circuits is allocated an electrically and pneumatically controllable control valve and a second of the at least two brake circuits is allocated an electrically controllable parking brake valve in order to predetermine braking pressures so as to actuate wheel brakes of the respective brake circuit. The brake system further includes a first control unit configured to electrically actuate the electrically and pneumatically controllable control valve in dependence upon a vehicle desired deceleration and a second control unit configured to electrically control the parking brake valve in dependence upon the vehicle desired deceleration that is requested in an automated manner. In addition, the brake system includes at least one bypass valve to which a control valve is allocated.
US11052887B2
An electric component assembly includes a housing with which an electric component is fitted, and the electric component and the housing are fixed to one surface of a base body. The electric component includes a connection terminal press-fitted to a through-hole (201a) of a board provided in the housing, and an insertion direction of the connection terminal into the through-hole is a fitting direction of the electric component with the housing. The electric component assembly includes a rib which is protrudingly provided on either one of an outer surface of the electric component intersecting the fitting direction and an inner surface of the housing facing the outer surface, and a groove portion which is provided as a recess on another one of the surfaces and the rib is inserted into; and a protrusion that abuts onto the rib is provided on an inner surface of the groove portion.
US11052885B2
A system and a method for estimating the coefficient of friction of a hydraulic brake system with axle-individual pressure buildup of a motor vehicle. In addition, a system and to a method for setting the target braking torque of a hydraulic braking system with axle-individual buildup of a motor vehicle in order to obtain a desired actual braking torque.
US11052883B2
Driving support ECU transmits a communication connection request to a help net center HNC when a driver of a vehicle has been determined to be in an abnormal state where the driver loses an ability to drive the vehicle, and when the communication connection to the help net center HNC has been established, the driving support ECU transmits the help signal (the positional information of the vehicle) and decelerates the vehicle at a constant deceleration to make the vehicle stop. On the other hand, when the communication connection to the help net center HNC has not been established, the driving support ECU makes the vehicle travel at a constant speed. Accordingly, it is possible to make the vehicle stop under a situation where the help net center HNC recognizes the vehicle position inside which the driver who has been determined to be in the abnormal state is.
US11052870B2
A switch assembly for a vehicle seat belt buckle comprising a switch housing defining an interior and a pocket, a cable extending into the interior and including hook-shaped ends extending around posts in the interior of the switch housing. In one embodiment, the interior of the switch housing includes first and second posts positioned in a co-linear and spaced apart relationship and the hook-shaped ends face each other and extend around the first posts and abut against the second posts. In one embodiment, the Hall Effect sensor is positioned in the pocket of the switch housing in an inclined relationship.
US11052869B2
A seatbelt ignition interlock system. The system includes a plurality of sensor devices each including a housing, a latch configured to removably engage the latch receiver of a vehicle seatbelt system, a latch receiver configured to receive and removably engage the latch of the vehicle seatbelt system, a latch sensor, a temperature sensor, and a power source. Each sensor device is in electrical communication with a vehicle ignition interlock circuit, and the vehicle ignition interlock circuit is in electrical communication with an ignition of a vehicle. The vehicle ignition interlock circuit is configured to prevent the vehicle ignition from being started when a combination of temperature sensors and latch sensors determine that occupied seats have unfastened seatbelts.
US11052862B2
Provided is an air bag base cloth constituted by a composite material obtained by coating fabric made of synthetic fibers with a synthetic resin. The average value of the 100% modulus in the warp direction of the fabric texture included in the composite material and the 100% modulus in the weft direction of the fabric texture included in the composite material is 50 N/cm or less. The 100% elongation recovery rate is 95% or more. The 100% elongation load air permeability is 0.1 L/cm2·min or less both before and after thermal treatment at 100° C.
US11052857B2
An assembly includes a belt and one of a buckle or a clip. The belt has a first inflatable portion inflatable to an inflated position, a second inflatable portion inflatable to an inflated position, and an intermediate portion between the first inflatable portion and the second inflatable portion. The intermediate portion includes a fluid channel connecting the first inflatable portion to the second inflatable portion. One of the buckle or the clip is slidably attached to the intermediate portion.
US11052851B1
Developing intelligent systems which take into consideration the economical, environmental, and safety factors of the modern society, is one of the main challenges of this century. Progress in the fields of mobile robots, control architectures, artificial intelligence, advanced technologies, and computer vision allows us to now envisage a smart environment future. The rise of the connected objects known as the “Internet of Things” (IoT) will rival past technological marvels. This application discloses a time synchronous communication IoT network and IoT ranging device to monitor a smart environment. IoT ranging device uses a time of day (TOD), an absolute time, and a time slot assigned to it by IoT network for ranging in the smart environment in order to avoid interference and collision.
US11052849B2
A vehicle member comprises a wooden member and a resin cover member integrally covering the wooden member. The vehicle member absorbs or transmits a received load. The cover member integrally includes a load acting portion and an attaching portion. The wooden member is positioned in the vehicle member so that a shaft center direction of annual rings is aligned with an input direction of the load. The attaching portion is attachable to an attached member of a vehicle.
US11052839B2
A binding structure of wire routing materials are formed by: elongated wire routing materials; a binding member for binding the wire routing materials; and an engaging member including a movable body portion including an engaging portion for assembly into a vehicle body, and a bound portion to be bound and held together with the wire routing materials by the binding member. The bound portion includes a main portion facing the wire routing materials, and a leg portion extending from the main portion and being in contact with the wire routing materials. The movable body portion includes a sliding portion disposed such that sliding thereof is allowed on the wire routing materials in a gap.
US11052834B2
A method for providing image processing for a plurality of vehicular driving assist systems includes mounting a camera module at a portion of an in-cabin side of a windshield of a vehicle. The camera module houses a camera, a circuit board, at least one electrical connector and an image processor. The camera is electrically connected to circuitry of the circuit board via a flexible electrical connection. With the camera module mounted at the vehicle windshield, electrical power is provided to the camera via the flexible electrical connection, the camera is controlled via the circuitry, the camera is operated to capture image data, which is provided to the circuitry via the flexible electrical connection and is received at the circuitry. The image processor processes the image data received at the circuitry of the circuit board for the plurality of driving assist systems of the vehicle.
US11052829B2
An accessory arm for a lift truck includes at least one rear attachment mechanism affixed to a rear overhead guard leg of the lift truck and a front attachment mechanism affixed to a front overhead guard leg of the lift truck. The accessory arm further includes an accessory bar rotationally mounted to the at least one rear attachment mechanism and to engage with the front attachment mechanism when the accessory bar is in a closed position. A wiring harness connected to a battery of the lift truck and routed within the accessory bar to a device mounted to the accessory bar, the wiring harness to provide power to the device.
US11052828B2
A rack for a truck includes a rail system having a first rail and a second rail each having a first end and a second end. The second rail is configured to be spaced apart from and positioned parallel to the first rail. A first support structure and a second support structure each have a first end and a second end and a cross member having a first end and a second end configured to laterally extend between said first rail and said second rail. The first support structure and the second support structure are configured to engage with said rail system. At least the first support structure is configured to be slidably positioned within the rail system such that the first support structure abuts the second support structure in a closed or unloaded configuration and is separated from the second support structure in an open or loaded configuration.
US11052823B2
A vehicle rear monitoring system includes a camera that captures an image of an area to a rear of a vehicle, and a processing unit that processes the image captured by the camera. The processing unit creates a first vehicle rear image that is displayed in a first display area that is a portion of a display area of a display device, when traveling forward, and creates a second vehicle rear image that is displayed in a second display area that is within the display area of the display device and that is an area that includes the first display area and is larger than the first display area, when traveling backward.
US11052821B2
Specifically programmed, integrated motor vehicle dangerous driving warning and control system and methods comprising at least one specialized communication computer machine including electronic artificial intelligence expert system decision making capability further comprising one or more motor vehicle electronic sensors for monitoring the motor vehicle and for monitoring activities of the driver and/or passengers including activities related to the use of cellular telephones and/or other wireless communication devices and further comprising electronic communications transceiver assemblies for communications with external sensor networks for monitoring dangerous driving situations, weather conditions, roadway conditions, pedestrian congestion and motor vehicle traffic congestion conditions to derive warning and/or control signals for warning the driver of dangerous driving situations and/or for controlling the motor vehicle driver use of a cellular telephone and/or other wireless communication devices.
US11052805B2
A console bin assembly for a vehicle includes a bin surface having a perimeter and a wall extending upward relative to the bin surface. A channel having a first end and a second end is located adjacent to the perimeter of the bin surface and the first wall. A drainage hole located near the first end of the channel. The channel is sloped such that the channel guides liquid entering the channel to the drainage hole.
US11052798B2
An air supply device and a method of operating same are provided for a vehicle seat having an air discharge opening provided in the upper region of the vehicle seat, via which opening a head, shoulder, and neck region of the seat occupant can be supplied with an airflow. The airflow is adjustable by a control unit for controlling or regulating a fan rotational speed of a blower and can be heated via a heating element. The control unit is supplied at least one activation signal for activating the air supply device and a temperature signal that provides information about the interior temperature. The control unit activates the heating element and the blower according to the activation signal and then controls at least the blower as a function of the interior temperature.
US11052797B2
A recliner heart includes a housing member, a locking plate and a pawl. The housing member includes a plate surface having a first recess and a second recess. The locking plate includes a surface having teeth formed thereon. The pawl is movable in the first recess between a secure position in which the pawl is engaged with the teeth of the locking plate and a release position in which the pawl is disengaged from the teeth of the locking plate. The pawl includes a boss slidably received in the second recess. A first lateral side of the boss abuts against a sidewall of the second recess upon an impact event.
US11052788B2
A longitudinal adjuster may have a first transverse locking bar accommodated in a slot of a first seat rail. A spindle may be guided through an opening of the first transverse bar in a contact-free manner. At a distance from the first transverse locking bar toward the front, a shoulder of the spindle is arranged. In reaction to a specified action of force, the first transverse locking bar is clamped between the first seat rail and the shoulder. As a result, a force from the first seat rail via the first transverse locking bar, the shoulder, the spindle, and the spindle nut can be diverted to the second seat rail.
US11052782B1
A charging system for a vehicle is provided. The charging system is for charging an energy storage system of the vehicle using grid power. The grid power may be an external three-phase AC. The charging system may use field weakening techniques to reduce a peak line-line voltage detected at input terminals of conversion circuitry when a need is determined.
US11052780B2
The vehicle dispatching system accepts a dispatch request from a user, selects an autonomous vehicle matching with the dispatch request from among a plurality of autonomous vehicles, and dispatches a selected autonomous vehicle to the user. The plurality of autonomous vehicles include a plurality of battery-mounted vehicles having an in-vehicle battery capable of being charged externally as an energy source. Each of the plurality of battery-mounted vehicles performs charging at a charging station when a charging level of the in-vehicle battery decreases. The vehicle dispatching system comprises a management server including a processor for executing programs stored in memory, the management server programmed to act as a charging planning unit that changes an upper limit charging level of the in-vehicle battery when charging at the charging station according to a time slot.
US11052774B2
A rail transit braking energy recovery system. The rail transit braking energy recovery system comprises a braking motor, a fuel battery, an electrolytic bath, and a hydrogen tank. The braking motor is used for converting braking energy of the rail transit into electric energy. An output end of the braking motor is connected to a power input end of the electrolytic bath. The electrolytic bath comprises a hydrogen output end and an oxygen output end, the hydrogen output end is connected to the hydrogen tank, and the hydrogen tank is connected to the fuel battery and is used for supplying hydrogen to the fuel battery. In the system, only the electrolytic bath is structurally added, and the existing vehicle-mounted hydrogen tank is directly used for storing hydrogen, therefore the structure is simple, the self weight of the vehicle body is reduced, the energy conversion efficiency is high, and at the same time, the injection of hydrogen is reduced and the operation cost is reduced. In addition, the purity of the hydrogen obtained by means of electrolysis is high, so that the hydrogen can be directly supplied to the fuel battery to be used without being processed. Also provided is a hybrid power rail transit system.
US11052772B2
Techniques are described for implementing automated control systems that manipulate operations of specified target systems, such as by modifying or otherwise manipulating inputs or other control elements of the target system that affect its operation (e.g., affect output of the target system). An automated control system may in some situations have a distributed architecture with multiple decision modules that each controls a portion of a target system, and may further have one or more components that interacts with one or more users to obtain a description of the target system, including restrictions related to the various elements of the target system, and one or more goals to be achieved during control of the target system. The component(s) then perform various automated actions to generate, test and deploy one or more executable decision modules to use in performing the control of the target system based on the user-specified information.
US11052765B2
A first and a second control device capable of transmitting and receiving signals to and from a third control device that performs an overall management to the control devices. The third device transmits a command signal to the second device in response to a reception signal from the first device. The first device transmits, to the second device and the third device, an electrical power storage unit signal includes at least one of control information and abnormality information about charging/discharging. The second device includes a function of controlling actuation of a rotating electrical machine on the basis of an actuation command signal about actuation of the rotating electrical machine transmitted from the third device in response to the electrical power storage unit signal, and a function of controlling actuation of the rotating electrical machine on the basis of the electrical power storage unit signal transmitted from the first device.
US11052760B2
A vehicle control device incorporating a plurality of vehicle control elements, at least one control apparatus to alter a functionality of the vehicle control elements, each of the vehicle control elements adapted in use to control a valve in a hydraulic line, in which each vehicle control element incorporates a vehicle control display element, the vehicle control display element indicating whether the functionality of the vehicle control element may be altered. This allows a driver when looking at the vehicle control element easily to see from the vehicle control display element whether the functionality of the vehicle control element may be changed.
US11052756B2
A drive device for a motor vehicle includes an electrical machine which is operatively connected to a transmission device via a drive shaft. The transmission device has at least a first and a second planetary stage and a differential stage. Each planetary stage includes a planet set having a plurality of planet gears, the planet gears being rotatably arranged on a planet carrier and meshing with a sun gear and with a ring gear. The second ring gear has external teeth which mesh with internal teeth of a ring gear cup fixed to a housing in a stationary manner.
US11052755B2
A capless fuel door assembly including a body pivotally supported within a housing of the vehicle between closed and opened positions. The body includes an exterior projection exhibiting an angled slide. A spring is secured to the housing and includes an extended portion supported against an end stop location of the projection defining a first end of said angled slide in order to exert the body in the closed position, with opening of the body about the pivot causing a decrease in the closing force as the spring portion displaces along said angled slide to a second end to achieve the opened position.
US11052753B2
A dual-fuel tank houses one or more compressed natural gas (CNG) vessels and one or more diesel fuel vessels. The diesel fuel vessels are generally disposed laterally outwardly from the CNG vessels to provide a buffer that protects the CNG vessels from side impacts. The dual-fuel tank may be retrofit onto a diesel locomotive in place of the locomotive's diesel fuel tank to convert the locomotive into a dual-fuel locomotive. The dual-fuel tank may be provided in a ship.
US11052752B2
A cooling apparatus for cooling compressed air produced by a compressor of a supercharger includes an air-cooled intercooler through which the compressed air flows, a grille shutter capable of blocking a flow of wind toward the intercooler, and a controller. The controller performs control processing to close the grille shutter when an ambient temperature around the intercooler is lower than or equal to zero degrees centigrade and a pressure value of the compressed air is lower than a predetermined pressure value at which condensate water generated within the intercooler is maintained in an unfrozen state at the ambient temperature lower than or equal to zero degrees centigrade, or otherwise performs control processing to open the grille shutter.
US11052746B2
A vehicle drive assembly with transverse dual-power-source, comprising two power sources and an automatic transmission. The automatic transmission has a first input shaft and a second input shaft, and the two power sources are respectively connected to the two input shafts; a first intermediate shaft is provided parallel to the first input shaft, a second intermediate shaft is provided coaxial with the first input shaft, a third intermediate shaft is provided coaxial with the first intermediate shaft, and a first gear and a second gear on the first intermediate shaft are in engaged transmission; a third gear shaft and a fourth gear on the second intermediate shaft are in engaged transmission; and a fifth gear and a sixth gear on the third intermediate shaft are in engaged transmission, and the sixth gear is simultaneously in engaged transmission with a seventh gear on a differential.
US11052744B2
A transmission having a main transmission and a splitter group, and including at least four spur gear planes formed with a countershaft and at least five shifting elements for engaging at least six gears between the transmission input and output shafts. When shifting between gears with the highest and the second-highest gear ratios, a shift occurs in the shifting elements associated with the splitter group but not in the shifting elements associated with the main transmission, whereas when shifting between gears with the lowest and second-lowest gear ratios, a shift occurs in the shifting elements associated with the main transmission but not in the shifting elements associated with the splitter group. An electric machine can be connected by a gearset, and depending on its shift position, the gearset acts as a pre-transmission ratio for the electric machine or as a superimposition transmission.
US11052743B2
A method according to an exemplary aspect of the present disclosure includes, among other things, periodically adjusting powertrain operation of an electrified vehicle equipped with an internal combustion engine to progressively influence oil quality of oil of the internal combustion engine.
US11052716B2
An axle for a vehicle, wherein the axle includes a transverse axle portion having a longitudinal end. The axle including a first axle portion connecting the transverse portion to a chassis of the vehicle and a second axle portion connecting the transverse portion to a wheel carrier for supporting a vehicle wheel. A vibration damper is arranged in a receiver in one of the axle portions.
US11052713B2
A mobility connection system including a left driveshaft and a right driveshaft having an internally hollow shaft shape, and connected to a left wheel portion and a right wheel portion, respectively; a connection shaft having a shaft shape provided inside the left driveshaft or inside the right driveshaft, and slid to the outside of a vehicle to be inserted into and coupled to the inside of the driveshaft of another vehicle which is disposed adjacent to the side thereof when the vehicle is laterally coupled to another vehicle; and a wheel detecting sensor provided at the left side or the right side of the vehicle, and for detecting whether the driveshafts facing each other when the vehicle is coupled to another vehicle have been aligned with each other or the spacing distance therebetween is formed.
US11052709B2
A pneumatic tire includes land portions defined by grooves, and sipes that are formed in the land portions and intersect the grooves. The sipes form acute angle portions and obtuse angle portions with the grooves. Notches are formed in the obtuse angle portions.
US11052708B2
A pneumatic tire includes: a protrusion portion projecting outward in a tire lateral direction disposed in a buttress portion; and a linear portion with a linear shape when viewed in a tire meridian cross section, the linear portion constituting a surface of the protrusion portion at a position inward in a tire radial direction from a corner portion, the corner portion being an end portion of the protrusion portion outward in the tire lateral direction; the corner portion being located within a retreading development width position, which is a range in the tire radial direction in which a boundary for removing a tread when retreading is located; and the linear portion having an angle ranging from 45° to 90° with respect to a horizontal line parallel with a tire rotation axis at a position inward of the linear portion in the tire lateral direction.
US11052706B2
A green tire includes a plurality of sheets of green rubber having a substantially circular shape, wherein each sheet of green rubber includes an upper ring and a lower ring, and each sheet of green rubber further includes a plurality of spoke portions extending from the upper ring to the lower ring. The green tire further includes a plurality of reinforcements. Each reinforcement is disposed between adjacent sheets of green rubber. At least one reinforcement is sandwiched between the upper rings of adjacent sheets of green rubber, and at least one reinforcement is sandwiched between the spoke portions of adjacent sheets of green rubber.
US11052693B2
The invention comprises a mechanical handwriting system linked to a user input system to generate a plotted document, such as a greeting card, note card or document, using a conveyor belt unit to support and move the document, a plotter, and a series of rollers to position and constrain movement of the greeting card, which is optionally and preferably linked to a paper feeder system in an assembly line format, where the rollers are optionally and preferably adjustable in position to accommodate varying paper sizes and to allow movement of the document during a plotting period to avoid positional overlap constraints of the rollers and a plotter head of the plotter in a process of plotting the document/card in sections.
US11052692B2
A covering assembly is disposed on an inked printing assembly of a stamp. The covering assembly has a top cover and a bottom cover. The top cover is detachably disposed above the inked printing assembly. The bottom cover is detachably disposed below the inked printing assembly, is located below the top cover at a spaced interval, and has a bottom wall. The covering assembly can assist in assembling the inked printing assembly. The disposition of the top cover and the bottom cover can transfer pointed force into planar force for increasing a contact area, the forcing uniformity, and the assembly convenience.
US11052691B2
Examples of the present disclosure relate to a calibration method for a printing system. The method comprises printing a diagnostic pattern representative of decap time. The diagnostic pattern comprises the firing of nozzles after an exposure to ambient air during a first predetermined time period to produce a first pattern element and the firing of nozzles after an exposure to ambient air during a second predetermined time period to produce a second pattern element. The method includes scanning the resulting diagnostic pattern with a sensor to collect decap data in a digital form, digitally analyzing the decap data, the digital analysis comprising identifying a quantitative difference between the first and second pattern elements, and modifying a servicing process of the printing system if the quantitative difference passes a predetermined threshold.
US11052683B2
A single nip de-skew, lateral registration, and process direction registration device removes skew, laterally registers, and registers in the process direction substrates moving along a media transport path. The single nip de-skew, lateral registration, and process direction registration device includes a fixed roller that is longer than a rotating wheel that forms a nip with the fixed roller. The wheel has a coefficient of friction that is higher than a coefficient of friction of the roller so an actuator translating the wheel along the fixed roller laterally registers and de-skews substrates.
US11052682B2
Devices and methods for identifying categories or types of print media in image forming apparatuses are disclosed. In an example method print media are advanced in a feeding direction to reach a cutting position, a cutter is advanced in a cutting direction, perpendicular to the feeding direction to cut the print media, friction between the cutter and the print medium is measured, and the print media are identified based on the measured friction.
US11052676B2
A printing device 1 includes a platen roller 7 which feeds a thermal tape 42, a thermal head 8 which performs printing on the thermal tape 42, and a control circuit 12. The control circuit 12 rotates the platen roller 7 backward to feed the thermal tape 42 backward in order to make a printing start area PT of the thermal tape 42 reach a backward feed position more away from an outlet 2b than a normal position NP of the thermal head 8. After that, the control circuit 12 rotates the platen roller 7 forward to perform printing using the thermal head 8.
US11052674B2
To reduce an influence of a flow of ambient atmosphere and the like on flying of a droplet ejected from a nozzle of an inkjet head. To exhaust vapor of a solvent contained in a coated film while reducing an influence on flying of the droplet. An exhaust device for inkjet coating includes: a cover that covers at least a target range on an object to be coated, the target range being a range in which a droplet lands that is ejected from an ejection nozzle of an inkjet head to a surface of the object to be coated; a closing member that closes a gap between the cover and the object to be coated around the target range; an external communication portion through which a compartment surrounded by the cover, the object to be coated, and the closing member communicates with an outside; and an exhaust mechanism configured to exhaust air from the compartment.
US11052669B2
In one example, an article for a replaceable printer component includes an integrated circuit device having a device controller, a conductor to supply power to the device controller and to carry a signal to and from the device controller, and a sensor operatively connected to the device controller to sense a voltage and/or a frequency on the conductor. The device controller to send an indication of a sensed voltage and/or a sensed frequency to the printer controller.
US11052666B2
In an example, a printhead carriage to be used in a printing system is disclosed herewith wherein the carriage includes a pocket defined by a first wall and a second wall opposite to the first wall; a set of electrical connectors provided on the first wall; and a mechanical protector. In an example, the mechanical protector may be a sheet with a determined length that extends from the first wall into the pocket and a width that extends along the width of the first wall over the electrical connectors. In an example, the mechanical protector includes an elastic member biased towards the second wall.
US11052664B2
A liquid absorbing device includes: a liquid absorber containing fibers and an anionic absorbent resin designed to absorb a liquid; a container having a feed port to which the liquid is supplied, a storage section that is connected with the feed port and that stores the liquid absorber, an inflow section configured such that part of the liquid flows into when the liquid is supplied to the storage section, and a communicating portion that connects the storage section with the inflow section; and a detection unit that is provided in the inflow section and that is configured to detect a surface of the liquid in the inflow section.
US11052659B2
There is provided a liquid discharge apparatus including: a discharging member including a plurality of individual electrodes arranged side by side in a first direction, a plurality of individual channels arranged side by side in the first direction, a plurality of nozzles arranged side by side in the first direction, a common channel communicating with the plurality of individual channels, and an opening communicating with the common channel; and a heating member at least a part of which makes contact with the discharging member. An individual electrode, included in the plurality of individual electrodes and located at an end in the first direction, and the opening are apart from each other in the first direction. At least the part of the heating member is a part making contact with the discharging member, at a location between the opening and the individual electrode located at the end in the first direction.
US11052653B2
A system for processing water washable flexo photopolymer printing plates, the system comprises a washing line including one or more brushes and a surface essentially facing said brushes, and a guiding means adapted to guide a water washable photopolymer printing plate through the washing line by pulling it from a vicinity of a downstream edge thereof and automatically dragging such water washable photopolymer printing plate on said surface. Said brushes are adapted to contact onto a side of such water washable photopolymer printing plate in a washing direction from the downstream edge towards an upstream edge thereof. The system further comprises one or more attachments adapted to be annexed to the vicinity of the upstream edge of a water washable photopolymer printing plate, the attachments being further adapted to exert friction onto the surface, said friction being greater than that between such water washable photopolymer printing plate and said surface.
US11052646B2
In a lining material peeling method of peeling a lining material, which is fixedly formed on a surface of a base material, from the base material, a liquefied fluid which evaporates after injection is injected to a boundary between the base material and the lining material.
US11052644B2
An electrical conductor includes: a first conductive layer including a plurality of ruthenium oxide nanosheets, wherein at least one ruthenium oxide nanosheet of the plurality of ruthenium oxide nanosheets includes a halogen, a chalcogen, a Group 15 element, or a combination thereof on a surface of the ruthenium oxide nanosheet.
US11052639B2
Thermoplastic film suitable as an intermediate layer for a laminated glass pane, wherein the thermoplastic film includes a defined region, which is provided for a camera window or an HUD (head-up display) region that has a non-zero wedge angle, and a region surrounding the defined region on all sides, in which the thermoplastic film has a substantially constant thickness, wherein the maximum thickness in the defined region of the thermoplastic film is less than the thickness in the surrounding region.
US11052637B2
A structure containing a Sn layer or a Sn alloy layer includes a substrate, a Sn layer or Sn alloy layer formed above the substrate, and an under barrier metal formed between the substrate and the Sn layer or Sn alloy layer in the form of a single metal layer containing any one of Fe, Co, Ru and Pd, or an alloy layer containing two or more of Fe, Co, Ru and Pd.
US11052635B2
Provided is a sheet-type molded body that is formed by sewing a sheet, wherein thread is used for at least part of said sewing, the thread being composed of a resin composition for thread containing resin for thread, the thread having a melting point of no more than 200° C., and a laminate comprising: the sheet-type molded body; and a polyurethane foam formed body, the sheet-type molded body, and the laminate comprising: the sheet-type molded body; and a polyurethane foam layer being able to be produced by a simple method at low cost without damaging design qualities over time, and making it possible to prevent leakage of raw material etc. from sewed portions when backed with the polyurethane foam layer.
US11052632B2
An article comprising a flexible mesh layer pliable enough for being arranged in direct planar contact with a contoured surface, the mesh layer providing one or more attributes of adhering, sealing or reinforcing to a surface receiving the flexible mesh.
US11052630B2
A sheet processor subjecting a sheet having been conveyed forward to processing along a direction perpendicular to a conveyance direction of the sheet, includes: a processing unit performing the processing; and a receiving unit receiving the processing unit therein in a state capable of perfecting the processing on the sheet, and the processing unit includes a first processing tool 4A and a second processing tool 4B disposed to vertically oppose each other with a conveyance surface of the sheet disposed therebetween, and the receiving unit includes at least one receiver that removably receives the first processing tool 4A and the second processing tool 4B in the state capable of performing the processing on the sheet, with arbitrarily selected one of the first processing tool 4A and the second processing tool 4B disposed above the conveyance surface, and with arbitrarily selected another of the first processing tool 4A and the second processing tool 4B disposed below the conveyance surface.
US11052628B2
A bag making and packaging machine has pull-down belt mechanisms, a transverse sealing mechanism, a rotatable folding member, and a gas blowing mechanism. The folding member, before the transverse sealing mechanism, seals a cylindrical film, pushes against a side portion of the cylindrical film to thereby fold the cylindrical film inward and form a fold in the cylindrical film. The gas blowing mechanism blows a gas onto the fold to thereby inhibit the cylindrical film from sticking to the rotating folding member.
US11052620B2
A guiding device for guiding a fiber texture on an impregnation mandrel of a winding machine, the device including a first radial spacer for placing facing a first cheekplate of the impregnation mandrel, a second radial spacer for placing facing a second cheekplate of the impregnation mandrel, and a cross-member suitable for supporting the first and second spacers, the cross-member including an adjustment system for adjusting the positions of the first and second spacers and suitable for positioning the first and second spacers apart respectively from the first and second cheekplates of the impregnation mandrel so as to hold a first portion of fiber texture that extends along the first cheekplate pressed against the first cheekplate, and a second portion fiber texture that extends along the second cheekplate pressed against the second cheekplate, without blocking rotation of the impregnation mandrel.
US11052616B2
A method for manufacturing a multilayer fiber structure includes providing a receiving surface being formed by a first surface region of a contoured tool surface of a forming tool component and a support surface of a support component. Further, at least one fiber layer is formed on the receiving surface by laying down a plurality of fiber tapes onto the receiving surface. A roller device is positioned so as to press the at least one fiber layer against the tool surface and the support component and the roller device are synchronously moved along a curved transition region connects the first surface region to a second surface region of the tool surface. Thereby the at least one fiber layer is abutted against the transition region and the second surface region of the tool surface. Further, a tool system for manufacturing a multilayer fiber structure is disclosed.
US11052611B2
A fabricating apparatus includes processing circuitry. The processing circuitry is configured to receive designation of a scheduled fabrication start time of a fabrication object, detect a change in a fabrication practicability condition of the fabricating apparatus, and output change information indicating an occurrence of a change in the fabrication practicability condition of the fabricating apparatus when the change in the fabrication practicability condition has been detected after reception of the designation of the scheduled fabrication start time.
US11052610B2
A powder delivery device for providing raw material powder to a powder application device of a powder bed fusion apparatus is provided. The powder delivery device comprises a powder supply section configured to receive raw material powder, the powder supply section comprising an outlet for providing the raw material powder to the powder application device. The powder delivery device further comprises a first physical parameter determining unit arranged at a first location of the powder supply section and configured to determine a first physical parameter in the powder supply section, and a controller configured to determine whether the first physical parameter meets a first tolerance criterion, and a powder treatment unit. The controller is configured to instruct the powder treatment unit to perform a powder treatment in case it determines that the first physical parameter does not meet the first tolerance criterion.
US11052603B2
An additive manufacturing system is disclosed for use in fabricating a composite structure. The additive manufacturing system may include a print head configured to discharge a continuous reinforcement that is at least partially wetted with a matrix, and a support configured to move the print head in at least one dimension during discharge. The additive manufacturing system may also include a cutting mechanism connected to at least one of the print head and the support. The cutting mechanism may be configured to selectively sever the continuous reinforcement from the print head. The cutting mechanism may include a cutting implement, a first actuator configured to move the cutting implement from a stowed position to a deployed position, and a second actuator configured to engage the cutting implement with the continuous reinforcement.
US11052601B2
In a 3D-printing system, a deposition head comprising a band assembly having a body and a band for compacting a filament onto the surface of an object being manufactured. One or more actuators are mounted on the assembly body and are used to shape the band to a desired contour. The band is connected to the one or more actuators, is curved toward the surface of the object to enable contact with the surface, and is capable of being driven along its length by one or more drive wheels that are under the control of a controller. The drive wheels are configured to advance the band along its length by a first distance and in response to a first signal from the controller. The controller provides the first signal based on an estimate of thermoplastic build-up on a portion of the band that overlaps the point of compaction.
US11052597B2
Described is a method of forming a structure having viscoelastic properties. The method can include a) depositing a layer of droplets of a solidifying material and a non-solidifying material, the droplets being deposited according to an occupancy matrix specifying voxels for the solidifying and non-solidifying materials, the solidifying and non-solidifying material being interspersed within the occupancy matrix, the occupancy matrix being generated by a probabilistic function; b) exposing the droplets of solidifying material to ultraviolet radiation to cure the solidifying material; and c) repeating a) and b) to deposit additional layers of droplets of solidifying and non-solidifying materials, thereby forming the structure having viscoelastic properties.
US11052592B2
An extruder assembly has a frame with upstream and downstream ends. A barrel assembly on the frame has a passage. At least one material advancing component resides at least partially within the passage and is configured to be turned around an operating axis to thereby cause material to be conveyed from a passage inlet to a passage outlet. A drive assembly turns the at least one material advancing component around its operating axis and has a motor on the frame situated so that at least a part of the motor is in lengthwise overlapping relationship with the barrel assembly. The drive assembly is configured to turn the one material advancing component around its operating axis at a speed of at least 300 rpm.
US11052578B2
A method for producing a thermoplastic combination film suitable for a composite glass pane, wherein the thermoplastic combination film includes at least one defined area, which is provided for a camera window or an HUD (head-up display) region that has a variable wedge angle, the method including providing a first thermoplastic film, producing a second thermoplastic film with a variable wedge angle, wherein the three-dimensional shape of second thermoplastic film is obtained by molding on a mold, and joining together the first thermoplastic film and the second thermoplastic film.
US11052575B2
Disclosed is an elastomeric bladder tool and related systems and methods. In one embodiment, the elastomeric bladder tool comprises an elastomeric inner layer substantially defining an inner cavity of the elastomeric bladder tool, an elastomeric outer layer substantially defining an outer surface of the elastomeric bladder tool, and a permeable middle layer positioned between the elastomeric inner layer and the elastomeric outer layer. The permeable middle layer has greater permeability than both the elastomeric outer layer and the elastomeric inner layer to allow for evacuating of gases that have entered the permeable middle layer.
US11052572B2
Systems for and methods of forming structural components, such as a spar cap (503), from layers of a fiber reinforced material obtained from rolls of the material are disclosed. The system comprising: a plurality of rolls (514) including a first roll (514a) and a second roll (514b) of the fiber reinforced material (504), the first roll has one or more first lines (530) printed thereon. The first lines indicating where the fiber reinforced material on the first roll is to be separated into a plurality of discrete first pieces (531-1) for forming the structural component (503). The fiber reinforced material on the second roll has one or more second lines (530) printed thereon. The second lines indicating where the fiber reinforced material on the second roll is to be separated into a plurality of discrete second pieces (531-2) for forming the structural component (503). The systems and methods achieve a substantial reduction in the amount of wasted material.
US11052571B2
Systems and methods are provided for fabricating preforms for composite parts. One embodiment is a method of creating a preform. The method includes conveying a web of fiber reinforced composite material in a process direction, disposing fiber reinforced composite material atop the web, conveying the web and the tow in the process direction to a cutting tool, and cutting out a preform comprising a combination of the tow and the web.
US11052570B2
A process for producing foamed thermoplastic polyurethane particles comprises the steps of a) melting a thermoplastic polyurethane in a first extruder (E1), b) injecting a gaseous blowing agent in a second extruder (E2), c) impregnating the gaseous blowing agent homogeneously into the thermoplastic polyurethane melt in a third extruder (E3), d) extruding the impregnated thermoplastic polyurethane melt through a die plate and granulating the melt in an underwater granulation device under temperature and pressure conditions to form foamed thermoplastic polyurethane particles.
US11052566B2
A pole for supporting a cable. The pole includes a plurality of truncated cones arranged in a linear array to form the pole, wherein each truncated cone receives an adjacent truncated cone within its interior. Each truncated cone in the pole is formed from a veneer by moving the longitudinal edges of the veneer towards each other. A method of manufacturing the pole and various uses of the pole are also provided.
US11052557B2
A razor includes one or more blades that are directly or indirectly heated by RF energy. A control circuit is connected to and operates a high frequency (HF) generator and a HF power amplifier (HFPA) for generating radio frequency (RF) energy throughout a range of controllable power levels. The generated RF energy is guided by a wave guide from the HFPA to a resonance chamber (i.e., band pass filter cavity). The RF energy is radiated from the resonance chamber towards the one or more blades which absorb the RF energy, thereby causing the temperature of the blades to increase. An energy source provides the electric current required for operating the control circuit, the HF generator and the HFPA. In another embodiment, the RF energy is radiated from the resonance chamber towards a heating element that increases in temperature and heats the blades by thermal conduction.
US11052552B2
A safety blade for use with a knife assembly comprises a blade body, a bade attachment having a cutting edge and a top edge opposite the cutting edge, a blade attachment having a first half and a second half connected together via a hinge and extending beyond the top edge of the blade body to define a clamshell for receiving the blade body, and a handle adaptor having a handle engagement portion for removably securing the blade attachment to a handle.
US11052543B2
A control device includes a control section configured to control a motion of a robot arm using values detected by a plurality of distance sensors. The plurality of distance sensors include a first distance sensor and a second distance sensor disposed in a first direction orthogonal to the axial direction of a dispenser. The second distance sensor is disposed in a position further apart from the dispenser than the first distance sensor. The control section executes, on a robot, a first instruction for causing the robot to execute discharge of a discharge object by the dispenser when a distance acquired by the first distance sensor is a distance in a predetermined range and a distance acquired by the second distance sensor is a distance larger than the distance in the predetermined range.
US11052539B2
Method, server and storage medium for robot routing are provided. An operation area of the robot is gridded into a plurality of cells arranged in rows and columns. The method includes: planning, for the robot, a traveling path from a starting point to a destination point, where the traveling path is divided into a plurality of path segments; and reserving, one or more cells corresponding to a first path segment for the robot, where the first path segment is anyone of at least one among the plurality of path segments, in case that there is the deadlock phenomenon, refraining from reserving the cell for the robot, and re-checking whether the deadlock phenomenon is still present in the cell after a preset interval; and in case that there is no deadlock phenomenon, reserving the cell for the robot.
US11052525B2
A hammer drill includes a housing, a tool holder, a hammering member, a gear, and a conversion member. The gear is switched to a first state where a rotation of the intermediate shaft is transmitted and a second state where the rotation of the intermediate shaft is not transmitted, and a mode switching member is configured to perform a switching operation of the state of the gear from an outside of the housing. The switching of the state of the gear by the mode switching member provides at least two operation modes of a hammer drill mode where the gear integrally rotates with the intermediate shaft to generate the rotation and a reciprocation of the hammering member on the tool holder and a hammer mode where the gear is separated from the rotation of the intermediate shaft to generate only the reciprocation of the hammering member.
US11052521B2
A crimping device includes a housing defining a bore and at least three extendable mechanisms angularly equispaced about the axis of the bore. Each of the extendable mechanisms include: (i) a first elongate arm hingedly connected at or near a first axial end of the first arm to the housing; (ii) a second elongate arm hingedly connected at or near a first axial end of the second arm to the housing, wherein: the first axial ends of the first and second arms are displaceable relative to each other; and the first and second arms are hingedly connected at or near their second axial ends to each other. The crimping device further includes means for equi-displacing the first axial ends of coupled first and second arms relative to each other, thereby to configure the crimping device between: (i) a dilated condition in which the second axial ends of the first and second arms are maximally spaced from the bore axis; and (ii) a contracted condition in which the second axial ends of the first and second arms are minimally spaced from the bore axis.
US11052518B2
A liner 7 is provided with a cylinder portion 14a is formed in parallel to the rotation axis, and also a hydraulic fluid flow path 14c is formed which opens to a cylinder portion 14a to communicate with the interior of the liner serving as a high-pressure chamber and a low pressure chamber at the time of occurrence of the striking torque, and an automatic relief mechanism 14 is provided in which a cylindrical valve element 14b having a cutout portion 14b′ serving as a flow path for hydraulic oil formed on the outer peripheral surface portion is disposed inside the cylinder portion 14a so as to be freely rotatable.
US11052515B2
The 90 Degrees utilizes dual ratio constant mesh gears which provides suitable use for ratchets in hard to access spaces, and particularly well suited for automotive use. The mesh gears are configured to be used either with manual or pneumatic tools. A female socket element recedes into the housing having gears therein and a male socket element meshes with the female socket element and is shaped to accommodate a female socket element at 90 degrees or the adapter element of a drive ratchet. You can use an elongated drive shaft to accommodate distance. Positioned within the housing of the adapter body are gears secured to mesh within the housing of the adapter. Rotation of the female socket element by a drive ratchet in one direction will rotate the male socket element in the opposite direction without any change in direction is governed by the ratchet use.
US11052513B2
A pneumatic-fixation connecting having a body, a movable part, a plurality of spheres, a plurality of elastic units, and a plurality of stop units is disclosed, wherein each of the elastic units is disposed between the body and the movable part via each of the stop units, respectively. When an external force is applied on the movable part, the distance between the movable part and the body is reduced and the sphere does not block the connecting pin in the extension tube inside the body. When the external force disappears, the distance between the movable part and the body increases such that the sphere affixes the connecting pin and the body. The stop unit can be used, not only to adjust the length and elastic force of the elastic unit so as to extend the life cycle of the elastic unit, but also to help in changing the elastic unit which in turn enhances the efficiency of the replacement work.
US11052504B1
A temperature regulation system and a temperature regulation method are applicable to a machine tool. The temperature regulation system includes a cooling fluid storage tank, a heating fluid storage tank, an internal circulation subsystem, an external circulation subsystem and a computing unit. The internal circulation subsystem includes a first valve. The external circulation subsystem includes a plurality of flow channels and a second valve and a third valve disposed on the plurality of the flow channels. The computing unit controls the first valve, the second valve and the third valve to switch flow directions of the plurality of the flow channels among the cooling fluid storage tank, the heating fluid storage tank and machine tool. Therefore, a thermal balance of the machine tool can be effectively maintained.
US11052481B2
A method for processing a transparent workpiece includes directing a pulsed laser beam into the transparent workpiece such that a portion of the pulsed laser beam directed into the transparent workpiece generates an induced absorption within the transparent workpiece, thereby forming a damage line within the transparent workpiece, and the portion of the pulsed laser beam directed into the transparent workpiece includes a wavelength λ, a spot size w0, and a Rayleigh range ZR that is greater than F D π w 0 2 λ , where FD is a dimensionless divergence factor comprising a value of 10 or greater. Further, the method for processing the transparent workpiece includes etching the transparent workpiece with an etching vapor to remove at least a portion of the transparent workpiece along the damage line, thereby forming an aperture extending through the at least a portion of the thickness of the transparent workpiece.
US11052477B2
A slag removal apparatus for removing slag from support plates provided to support an object to be processed in a cutting machine is disclosed. The slag removal apparatus includes a scraper including a plurality of blades around an outer surface of a bar crossing the support plates, and a plurality of slots formed in the respective blades along a length direction and thus formed around the bar and in a length direction of the bar, a rotation support unit to which the scraper is rotatably installed, a rotation driving unit rotating the scraper from the rotation support unit to remove slag attached to the support plates by the blades, when the support plates are inserted into the slots, a lifting unit lowering the scraper, for insertion of the support plates into the slots and raising the scraper to an original position by raising and lowering the rotation support unit, and a first transfer unit moving the rotation support unit along a length direction of the support plates to allow the scraper to remove the slag along the length direction of the support plates.
US11052472B2
A cutting insert includes a rake face configuring one of polygonal surfaces, a seating surface configuring the other one of the polygonal surfaces, and a side surface connecting the rake face and the seating surface to each other. The cutting insert has a cutting edge portion including a main cutting edge located in a side portion of the rake face, a subsidiary cutting edge connected to the main cutting edge, and a corner cutting edge connected to the subsidiary cutting edge and located in a corner portion of the rake face. The side surface includes a flank face and a connection surface which are adjacent to each other in a thickness direction via a boundary line. The connection surface is located on the seating surface side, and is located outside than an extension line of the flank face.
US11052470B2
THIS invention relates to a drilling accessory for a power drill drilling accessory that assists the operator of the power drill to correctly align and orientate the drill bit of the power drill with the target object, and collects the dust and/or debris arising from such drilling. The drilling accessory includes a cap having a plurality of differently sized guide holes and a container to which the cap is pivotally connected. The container comprises a first through hole, which on rotation of the cap relative to the container, enables the first through hole to be aligned with the require guide hole thereby to allow a drill bit to pass therethrough. The container further comprises a base having a planar support surface portion and a seal portion protruding outwardly from the support surface portion towards a contact lip, which contact lip defines a second through hole coaxially aligned with the first through hole. The protruding seal portion defines a bore therein tapering radially inwardly from the planar surface portion of the base towards the contact lip, which in use biases the contact lip into sealing engagement with the target object to efficiently collect dust and debris, with substantially the entire planar support surface portion contacting the target object thereby to provide a stability for drilling straight holes.
US11052468B2
A surface roughening tool includes a cylindrical body and at least one grooving blade outwardly radially projecting from the body and configured to form grooves and peaks into a surface. The surface roughening tool also includes at least one swaging blade outwardly radially projecting from the body and configured to deform the peaks. The at least one swaging blade is aligned with the at least one grooving blade along a circumference of the body.
US11052462B2
An additive manufacturing product is provided. The additive manufacturing product includes an embedded electronic, a transition zone, and a base material. The transition zone encases the embedded electronic. The transition zone includes transition material. The base material encases the transition zone. The transition material includes an intermediate melting point that is lower than a melting point of the base material.
US11052445B2
A method of forming a part includes extruding a billet through a die, forming a round, closed geometry tube from the billet, and hydroforming the round, closed geometry tube. The extrusion die contains an orifice with a central mandrel, a plurality of bridges, and a corresponding plurality of portholes between the bridges. A spacing of the bridges around the mandrel is non-equiangular. As a result, the round, closed geometry tube has non-equiangular welds after emerging from the die.
US11052442B2
To provide a copper-coated magnesium wire which meets the demand for a lightweight coil wire material, and a method for manufacturing the same. The above-described problem is solved by a copper-coated magnesium wire (10) comprising a core material (1) made of magnesium, and a copper coating layer (2) made of copper or a copper alloy provided on a surface of the core material (1). In the copper-coated magnesium wire (10), a wire drawing mark is present on a surface of the copper coating layer (2), and the diameter is preferably within a range of 0.03 to 0.08 mm, inclusive. Further, a thickness of the copper coating layer (2) is preferably within a range of 5 to 30%, inclusive, as a ratio of the overall cross-sectional area. An insulating coating layer (3) may be provided on an outer circumferential side of the copper coating layer (2).
US11052433B2
An ultrasonic cleaning equipment (1) according to the present invention includes a treatment tank (10) that stores a cleaning liquid that cleans an object to be cleaned and in which the object to be cleaned is immersed; an ultrasonic application mechanism (20) that applies ultrasonic waves to the cleaning liquid retained in an interior of the treatment tank; and a curved surface member (30) that is located in a range defined by an angle of inclination from a perpendicular direction in an end portion of a vibrating surface of the ultrasonic application mechanism to an outside with respect to the vibrating surface and that is held on a wall surface and/or a bottom surface of the treatment tank.
US11052412B2
A sprayer includes a spray gun and a hopper. An air source provides compressed air to the sprayer to both eject fluid from the spray gun as a spray and to pressurize the hopper. The spray gun includes an airflow controller for controlling the flow of the compressed air to a nozzle of the spray gun, a pressure regulator for regulating a pressure of the compressed air flowing to the hopper, and a relief valve between the pressure regulator and the hopper. The hopper receives the compressed air through a port in the hopper, and the compressed air assists the flow of material out of the hopper and into the spray gun.
US11052411B2
A nozzle device and method for creating a fluid nucleation in situ, is disclosed. The nozzle has a housing having a hollow interior, an outer cylindrical wall, and inlet and an outlet, and a diffuser disposed in the cylindrical tube at a first end toward the inlet. The diffuser is configured to break bonds between adjoining fluid molecules and create a nucleation event. The nozzle further has a mesh framework disposed in the cylindrical tube and extending longitudinally within the tube in the nucleation zone, and is configured to manipulate the bonding and un-bonding of water molecules within a pressurized environment for the production of snow, clean water or both.
US11052407B1
A dielectrophoresis-based in-droplet cell concentrator is disclosed herein. The concentrator can include a concentration microchannel having an input port and two or more outlet ports. The input port introduces cell-encapsulated droplets or particle-encapsulated droplets into the microchannel; a first outlet port receives droplets including most of the cells or particles and a second output port receives droplets including few cells or particles. The concentrator also can include a pair of electrodes. When voltage is applied, the electrodes will create an electric field across the microchannel. The concentrator adds new capabilities to droplet microfluidics operations, such as adjusting concentrations of cells in droplets, separating cells of different properties from inside droplets, and solution exchange.
US11052404B1
An apparatus for remediation of a copper and nickel co-contaminated soil includes a housing. A crushing device is arranged at the upper part of the inside of the housing. A stirring device is arranged below the crushing device. An anode electrode and a cathode electrode are provided at both ends of the inner bottom of the housing, respectively. In the present invention, the soil contaminated by copper and nickel is first poured from the top of the crushing device, and then crushed thoroughly under the action of the crushing device. The crushed soil facilitates the movement of copper and nickel metal ions therein toward the electrodes under the action of the anode electrode and the cathode electrode, thereby achieving optimal soil remediation.
US11052403B2
A protection device for tools for cutters and shredders and the like, arranged on a tool-holder seat for a tool-holder rotor rotatable about the axis of the rotor, said tool being housed in a seat arranged on the tool-bolder rotor, and formed by a first surface arranged at the front in the cutting direction and a second surface onto which the tool is fixed with its opposite surface to the cutting direction, the tool having a body that has a front surface in the rotation direction of the rotor, and a rear surface opposing the front surface. The tool and/or the seat having lateral projections and a protection device is dismountable connected to the seat of the tool, laterally as a protection for the tool and the plates being arranged partially between the lateral projections, of the tool and/or the seat of the tool, and the tool-holder rotor.
US11052399B2
A powder gathering apparatus includes at least two rotating plates and a driving mechanism. The at least two rotating plates are disposed with respect to each other. Each of the rotating plates includes at least one spherical member. The at least one spherical member protrudes from the rotating plate. The driving mechanism drives at least one of the at least two rotating plates to move, such that the at least two rotating plates get close to or away from each other. The driving mechanism drives the at least two rotating plates to rotate.
US11052391B2
A microfluidic device, including a controllable shape-changing micropillar where a shape of the shape-changing micropillar is changed by a fluid.
US11052388B2
A method of manufacturing a microfluidic device, said method comprising placing a length of material in a liquid polymer, configuring the length of material to define the path of a microfluidic channel, curing or setting the polymer liquid to form a solid polymer around the configured length of material, and dissolving the configured length of material with a solvent to provide a microfluidic channel in the solid polymer.
US11052381B2
A modified Y-type molecular sieve has a rare earth oxide content of about 4% to about 12% by weight, a phosphorus content of about 0% to about 10% by weight, a sodium oxide content of no more than about 1.0% by weight, a total pore volume of about 0.36 to 0.48 mL/g, a percentage of the pore volume of secondary pores to the total pore volume of about 20% to about 40%, a lattice constant of about 2.440 nm to about 2.455 nm, a percentage of the non-framework aluminum content to the total aluminum content of no more than about 10%, a lattice collapse temperature of not lower than about 1060° C., and a ratio of Brønsted acid to Lewis acid of no less than about 3.50. The preparation of the molecular sieve includes ion-exchange with rare earth, hydrothermal roasting, gas phase ultra-stabilization, acid treatment, and an optional phosphorus modification.
US11052376B2
The present disclosure provides for a porous gas sorbent monolith with superior gravimetric working capacity and volumetric capacity, a gas storage system including a porous gas sorbent monolith of the present disclosure, methods of making the same, and method for storing a gas. The porous gas sorbent monolith includes a gas adsorbing material and a non-aqueous binder.
US11052373B2
The present invention relates to processes and apparatus useful for (fast) ionic polymerisation of liquid monomer(s) containing reaction mixture for the production of the corresponding polymer(s).
US11052362B2
A device for spherification of a liquid includes a first device for storing a first liquid; and a spherification tank for storing a second liquid, arranged so that a dripper or entry funnel controls a level of the second liquid in the spherification tank. A device meters the first liquid coming from the first tank into the spherification tank. An extraction device extracts spheres generated in the spherification tank as a result of the metering. The extraction device includes a worm screw located in the spherification tank, the worm screw being arranged at an angle to the level, and a motor for rotating the worm screw.
US11052360B2
A mixing machine includes a head extending over a bowl receiving location, the head including a downwardly extending rotatable output shaft for receiving a mixer tool. A drive train including a motor having an output operatively connected to drive a planetary gear system that effects rotation of the rotatable output shaft about its axis and orbiting of the shaft axis about another axis. A control system includes a master control unit and a slave control unit, the master control unit connected with a first sensor located along the drive train between the motor and the planetary gear system, the slave control unit connected with a second sensor, wherein both the slave control unit and the second sensor rotate with a part of the planetary gear system, wherein the master control unit and the slave control unit are configured for wireless communication with each other.
US11052357B2
The invention relates to a stirring member (9) for using in a system for preparing a food product, the product being prepared by the stirring member (9) moving inside a container (8), the stirring member (9) being configured in such a way that it can adopt different configurations depending on its direction of rotation inside the container (8). Preferably, the stirring member (9) can adopt a spoon configuration or a whisk configuration. The invention further relates to a method for using such a stirring member (9) in a system for preparing a food product, the method varying the direction of rotation of the stirring member (9) so that it adopts a different configuration depending on the type of product prepared in the container (8).
US11052328B2
A fuel stabilization system for removing oxygen from fuel includes an accumulator disposed along a fuel line, the accumulator includes a fuel inlet and a fuel outlet and a heat source disposed in thermal communication with the fuel in or upstream of the fuel inlet of the accumulator to increase the temperature of the fuel within the accumulator. The accumulator is configured to allow oxygen deposits to form therein as a result of the temperature increase of the fuel.
US11052325B2
Provided are a mono-ethylene glycol (MEG) recovery apparatus and a MEG recovery method. The MEG recovery apparatus includes a pretreater receiving the raw material from a raw material supplier to remove the low soluble salts, a first distiller connected to the pretreater to receive the raw material from which the low soluble salts are removed, and to form a first treated solution by vaporizing a certain amount of the water, a high soluble salt remover connected to the first distiller to remove the high soluble salts from the first treated solution, a second distiller connected to the high soluble salt remover to form a second treated solution by vaporizing the water from the first treated solution from which the high soluble salts are removed, and a recovery unit connected to the second distiller to recover the second treated solution.
US11052321B2
A system that collects, analyzes, and applies physical metrics from participants in game environments. Participants (players and/or spectators) in a game may wear or hold devices that collect physical data from the participants via sensors, generate metrics data from the sensor data, and provide the metrics data to a participant metrics module. The module may receive the metrics data from the devices, analyze the metrics data to generate game inputs based on the participants' physical metrics, and provide the game inputs to the game system to affect game play. The module may also receive alerts or other information from the game system or from players, determine feedback for participants according to the received information, and signal the devices to provide feedback or alerts to the participants in the game. The devices may include indicators that are activated by the signals to provide visual, audio, and/or haptic indications to respective participants.
US11052313B2
Methods and systems for assigning a data center to service a request from a user account include receiving a login request to a cloud gaming server. The login request is examined to identify a user account. A use history of the cloud gaming server is examined to identify a data center. The user account is assigned to the data center to start a session of streaming game play at a server within the data center. The data center is identified without performing a connection testing operation.
US11052310B2
Various game controller hardware and user interface configurations are disclosed. Some configurations may comprise two circular trackpads, driven by the player's thumbs, which may be clickable, allowing the entire surface to act as a button. Haptic feedback may be based on dual linear resonant actuators (e.g., by means of strong, weighted electro-magnets attached to each of the dual trackpads), capable of delivering a wide range of force and vibration, allowing control over frequency, amplitude, and direction of movement. The haptics-related components in certain implementations may also play audio waveforms and thereby function as speakers. In the center of the controller according to certain configurations may be another touch-enabled surface, this one backed by a display screen. In some configurations this entire screen itself may also be clickable, like a large single button. A variety of other exemplary implementations and configurations are described.
US11052307B2
Embodiments of the present disclosure provide a method for controlling the movement of a virtual object performed by an electronic device. A first button is displayed at a first position of a screen. A second button is displayed at a second position of the screen when a first touch operation is detected. When a second touch operation on the second button is detected, a virtual object is controlled to move automatically, and the two buttons are highlighted. The automatic movement of the virtual object and the linkage between the two buttons are implemented through simple operations, thereby improving the convenience and flexibility of operations.
US11052304B2
A system that manages a package of shuffled playing cards and gaming chips includes a storage box and a control apparatus. The storage box is provided in association with a game table and stores a plurality of shuffled playing cards and a plurality of chip cases and also includes a card reader that reads playing card ID codes of the shuffled playing cards and a chip reader that reads case ID codes of the chip cases. The control apparatus outputs total numbers of the shuffled playing cards and the chip cases stored in the storage box and the playing card ID codes and case ID codes stored in the storage box by monitoring read playing card ID codes and case ID codes.
US11052299B2
A golf putter that enables dual configuration, namely sighting & play modes whereby the golfer can view both the ball and the hole by means of a mirrored surface, but which is reversible so that the golfer can play within tournament rules. A removable mirrored training aid has a reflective side and can be removed, flipped to a non-reflective side, or simply replaced with a same-weighted non-reflective plate, for use in actual (non-practice) golf play. The golfer can practice his or her stroke while observing the image of the ball and hole in the mirror, and thereby imprinting the correct stroke mechanics into muscle memory. Then, after the golfer has reversed the re-attachable mirrored surface plate to present its non-reflective side, the golfer can use the putter in a round of golf.
US11052296B2
A gymnasium or playing field game apparatus provides one or more movable target components in the shape of a mascot mounted on swivel casters which roll on the gym floor or other playing field. Each component serves as a movable target for projectiles thrown by two teams from geometrically opposite sides. Each mascot is moved incrementally upon being impacted by a projectile to move the mascot on the gym floor until it “breaks through” a designated goal finish line of traffic cones protecting one team or the other.
US11052288B1
A force measurement system is disclosed herein. The force measurement system includes a force measurement assembly configured to receive a subject thereon, and one or more data processing devices operatively coupled to the force measurement assembly. In one or more embodiments, the one or more data processing devices are operatively coupled to the force measurement assembly, the one or more data processing devices configured to receive one or more signals that are representative of forces and/or moments being applied to a top surface of the force measurement assembly by the subject, and to convert the one or more signals into output forces and/or moments, the one or more data processing devices further configured to predict one or more balance parameters of the subject using a trained neural network.
US11052284B2
The present invention relates to a method, system, and non-transitory computer-readable recording medium for supporting photographing of a golf swing. According to one aspect of the invention, there is provided a method for supporting photographing of a golf swing, the method comprising the steps of: (i) determining a user device matched with information on a user who is to perform a golf swing, among a plurality of user devices, with reference to a scenario associated with the golf swing; and (ii) causing a photographing module of the determined user device to photograph the golf swing of the user.
US11052278B2
A pipe exercise device designed to allow a user to transport a weight variable exercise device. The pipe exercise device includes an elongated member with an outer shell having a hollow interior designed to receive items therein. The elongated member has an open end disposed opposite a sealed end, wherein the open end is in communication with the hollow interior, such that a weight can be received therethrough to sit within the hollow interior. An end cap is designed to seal the open end, such that the weights therein are removably secured. At least one handle is disposed on the outer shell, such that the user can grasp the pipe exercise device. In this way, a user is able to transport a weight training device that can quickly and simply change the amount of weight used.
US11052272B2
A multiple position adjustable exercise device includes a first plate, a second plate and an elastic member. The second plate is pivotally connected with the first plate. The elastic member is disposed between the first plate and the second plate, and when the second plate rotates relative to the first plate, the elastic member is twisted for providing an elastic recovering force. An initial position of the second plate relative to the first plate is adjustable for adjusting the elastic recovering force.
US11052269B1
An improved protective face mask used to filter out hazardous pollution and airborne germs and viruses. Embodiments include a three layer version including a first spunbond TETHYS SHIELD treated layer, a meltblown filtration layer, and a second spunbond layer; a four layer version further including a gasket layer formed of a felt material; and a five layer version further including an activated carbon layer in between the spunbond TETHYS SHIELD treated layer and the meltblown filtration layer.
US11052266B2
Apparatus for measuring radiation beam energy output from a radiation beam source, comprising a first beam energy sensor at a first distance from the radiation beam source along the radiation beam axis; a second beam energy sensor located at a second distance from the radiation beam source along the radiation beam axis; and an energy absorbing layer, for example a layer that removes a part of the low energy content of the beam or a layer that absorbs at least 1% of the beam energy, located between the first and second sensors, and positioned such that radiation passing through the first sensor also passes through the energy absorbing layer before entering the second sensor.
US11052262B1
A method of affecting a biological, cellular or biochemical function or structure in a targeted subcortical location in a brain of a patient using a TRPMS apparatus placed on a head of the patient includes positioning two or more of a plurality of magnetic assemblies on locations of the head mount selected to stimulate the targeted subcortical location in the brain of the patient, and activating the plurality of magnetic assemblies at the selected locations to generate magnetic fluxes of a selected strength, frequency and duration directed into the brain of the patient, wherein the magnetic flux directed into the brain of the patient from each of the assemblies is operative to generate induced electric field in regions of the brain and the regions of induced electric fields generated by each of the plurality of magnetic assemblies converge in the targeted subcortical location and combine to a magnitude sufficient to affect the biological, cellular or biochemical function or structure in the targeted subcortical location.
US11052259B2
A connector assembly for an implantable device includes a feedthrough interface having a ceramic feedthrough and a ferrule attached to, and forming a perimeter around, the ceramic feedthrough; a lower contact housing coupled to the feedthrough interface, where the lower contact housing and ceramic feedthrough define wire holes extending therethrough; an upper contact housing attached to the lower contact housing and collectively defining contact receptacles, each of the contact receptacles defining an opening for at least one of the wire holes; connector contacts with each connector contact disposed in a one of the contact receptacles; and wires with each of the wires coupled to one of the connector contacts and extending through one of the wire holes so that the respective wire extends out of the ceramic feedthrough.
US11052256B2
An implantable medical device (IMD) includes a heterogeneous housing configured to receive and store one or more components of the IMD. The housing includes an intrinsically non-conductive and non-magnetic base material and at least one dopant with a property of at least one of electrical conductance and magnetic permeability. The base material and the dopant form a first region of the housing including a first skin depth and a second region of the housing including a second skin depth different than the first skin depth.
US11052255B2
Systems and methods for pacing cardiac conductive tissue are described. A medical system includes an electrostimulation circuit to generate His-bundle pacing (HBP) pulses. A sensing circuit senses a physiologic signal, and detect a local His-bundle activation discrete from a pacing artifact of the HBP pulse. A control circuit verifies capture status in response to the HBP pulses. Based on the capture status, the control circuit determines one or more pacing thresholds including a selective HBP threshold representing a threshold strength to capture only the His bundle but not the local myocardium, and a non-selective HBP threshold representing a threshold strength to capture both the His bundle and the local myocardium. The electrostimulation circuit may deliver HBP pulses based on the selective and non-selective HBP thresholds.
US11052252B1
Described is a system for weakening an undesirable memory. The system initiates application of a first pattern of spatiotemporally distributed transcranial stimulation via a set of electrodes to a subject who is in a calm mental state, causing association of the first pattern of spatiotemporally distributed transcranial stimulation with the calm mental state. The system then initiates application of the first pattern of spatiotemporally distributed transcranial stimulation via the set of electrodes when the undesirable memory is recalled by the subject, causing recall of the calm mental state and reconsolidation of the undesirable memory with the calm mental state.
US11052246B2
A method, system, and device for electroporation. A system may include a medical device with a plurality of electrodes borne on an expandable element and an energy generator in communication with the electrodes. The energy generator may have processing circuitry configured to selectively deliver electroporation energy to at least one of the electrodes. The processing circuitry may determine whether an alert condition is present and, if so, cease the delivery of electroporation energy to one or more electrodes identified as the cause of the alert condition and/or prevent the delivery of electroporation energy to the one or more electrodes identified as the cause of the alert condition. The energy generator may also be configured to deliver electroporation energy in a sequence of a plurality of energy delivery patterns to enhance lesion formation.
US11052243B2
A method of laparoscopically implanting an electrically stimulating lead proximate the lower esophageal sphincter (LES) of a patient includes delivering the lead through a port of a laparoscope inserted into the abdominal cavity of the patient through an incision in the abdominal wall. The stimulating electrode is implanted in or proximate the muscularis layer of the lower esophageal wall to treat esophageal reflux disease (GERD). The lead includes a needle and suture at its distal end for pulling the electrode into the muscular wall of the LES. Clips are applied to the suture attached to the distal end of the lead to prevent retrograde movement of the electrode. The lead also includes an anchoring member for anchoring the portion of the lead proximal to the electrode. The method and lead used with the method allow the surgeon to work within the confined anatomy present at the gastroesophageal junction and prevents backwards movement and dislodgment of the electrode. The implantation procedure can be combined with a hiatal hernia repair to repair the hernia and prevent recurrence of a hiatal hernia.
US11052240B2
A medical device for administering a medicament is disclosed that includes a reservoir for storing the medicament, a current driver electrically coupled to an electrode, and an oscillation driver electrically coupled to a vibrational element. The electrode forms multiple channels in fluid communication with the reservoir. A method of administering a medicament is also provided.
US11052239B2
A cannula for relieving the left side of the heart is provided, the cannula having a cannula shaft comprising a heart-side inlet and a pump-side outlet. A lumen extends between the inlet and the outlet, and a suture ring for connecting the cannula to a left atrium is arranged on an outer side of the cannula shaft. The outlet is configured such that the outlet can be connected to a pump and the length of the cannula shaft between the suture ring and the outlet is such that the cannula shaft can be guided outwards through an intercostal space.
US11052232B2
A needle assembly for a liquid applicator comprises housing with longitudinal channel. The channel comprises upper and lower open ends. A needle bundle is movably mounted in the channel, which comprises needle shaft and needles attached thereto. A biasing member is configured and mounted for (i) biasing the needle bundle longitudinally towards a retracted position and (ii) biasing the needles laterally towards a needle-guiding side wall of the housing adjacent the lower open end. The biasing member is configured and mounted to form a fluid seal between the lower and upper open ends. The biasing member comprises an elastic tubular section with opposite sides. The first side has a first rectified length. The second side has a second rectified length longer than the first rectified length so that the second side is less tensioned than the first side to bias the needles towards the needle-guiding side wall.
US11052226B2
Steerable medical devices and methods of use. In some embodiments, the steerable medical devices can be steered bi-directionally. In some embodiments the steerable medical devices include a first flexible tubular member and a second flexible tubular member secured together at a location distal to a steerable portion of the steerable medical device.
US11052225B2
There is provided an apparatus for use in a bodily lumen. The apparatus comprises a guidewire and a catheter. The guidewire has a proximal end portion and a distal end portion. The catheter has a proximal end portion and a distal end portion. The catheter includes a lumen for receiving the guidewire. The catheter is configured to be translated along the guidewire. The catheter is configured to be biased towards a translated position along the guidewire by a magnetic attraction between the guidewire and the catheter.
US11052220B2
The present disclosure pertains to a system configured to adjust a volume of auditory stimulation delivered to a subject during sleep. The system is configured to determine a deepening time indicative of a rate at which sleep of the subject deepens during the sleep session. The deepening time is determined based on (i) a ratio of power in a high frequency band of an EEG signal to power in a low frequency band, (ii) a density of slow waves, or (iii) a hypnogram, indicative of sleep depth in the subject during the sleep session. The system is configured to determine a rate of volume increase for auditory stimulation during a subsequent sleep session based on the deepening time; and control the one or more sensory stimulators to adjust the volume of auditory stimulation provided to the subject during the subsequent sleep session based on the determined rate of volume increase.
US11052219B2
A sensory activity sack provides a garment with pleasant tactile features offering safe sensory stimulation for persons with developmental or sensory disabilities and an isolation bag for the wearer's arms and hands. The isolation bag prevents the wearer from engaging in self-injurious behavior or other harmful behaviors. Multiple fabrics and textures in the isolation bag, including mesh and denim, provide a pleasing tactile experience, which can be furthered by the placement of toys into the isolation bag. Sensory panels made with a sturdy, textured material such as denim provide tactile stimulation and resistance against wear and biting, as well as adding a comforting weight to the sensory activity sack for wearers with sensory issues.
US11052215B2
A medical tube has a tube wall, a first end and a second end. At least one heater wire is wrapped around the wall. Near or at one of the first end or the second end, there is at least one recess in an outer surface of the wall. The heater wire passes over the at least one tube recess such that the wire does not contact the wall in the area of the tube recess. Also disclosed are methods of making the tube and components used in making the tube.
US11052202B2
Drug delivery devices that include a microphone and processing circuitry that can detect operating events, such as peak inspiratory flow (PIF) and Breath Actuated Mechanism (BAM) in dry powder inhalers can be used to improve clinical trials by providing information about the way in which the inhalers under test are being used.
US11052196B1
A method of providing and/or injecting octreotide acetate to a subject in need thereof includes storing the octreotide acetate in a cartridge of a multi-use multi-dose injector provided with a variable dose setter and actuator. The injector includes a needle configured for subcutaneous administration of the octreotide acetate, the octreotide acetate having a concentration of 2,500 μg/mL. The method further includes providing, on the injector, a plurality of indicia only at prescribed doses of 50 μg, 100 μg, 150 μg and 200 μg settable via the dose setter without indicia between said prescribed doses; and permitting setting of a dose of the octreotide acetate by rotation of the variable dose setter, wherein the injector is configured to provide at least one audible feedback during the rotation.
US11052190B2
Provided is a wearable, self-contained drug infusion or medical device capable of communicating with a host controller or other external devices via a personal area network (PAN). The medical device utilizes a PAN transceiver for communication with other devices in contact with a user's body, such as a physiological sensor or host controller, by propagating a current across the user's body via capacitive coupling. The wearable nature of the medical device and the low power requirements of the PAN communication system enable the medical device to utilize alternative energy harvesting techniques for powering the device. The medical device preferably utilizes thermal, kinetic and other energy harvesting techniques for capturing energy from the user and the environment during normal use of the medical device. A system power distribution unit is provided for managing the harvested energy and selectively supplying power to the medical device during system operation.
US11052187B2
A packaging for a reel of medical injection devices includes a base tray configured for supporting the reel and at least a first flat rib and a second flat rib. Each rib includes a respective slot arranged such that the ribs can be interlocked with one another by mutual engagement of the slots. The base tray includes at least two pairs of peripheral openings. Each opening is configured to receive an end of the ribs, so that the base tray and interlocked flat ribs engaging the base tray form a frame configured for enclosing the reel.
US11052184B2
A membrane separation device is disclosed along with systems and methods employing the device in blood processing procedures. In one embodiment, a spinning membrane separator is provided in which at least two zones or regions are created in the gap between the spinning membrane and the shell, such that mixing of the fluid between the two regions is inhibited by a radial rib or ridge associated with the spinning membrane that decreases the gap between the spinning membrane and the shell to define two fluid regions, the ridge isolating the fluid in the two regions to minimize mixing between the two. Automated systems and methods are disclosed for separating a unit of previously-collected whole blood into selected blood components, such as concentrated red cells and plasma, for collecting red cells and plasma directly from a donor in a single pass, and for cell washing. Data management systems and methods and priming methods are also disclosed.
US11052182B2
The present invention relates to a method for checking a dialyzer for the presence of a leak in the semipermeable membrane of the dialyzer, wherein the membrane divides the inner dialyzer space into a least one blood chamber and into at least one dialyzate chamber, wherein the blood chamber is flowed through by blood in the operation of the dialyzer and is in fluid communication with a blood-side line system and the vascular system of the patient, and wherein the dialyzate chamber is flowed through by dialysis fluid in the operation of the dialyzer and is in fluid communication with a dialyzate-side line system, wherein the method comprises the following steps: a) emptying the blood chamber or the dialyzate chamber of blood and of dialysis fluid respectively and keeping the fluid (blood or dialyzate) in the non-emptied dialyzate chamber or blood chamber; b) building up a test pressure by means of a gas, in particular by means of air, in the emptied blood chamber or in the emptied dialyzate chamber; and c) measuring the pressure drop over time in the emptied blood chamber or in the emptied dialyzate chamber or in the line system respectively in fluid communication therewith and/or measuring the pressure increase in the non-emptied blood chamber or in the non-emptied dialyzate chamber or in the line system respectively in fluid communication therewith or measuring the number of air bubbles or of a parameter correlated with the number of air bubbles in the non-emptied blood chamber or in the non-emptied dialyzate chamber or in a line system respectively in fluid communication therewith, wherein the steps a) to c) are carried out subsequent to the blood treatment of the patient and subsequent to the disconnection of the patient from the blood-side line system.
US11052181B2
A cassette integrated system. The cassette integrated system includes a mixing cassette, a balancing cassette, a middle cassette fluidly connected to the mixing cassette and the balancing cassette and at least one pod. The mixing cassette is fluidly connected to the middle cassette by at least one fluid line and the middle cassette is fluidly connected to the balancing cassette by at least one fluid line. The at least one pod is connected to at least two of the cassettes wherein the pod is located in an area between the cassettes.
US11052180B2
A system and method for balancing flows of renal replacement fluid is disclosed. The method uses pressure controls and pressure sensing devices to more precisely meter and balance the flow of fresh dialysate and spent dialysate. The balancing system may use one or two balancing devices, such as a balance tube, a tortuous path, or a balance chamber.
US11052173B2
The present disclosure relates to a biocompatible, electrically conductive polymer capable of carrying the electrical potential of a cardiac impulse. The present disclosure also relates to treatments using the electrically conductive polymer, such as for atrial fibrillation.
US11052168B2
An air germicidal treatment device and system for removing or eliminating unwanted pathogens or bacteria in an airstream is shown. The device or system has a removable irradiation chamber that divides an interior area of the device into an air pre-chamber area, an air post-chamber area and an irradiation area therebetween. The removable irradiation chamber is generally trapezoidal in shape and has end walls that are inclined with respect to an interior divider wall.
US11052163B2
The present disclosure provides peptide constructs for diagnostic imaging and therapeutic applications, using pegylated peptides which exhibit specific binding for a target molecule of interest, such as a biomarker of a disease or disorder.
US11052155B2
This invention relates to novel analogs of the DNA-alkylating agent CC-1065 and to their conjugates. Furthermore this invention concerns intermediates for the preparation of said agents and conjugates. The conjugates are designed to release their (multiple) payload after one or more activation steps and/or at a rate and time span controlled by the conjugate in order to selectively deliver and/or controllably release one or more of said DNA alkylating agents. The agents, conjugates, and intermediates can be used to treat an illness that is characterized by undesired (cell) proliferation. As an example, the agents and the conjugates of this invention may be used to treat a tumor.
US11052153B2
Compositions including a highly branched alpha-D-glucan or modified forms thereof and a solute compound are described herein. The compositions can provide increased water solubility and/or increased rate of dissolution for the solute compound. The compositions can also provide increased stability for the solute compound. Methods for preparing and using compositions including a solute compound and a highly branched alpha-D-glucan are also described.
US11052145B2
Disclosed are novel immunogenic proteins derived from Staphylococcus aureus, as well as methods for their use in conferring protective immunity against S. aureus infections. Also disclosed are nucleic acids encoding the proteins and methods of use of these nucleic acids.
US11052142B2
For the first time individual (free from impurities of penta- and hexa-acetylated derivatives) di-, tri- and tetra-acetylated S-LPS of endotoxic bacteria and combinations thereof were obtained and their immunobiological, physical-chemical and chemical-pharmaceutical properties were studied. For the first time the principal possibility of their clinical application was directly demonstrated as vaccines and pharmaceutical compositions containing the modified S-LPS individual as monocomponent or combinations thereof as two and three component active substance, respectively. The modified S-LPS and combinations thereof have high safety profile and provide low pyrogenicity and high immunogenicity. Developed on their basis vaccines and pharmaceutical compositions demonstrate anti-shock activity, high efficiency and specificity, broad-spectrum action and also good chemical-pharmaceutical parameters.
US11052141B1
Methods of mitigating the risk of rejection of an allograft or xenograft in an incompatible recipient by neutralizing one or more populations of circulating antibody cross-reactive with a carbohydrate antigen expressed by the allograft or xenograft. The method includes administering to the recipient by intravenous infusion a concentration of a synthetic antigen lipid construct sufficient to neutralize the one or more populations of circulating antibody in the recipient.
US11052137B2
The application relates to antimicrobial agents against Gram-negative bacteria, in particular to fusion proteins composed of an enzyme having the activity of degrading the cell wall of Gram-negative bacteria and a peptide stretch fused to the enzyme at the N- or C-terminus, as well as pharmaceutical compositions comprising the same. Moreover, it relates to nucleic acid molecules encoding such a fusion protein, vectors comprising said nucleic acid molecules and host cells comprising either said nucleic acid molecules or said vectors. In addition, it relates to such a fusion protein for use as a medicament, in particular for the treatment or prevention of Gram-negative bacterial infections, as diagnostic means or as cosmetic substance. The application also relates to the treatment or prevention of Gram-negative bacterial contamination of foodstuff, of food processing equipment, of food processing plants, of surfaces coming into contact with foodstuff, of medical devices, of surfaces in hospitals and surgeries.
US11052131B2
Disclosed are methods and pharmaceutical compositions for the treatment of kidney cancer. The inventors showed that while Elabela (ELA) is mostly expressed in kidney, its expression is reduced in human kidney cancer. In a xenograft animal model (sub-cutaneous, or sub-capsular injection) Ela inhibits tumor progression. In particular, there is disclosed a method of treating kidney cancer in a subject in need thereof including administering to the subject a therapeutically effective amount of an ELA polypeptide including an amino acid sequence having at least 90% of identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) wherein the arginine residue (R) at position 9, 10, 20 or 21 is optionally mutated.
US11052129B2
The present invention relates to methods of treating or preventing a complement-mediated disease and/or disorder in a subject with a complement C5 polymorphism, including administering to a subject in need thereof a therapeutically or prophylactically effective amount of an agent that a) inhibits the classical complement pathway, the alternative complement pathway and the lectin complement pathway; and/or b) inhibits eicosanoid activity. The invention also relates to methods of identifying patient populations with C5 polymorphisms that are treatable with specific agents that a) inhibit the classical complement pathway, the alternative complement pathway and the lectin complement pathway; and/or b) inhibit eicosanoid activity.
US11052125B2
The present invention discloses a composition comprising extracts of Cyperus rotundus, standardized to contain 3-5% w/w total stilbenes, extracts of Garcinia sp., standardized to contain 20% w/w garcinol and extracts of Coleus forskohlii standardized to contain not less than 10% w/w forskolin for the therapeutic management of diet induced obesity and weight gain and related conditions like liver dysfunction, NASH, NAFLD, liver cirrhosis, hypercholesterolemia, hyperlipidemia, kidney dysfunction by bringing about a reduction in body weight, increasing lean body mass and by normalizing the levels of liver enzymes, kidney markers and circulating lipids.
US11052119B2
The present invention relates to a cell-based composition comprising a suspension of mesenchymal stem cells in crystalloid with a cellular concentration from 0.01 million to 3.0 million cells/ml. The cell-based composition is used in a form of medicament for treatment of diabetes and its associated metabolic disorders and complications.
US11052118B2
The invention provides improved methods for cell therapy. In particular, the invention provides therapeutic compositions of enhanced hematopoietic stem and progenitor cells having improved engraftment and homing properties, and methods of making the therapeutic compositions. The invention further provides methods of improving the efficacy of hematopoietic stem and progenitor cell transplantation including transplanting the therapeutic composition to subjects in need of hematopoietic system reconstitution.
US11052114B2
The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules.
US11052102B2
The present invention provides novel compounds that target thrombocyte activity or aggregation capacity through cellular components for the treatment of diseases associated with Non-Alcoholic Fatty Liver Disease (NAFLD). The invention provides these compounds for treating non-alcoholic steatohepatitis (NASH), a progressed stage of NAFL (non-alcoholic fatty liver), in order to avoid the development of liver cirrhosis and Hepatocellular Carcinoma (HCC). Further provided are pharmaceutical compositions, comprising the compounds of the invention, and methods for screening new NASH therapeuticals.
US11052100B2
A nicotinamide riboside composition and preparation method thereof, the icotinamide riboside composition comprises nicotinamide riboside and/or a salt thereof and konjac glucomannan or rebaudioside A. The nicotinamide riboside composition provided by the present invention, used to increase the concentration of NAD in cells, thereby preventing and improving various unhealthy conditions caused by NAD deficiency. is stable in property and easy to store and transport.
US11052094B2
Provided herein is an ophthalmic composition formulated in deuterated water. Also disclosed herein are methods of treating, ameliorating, or reducing ophthalmic conditions or diseases by administering to an eye of an individual in need thereof an effective amount of an ophthalmic composition as described herein.
US11052092B2
The present invention provides e.g. N-{[2-(piperidin-1-yl)phenyl](phenyl)methyl}-2-(3-oxo-3,4-dihydro-2H-1,4-benzoxazin-7-yl)acetamide derivatives and related compounds as ROR-gamma modulators for treating e.g. autoimmune diseases, autoimmune-related diseases, inflammatory diseases, metabolic diseases, fibrotic diseases or cholestatic diseases, such as e.g. arthitis and asthma.
US11052089B2
In alternative embodiments, provided are compositions and methods for treating, enhancing the drug sensitivity of, and preventing the formation of cancer stems cells, including preventing or slowing the development or generation of a beta-3 (β3)-expressing, or integrin β3 (ITG-B3)-expressing cancer or tumor cells. In alternative embodiments, provided are methods using histone acetyl transferase inhibitors and/or histone methyl transferase inhibitors to determine therapeutic values in cancer cells that induce an integrin β3 (ITGB3) polypeptide expression. In alternative embodiments, provided are kits, blister packages, lidded blisters or a blister card or packet, clamshells, trays or shrink wraps, comprising at least one compound, composition or formulation used to practice a method as provided herein, and at least one Growth Factor Inhibitor.
US11052081B2
The present invention relates to therapeutic ADCs comprising SN-38 attached to an anti-Trop-2 antibody or antigen-binding antibody fragment. The ADC may be administered at a dosage of between 4 mg/kg and 18 mg/kg, preferably 4, 6, 8, 9, 10, 12, 16 or 18 mg/kg, most preferably 8 to 10 mg/kg. When administered at specified dosages and schedules, the ADC can reduce solid tumors in size, reduce or eliminate metastases and is effective to treat cancers resistant to standard therapies, such as radiation therapy, chemotherapy or immunotherapy. Preferably, the ADC is administered in combination with one or more other therapeutic agents, such as a PARP inhibitor, a microtubule inhibitor, a Bruton kinase inhibitor or a PI3K inhibitor. Most preferably, the ADC is of use for treating a Trop-2 expressing cancer, such as metastatic urothelial cancer.
US11052080B2
The present invention provides compounds of formula I, pharmaceutically acceptable salts thereof, and pharmaceutical compositions thereof. Compounds of the present invention are useful for inhibiting kinase (e.g., GSK3 (e.g., GSK3α or GSK3β) or CK1) activity. The present invention further provides methods of using the compounds described herein for treating kinase-mediated disorders, such as neurological diseases, psychiatric disorders, metabolic disorders, and cancer.
US11052078B2
Provided herein are compounds, derivatives thereof, composition comprising one or more of said compounds and derivatives, and methods for prevention and/or treatment of microbial infections and/or related diseases or conditions. The present compounds and/or derivatives thereof can be represented by Formula (II): The present methods include administering to a subject an effective amount of one or more compounds of Formula (II). In one embodiment, said microbial infections are bacterial infections. More specifically, said bacterial infections are staphylococcal infections.
US11052068B2
Pharmaceutical compositions and kits including a tyrosine hydroxylase inhibitor; melanin, a melanin promoter, or a combination thereof a p450 3A4 promoter; and a leucine aminopeptidase inhibitor are provided. Also provided are methods of treating cancer in a subject, comprising administering an effective amount of a tyrosine hydroxylase inhibitor, a melanin promoter, a p450 3A4 promoter, and a leucine aminopeptidase inhibitor to the subject in need thereof. Also provided are methods of reducing cell proliferation in a subject comprising administering an effective amount of a tyrosine hydroxylase inhibitor, a melanin promoter, a p450 3A4 promoter, and a leucine aminopeptidase inhibitor to the subject in need thereof.
US11052053B2
A nanoparticle includes a core. The core includes a bio-resorbable polyester and a hydrophilic polymer. The hydrophilic polymer is a portion of the bio-resorbable polyester or a separate polymer. An acylated human lactoferrin-derived peptide is coated onto the core. The acylated human lactoferrin-derived peptide is a peptide with the amino acid sequence SEQ ID NO. 1: KCFQWQRNMRKVRGPPVSCIKR or an amino acid sequence, which does not differ by more than 8 amino acid positions from the sequence SEQ ID NO: 1. The N-terminus of the human lactoferrin-derived peptide is acylated with a C16-monoacyl group.
US11052039B2
Provided is a cosmetic composition for skin moisturization containing a hydrolyzate extract obtained by adding a protease to the fruit of Cicer arietinum, a Rhododendron chrysanthum leaf extract and a Tricholoma matsutake extract. The cosmetic composition exhibits excellent effects on cell moisturization, intercellular moisturization and skin-barrier moisturization. In addition, the cosmetic composition is harmless to the human body and has excellent stability because it uses natural substances.
US11052038B2
Disclosed are a green environmental facial cleansing tissue with a natural plant origin and its preparation method, particularly a green facial cleansing tissue with a makeup removal function and a natural plant origin formula and its preparation method. The formula of the facial cleansing tissue consists of natural plants, honey extracts, etc., and the facial cleansing tissue is capable of avoiding skin irritation, providing a convenient and safe use, and the facial cleansing tissue is naturally decomposable and environmentally friendly.
US11052035B2
Method for treating hair comprising the successive application onto hair of polymeric layers which can be removed to a large extent or even totally in an easy manner upon request of the user by using a composition having a pH less than 7.
US11052032B2
Compositions and methods for amelioration of skin laxity and body contour are provided. Provided herein are compositions comprising a combination of peptides.
US11052031B2
An aqueous cleansing composition comprising a cationic surfactant, a nonionic surfactant, and a thickener comprising an alkoxylated methyl glucose ether, wherein a weight ratio of cationic surfactant to nonionic surfactant is greater than 0.9:1. The combination of the cationionic:nonionic surfactant ratio with the alkoxylated methyl glucose ether thickener provides the composition with cold weather stability. Cold weather stability is observed when the composition remains transparent after cold storage.
US11052030B2
A method of preparing a fine oil-in-water emulsion comprising an oil phase based on silicone and/or hydrocarbon oils, in which the oil phase particles have an average particle size of 150 nm or less. The emulsion is stabilized by a carboxy-modified silicone in combination with a C16 to 22 higher alcohol; a nonionic surfactant having a POE chain and an HLB of 5 to 10; and a dihydric glycol. The emulsions can be prepared without the use of a high-pressure emulsifying apparatus.
US11052011B2
A standing-up assistance apparatus includes a first sensor that measures a muscle potential of a lower leg of a user, a second sensor that measures a knee angle of the user, a processor that determines whether starting to assist the user in a standing-up motion from a seated state is possible, based on, at least, the measured muscle potential and the measured knee angle, and outputs an instruction signal if the processor determines that starting to assist the user in the standing-up motion is possible, and an assistance mechanism. The assistance mechanism starts assisting the user in the standing-up motion when the assistance mechanism receives the instruction signal from the processor.
US11052001B2
A mobile chair apparatus is described that comprises a drive assembly that preferably includes one or more moveable foot pedals, and drive wheels which rotate in response to rotation of the foot pedals by the mobile chair occupant, and a steering assembly which comprises two steering wheels and at least one tiller, configured such that forward and backward movement of said tiller will translate into movement of both steering wheels, wherein the drive assembly and the steering assembly concurrently enable the mobile chair occupant to propel and steer the mobile chair apparatus without assistance from another person.
US11051999B2
Patient support apparatuses, such as beds, cots, stretchers, recliners, or the like, include control systems with one or more image, radar, and/or laser sensors to detect objects and determine if a likelihood of collision exists. If so, the control system controls the speed and steering of the patient support apparatus in order to reduce the likelihood of collision. The control system may be adapted to autonomously drive the patient support apparatus, to transmit a message to a remote device indicating whether it is occupied by a patient or not, and/or to transmit its route to the remote device. The remote device may determine an estimate of a time of arrival of the patient support apparatus at a particular destination and/or determine a distance of the patient support apparatus from the particular destination.
US11051998B2
A reconfigurable portable load bearing structure which can be configured into an extended load bearing configuration or a collapsed configuration, comprising of a first, second and third plurality of rail segments that are each rotatably coupled together and a plurality of support segments or pads which are configured to selectively couple and latch into one of a plurality of positions on said first, second and third plurality of rail segments.
US11051997B2
A disposable pant-type absorbent article, such as a pant diaper, a sanitary pant or incontinence pant is described. The disposable pant-type absorbent article has a longitudinal direction (Y) and a transverse direction (X). The disposable pant-type absorbent article is adapted for a male user. A method for manufacturing such a disposable pant-type absorbent article is also described.
US11051984B2
A ventilation unit and controller device comprises a ventilation unit with a housing. The housing has an intake port permitting flow of gas into the housing and an exhaust port permitting flow of gas out of the housing. Within the housing, a motorized fan is positioned to direct gas into the housing via the intake port and out of the housing via the exhaust port. A controller capable of controlling the ventilation unit communicates with a sensor capable of detecting an environmental stimulus. A source of electric current provides power to the ventilation unit and controller device. The device further comprises a switch capable of interrupting the electric current that powers the device. The device is capable of being removably attached via fasteners to an arc flash hood, and the arc flash hood comprises a ventilation opening to permit gas discharged by the device to enter the arc flash hood.
US11051982B2
A plug for occluding an ocular canaliculus comprises a cylindrical body member having a first outer diameter. The cylindrical body member is provided along an external surface with at least one outwardly extending projection having a second outer diameter greater than the first outer diameter and larger than an inner diameter of an ocular canaliculus. The first outer diameter of the plug is typically less than and approximately equal to the inner diameter of the canaliculus.
US11051981B2
Devices, systems, and methods for performing an ophthalmic procedure in an eye are disclosed. The devices include a hand-held portion and a distal, elongate member coupled to the hand-held portion having a lumen operatively coupled to a vacuum source. A drive mechanism operatively coupled to the elongate member is configured to oscillate the elongate member. When in use, the device is configured to aspirate ocular material from the eye through the lumen. The drive mechanism retracts the elongate member with a retraction speed profile and advances the elongate member with an extension speed profile. The retraction speed profile is different from the extension speed profile.
US11051977B2
An eye treatment apparatus is described. The apparatus includes an annular body that has a hollow optical zone in its center. An inner perimeter of the annular body surrounds the optical zone. The inner perimeter has a diameter that corresponds to a diameter of the eye's cornea. An outer perimeter of the annular body has a diameter such that the annular body can extend to underneath the eye lid in an open eye position when the eye treatment apparatus is in operation. In this way, the apparatus can be worn on the eye, where the hollow optical zone substantially corresponds to the cornea and does not interfere with the field of vision. The annular body also includes a storage chamber that stores therapeutic liquid for an eye. An outlet is coupled with the storage chamber such that, in operation, the therapeutic liquid can be dispensed to the eye.
US11051970B2
A single use device for capturing fecal matter excreted from the anus of a user. The device includes a flexible fecal matter container having a closed end and an opening that is in fluid communication with a volume enclosed by the flexible container. An adhesive is disposed about the opening of the flexible container and has a first side that is secured to the flexible container. A second side of the adhesive is constructed to be removably applied to the epidermis of the user proximate an anal opening of the user. The adhesive is shaped to cooperate with the epidermis to circumscribe the anus in a sealed manner without interfering or overlapping anatomy associated with urinary function or medical devices, such as a catheter, associated therewith.
US11051969B2
An adaptable ostomy base plate comprising a flexible top film, having a first section and a second section, and having at least a first elastic skin-friendly adhesive on a proximal surface of said flexible top film, a stoma-receiving through-going hole defining an inner boundary in said first section, said first section being adjacent to and extending radially from said through-going hole and said second section surrounding said first section defining an outer boundary of the base plate, and one or more release liners, the base plate has a substantially convex shape for initial engagement with a peristomal skin surface and can be inverted to a substantially concave shape to fittingly engage to a topography of the peristomal skin surface and the second section of the base plate is in the form of a plurality of petals extending away from the central area; and a plurality of bridges, each bridge formed between adjacent petals of the plurality of petals.
US11051964B1
A posture supportive garment for supporting for a user's chest, back, and shoulders, while simultaneously reinforcing body alignment in the thoracic region to improve posture may include a bra structure having right and left cups sized to accommodate a user's breasts; a support base sized to encircle a user's torso, the support base attached to a bottom portion of the right and left cups; and right and left shoulder straps ultimately attached to the right and left cups, respectively, and the support base, wherein each of the right and left cups includes a compression sling; each of the right and left shoulder straps includes a lined compression panel; and the support base is made of a compression material.
US11051960B2
There is disclosed a control system for controlling the inflation of a balloon in a balloon stent catheter arrangement including (i) a transducer adapted to receive a source of intracoronary arterial pressure in a patient's coronary artery and to provide arterial pressure waveform data indicative of the status of a patient's cardiac cycle based upon the intracoronary arterial pressure, (ii) a processing system adapted to process the arterial pressure waveform data, and (iii) an inflation pump adapted to inflate the balloon. The processing system is adapted to cause the inflation pump to inflate the balloon in diastole, corresponding to about 55% to about 85% of a single R-R interval of the cardiac cycle, by an amount sufficient to achieve fixation of the stent at a target site in the coronary artery.
US11051957B2
Systems, devices and methods for control of a prosthetic or orthotic device (POD) based on electromyography (EMG) signals are described. The POD may be a lower or upper limb POD having one or more joints. One or more EMG sensors may detect the EMG signals. The EMG sensors may be external, subcutaneous, intraperitoneal, epimysial, intramuscular, or other types. Control of the POD may be based on EMG and non-EMG signals, such as velocity, acceleration, position, force, etc. Voluntary and/or automatic control may be implemented, for example with voluntary muscle contractions and/or data based on velocity, acceleration, position, force, etc. In some embodiments, the neutral position of an ankle POD is adjusted based on EMG signals.
US11051956B2
A prosthesis cosmetic element for a prosthesis comprising a prosthesis joint which has an upper part and a lower part that is mounted thereon in a pivotal manner about a pivot axis, the prosthesis cosmetic element has a first frame part, which has at least one first securing device for fixing on the lower part, and a second frame part with at least one second securing device for securing on the upper part. The frame parts are mounted in a pivotal manner relative to each other, and the prosthesis joint is equipped with a rotational element on which an actuating element is arranged. The actuating element is accessible from the outside by a frame part or through a frame part.
US11051954B2
An expandable support device for tissue repair is disclosed. The device can be used to repair hard or soft tissue, such as bone or vertebral discs. A method of repairing tissue is also disclosed. The device and method can be used to treat compression fractures. The compression fractures can be in the spine. The device can be deployed by compressing the device longitudinally resulting in radial expansion.
US11051951B2
An expandable inter-body fusion device is presented. The expandable inter-body fusion device can have a first plate, a second plate, and an insert positioned substantially therebetween the first plate and the second plate. The first plate, the second plate, and the insert define an interior cavity. Moving the insert longitudinally with respect to the first and second plates increases or decreases the distance of the first plate with respect to the second plate, effectively expanding the inter-body fusion device and increasing the volume of the interior cavity.
