US09129139B2
A solid state memory including a processor and a method for protecting the digital contents of the solid state memory. The microprocessor inserts at least an interruption during a copying or a reading of the digital contents and proceeds with the copying or reading only subsequent to a verification of a PIN or other user action. In particular, the verification provides control to ensure that the PIN is inserted manually. Access may be prevented if a time elapsed between the interruption and inputting of a PIN is shorter than a threshold time representing a speed of manual input, or if the PIN does not correspond to a sequence of requests for access to selectable files, which may be virtual files. The interruption may comprise substituting altered or cryptographic data if verification fails, or reproduction of an audio or visual message to be understood by the user.
US09129122B2
A signature verification apparatus including a signature acquisition unit configured to acquire a digital signature including first information generated based on a pair of multi-order multivariate polynomials F=(f1, . . . , fm) defined in a ring K, a signature key s which is an element of a set Kn, and a document M and a plurality of pieces of second information for verifying that the first information is generated using the signature key s based on the data M, the pair of multi-order multivariate polynomials F, and vectors y=(f1(s), . . . , fm(s)), and a signature verification unit configured to verify legitimacy of the document M by confirming whether or not the first information is restorable using the plurality of pieces of second information included in the digital signature. The pair of multivariate polynomials F and the vectors y are public keys.
US09129118B1
A technology is described for making a decision based on identifying without disclosing the identifying information. The method may include receiving a mapping value that represents identifying information that has been converted into a mapping value. A request for data associated with the identifying information may be made by providing the mapping value as a proxy for the identifying information whereby the data associated with the identifying information may be located using the mapping value and returned to a requesting client or service.
US09129114B2
Booting an operating system that includes a secure preboot environment that performs integrity checks against security threats. A computer system boots to a preboot environment, which performs integrity checks and other anti-malware operations. Once the preboot environment finishes, the system reboots into a regular environment. The preboot environment can reside on a secure portion of a flash memory, with a computer system booting therefrom; or the preboot environment can reside securely in the computer system. The preboot environment includes integrity checks for a regular environment, and anti-malware programming. Once the preboot environment is done, the computer system reboots into a regular environment, such as from the flash memory or on the computer system. The integrity checks confirm that files in the regular environment are unchanged or uninfected. The integrity checks include determining the accuracy of a trusted system configuration on the computer system, such as using a TPM.
US09129111B2
A method is provided of protecting a computer against malware affection. The computer has a data storage and an operating system for managing the data storage. The method comprises providing a filter module in the operating system which operates to detect an attempt to store data in the data storage, to determine a data format of the data to be stored in the data storage, and to prevent storage of the data if the data format is determined to relate to a predefined type. The filter module may be provided as a file system filter driver in a kernel of the operating system. The filter module may be arranged to operate between an input/output manager of the operating system and a driver associated with the data storage. The input/output manager and driver associated with the data storage may form part of the kernel of the operating system.
US09129108B2
Disclosed is a method and system to operate a governed data processing system in concert with a governing data processing system. The method includes operating a secure governing data processing system to monitor operation of at least one governed data processing system to detect a deviation from modeled user and governed data processing system behavior. The method further includes, upon detecting a deviation from the modeled behavior, taking proactive action to mitigate an occurrence of a potential adverse result of an occurrence of a cyber-security threat.
US09129106B2
Security systems can provide secure and efficient in-VM monitoring. An exemplary security system can be built upon hardware virtualization features and can comprise a virtual machine having a plurality of standard virtual address spaces, as well as a hidden virtual address space. While the standard virtual address spaces can be directly accessible by a kernel in the virtual machine, the hidden virtual address space can be hidden from the kernel, which can be absent a virtual page table corresponding to the hidden virtual address space. A security monitor can reside in the hidden address space, monitoring the kernel without being modifiable by the kernel. A processor can transfer focus from the standard virtual address spaces to the hidden virtual address space only through predetermined entry gates, and the processor can transfer focus from the hidden virtual address space to the standard virtual address spaces only through predetermined exit gates.
US09129105B2
Techniques for managing accounts are provided. An access management system may check out credentials for accessing target systems. For example a user may receive a password for a period of time or until checked back in. Access to the target system may be logged during this time. Upon the password being checked in, a security account may modify the password so that the user may not log back in without checking out a new password. Additionally, in some examples, password policies for the security account may be managed. As such, when a password policy changes, the security account password may be dynamically updated. Additionally, in some examples, hierarchical viewing perspectives may be determined and/or selected for visualizing one or more managed accounts. Further, accounts may be organized into groups based on roles, and grants for the accounts may be dynamically updated as changes occur or new accounts are managed.
US09129094B2
A syndication system facilitates rights management services between media content owners and media hosting services that elect to participate in the syndication system and mutually elect to participate with each other. The syndication system utilizes a content recognition system to identify hosted media content and ownership rights associated with the hosted content. By applying melody recognition, the content recognition system can identify compositions embodied in hosted media content even when these compositions do not precisely match any known sound recording. Thus, the content recognition system is beneficially able to detect, for example, recorded cover performances and recorded live performances embodied in hosted media content. Once identified, ownership information is determined and the syndication system can facilitate rights management policies associated with the content such as monetizing or blocking the protected content.
US09129087B2
Systems and methods are provided for aggregating digital access rights owned by a group of individuals and for correlating access rights to physical presence of the users to more accurately control access and distribution of copyrighted media. The intersection of content authorization information associated with each individual of a group may be analyzed. The aggregation and analysis of digital access rights enables multiple users to share the cost of a digital access right to access a content asset in a common area.
US09129081B2
A system and method for synchronizing the display and edit of a plurality of connected layouts or documents within a single display. A first document or plurality of elements may be displayed as active and a second document or plurality of elements may be displayed as non-active background in a first window. The second document or plurality of elements may be displayed as active and the first document or plurality of elements may be displayed as non-active background in a second window. Any action detected in either window may be displayed in the other window. Upon selection of any active element or predefined net list, the elements physically or logically connected to the selected element or net list may be highlighted in the active documents, listed, or otherwise identified. An inter-document net list may identify connections between existing net lists in multiple documents.
US09129076B2
For improving wafer fabrication, yield and lifetime of wafers are predicted by determining coefficients of a yield domain for wafer yield prediction and a lifetime domain for a wafer lifetime prediction, an integral domain, an electric/layout domain, a metrology/defect domain, and a machine sensor domain in a hierarchical manner. With the aid of the hierarchically-determined coefficients, noises in prediction can be reduced so that precision of prediction results of the yields or the lifetimes of wafers can be raised.
US09129072B2
A finite state machine is provided that both serializes virtual GPIO signals and deserializes virtual GPIO signals responsive to cycles of an external clock. The finite state machine frames the serialized virtual GPIO signals into frames each demarcated by a start bit and an end bit.
US09129068B2
Methods and structure are provided for “spoofing” an active connection between a Serial Attached SCSI (SAS) initiator and a SAS target. The structure includes a SAS expander, comprising multiple physical links with associated transceivers (PHYs), switching hardware, a memory, and a control unit. Each PHY is operable to receive incoming Open Address Frames (OAFs) from SAS initiators that request connections with target devices. The switching hardware is operable to selectively link PHYs of the expander with each other to enable connections between initiators and target devices. The control unit is operable to determine that a connection requested by a received OAF cannot be completed, is operable to transmit an OPEN ACCEPT to the SAS initiator that transmitted the OAF responsive to making the determination, and is operable to store I/O received from the SAS initiator for the requested connection in the memory, responsive to transmitting the OPEN ACCEPT.
US09129066B2
Systems and methods for operating a universal serial bus are described herein. The method includes sending packet data from a USB2 device to a USB2 host on a pair of signal lines, and after sending the packet data, sending an End-Of-Packet (EOP) signal from the USB2 device to the USB2 host. The method also includes, entering the USB2 device into idle state after sending the EOP signal. The method also includes sending a digital ping from the USB2 device to the USB2 host to indicate device presence during idle state.
US09129062B1
Systems and methods for instrumenting code are disclosed. The entry to a subroutine is trapped and the subroutine's return address is mutated to create an invalid instruction pointer. The mutated return address is stored in the architecture reserved space for the return address. An exception handler is executed that has been instrumented to handle the fault caused by the mutated return address such that the exit from the subroutine is instrumented.
US09129059B2
Techniques suitable for identifying potential subjects for a clinical trial and other applications are disclosed. One or more exclusion or inclusion criteria are defined for the clinical trial. One or more specialized searching tables are pre-generated using administrative healthcare claims data and the one or more exclusion or inclusion criteria. The specialized searching tables are searched. Through the searching step, subjects are identified within the administrative healthcare claims data who match the one or more exclusion or inclusion criteria. Through the searching step, a geographical area is identified corresponding to the subjects who match the one or more exclusion or inclusion criteria. A customized report is generated using the identified subjects and geographical area.
US09129048B2
An ultrasound imaging system including a user interface configured to receive user inputs from an operator during an imaging session. The user interface includes a display device having a display area and an image-processing module that is configured to receive ultrasound signals from a diagnostic probe and process the signals to generate ultrasound images. The system also includes a workflow module that is configured to display, concurrently, an acquired image of the ultrasound images and a user-selectable element in the display area. The acquired image includes an anatomical feature of a subject. The workflow module is configured to display an activated frame over the acquired image in the display area when the user-selectable element is selected by the operator. The activated frame appears partially transparent such that the anatomical feature is visible through the activated frame.
US09129047B2
A programming device for an implantable drug pump includes a display device, a communication device, and a controller. The communication device is adapted to facilitate a communication link between the programming device and an implantable drug pump. The controller adapted to receive bolus data stored on the implantable drug pump when the communications link has been established, to process the bolus data, and to control the display device to generate a visual representation of numbers of bolus attempts for multiple periodic time intervals.
US09129046B2
A system for managing a master patient index is described. The master patient index database is constructed using inverted indices. The inverted index formulation enables faster, more complete and more flexible duplicate detection as compared to traditional master patient database management techniques. A master patient index management system including a remote user interface configured to leverage the inverted index formulation is described. The user interface includes features for managing records in an MPI database including identifying, efficiently comparing, updating and merging duplicate records across a heterogeneous healthcare organization.
US09129041B1
The disclosed embodiments relate to a system that updates a context that facilitates evaluating qualitative search terms for an attribute during query processing. During operation, the system extracts a value for the attribute from each data item in a set of data items. Next, the system updates the context based on the extracted attribute values, wherein the context includes a concept-mapping for one or more qualitative search terms applied to the attribute, and wherein each concept-mapping associates a given attribute value with a numerical compatibility index that indicates a compatibility between the given attribute value and a corresponding qualitative search term.
US09129039B2
A system and method of integrating diverse sources of data and data streams is presented. The method can include selecting a scenario based on a topic, creating a multi-relational directed graph based on the scenario, identifying and converting resources in accordance with the scenario and updating the multi-directed graph based on the resources, identifying data feeds in accordance with the scenario and updating the multi-directed graph based on the data feeds, identifying analytical routines in accordance with the scenario and updating the multi-directed graph using the analytical routines and identifying data outputs in accordance with the scenario and defining queries to produce the data outputs from the multi-directed graph.
US09129038B2
Software development items can be represented in a graph data structure. Relationships between the represented items can be detected and reflected in the graph data structure. Queries can be run against the data structure to determine which software development items are related to each other. Implicit query can be implemented in a software development context. A graph browser can present panes showing related items.In some embodiments, a set of regular expressions can be used to identify paths in a graph. Probability scores for the identified paths can be computed. Path data for the identified paths, including the probability scores, can be stored in a searchable location accessible by one or more applications. A query of the path data can be processed to return query results associated with at least one of the identified paths.
US09129035B2
In one embodiment, markup representation of a data set is requested at a relational data store. The data set has a first portion stored at a first table structure of the relational data store and a second portion stored at a second tale structure of the relational data store. The markup representation of the data set is received from the relational data store and an object representation of the data set is generated based on the markup representation of the data set. The object representation of the data set includes a first element having a value of the first portion and a second element having a value of the second portion.
US09129032B2
An aspect of the present invention relates to tracking a computer user's web browsing behavior by collecting web browser click events as a clickstream and and processing the clickstream in a parallel processing architecture.
US09129024B2
A method and computer program product for conducting a weighted keyword search and a method for displaying search results. A computer determines respective weights of respective keywords, based on proximity of a user interaction position to the respective keywords on a graphical presentation. The computer conducts a weighted keyword search of documents based on the keywords and the respective weights of the keywords. In a method of displaying search results, based on the respective weights, a computer displays the search results associated with the respective keywords.
US09129021B2
A computer-based search engine for performing a search for a keyword, comprising a result responsive to a search, a database comprising a plurality of terms organized by categories wherein at least one of the categories includes the keyword, and relational ones of the plurality of terms to the keyword; a heuristic engine comprising a plurality of rules which, when executed by a processor, applies the rules in accordance with the relational ones of the plurality of terms to a networked site to assess the keyword as a primary subject of the networked site.
US09129015B1
Systems and methods are provided herein relating to audio matching. Descriptors can be generated for a received audio signal and matched with reference descriptors. Potential matching reference samples can then be filtered based on, at least in part, a number of hits, a match threshold, and a window size. As more hits are accumulated for a reference sample, the more likely the reference sample is to pass through the filter. Eliminating potential false positive matches before performing more computational demanding matching algorithms can increase efficiency within an audio matching system.
US09129013B2
Techniques for entity detection include matching a token from at least a portion of a text string with a matching concept in an ontology. A first concept may be identified as being hierarchically related to the matching concept within the ontology, and a second concept may be identified as being hierarchically related to the first concept within the ontology. The first and second concepts may be included in a set of features of the token. Based at least in part on the set of features of the token, a measure related to a likelihood that the at least a portion of the text string corresponds to a particular entity type may be determined.
US09129006B2
A device determines an additional component added to a second model, and a modification component modified in a third model, wherein a condition includes a wild card, and a first model are described in a module, the first model serving as a model when the module is applied to a model satisfying the condition and including a variable in which a string in a model satisfying the condition is stored, and the third model is a model when the module is applied to the second model satisfying the condition and where a string in the second model, which corresponds to the wild card, is stored in a variable, based on a word in a fourth model, and a word in the additional component and the modification component, calculates a degree regarding numbers of the word in the third model and the fourth, and creates a tag corresponding to the module.
US09129000B2
According to one embodiment of the present invention, a system enables control of database applications. The system comprises a computer system including a database application to provide access to a database system, and at least one processor. The computer system requests retrieval of application specific property information for the database application from a data repository, and applies the retrieved application specific property information to the database application to control operation of the database application. Embodiments of the present invention further include a method and computer program product for controlling database applications in substantially the same manner described above.
US09128998B2
Systems and methods for use in presenting a hierarchy of data objects. Data objects in a hierarchy are each associated with a node type of a plurality of node types. A graphical representation of the hierarchy is created. The graphical representation includes including a plurality of strata corresponding to the plurality of node types. A plurality of tree nodes representing the data objects is created. Each tree node is associated with the node type that corresponds to the associated data object. The tree nodes associated with the node type that corresponds to the stratum are included in each stratum of the plurality of strata. The graphical representation may include hierarchical connectors extending between the tree nodes and representing hierarchical relationships between the data objects represented by the tree nodes.
US09128996B2
In some implementations, a method includes receiving a first data set that is stored using a first format, generating an info item based on the first data set, the info item representing an entity extracted from the first data set, generating a delta item based on the first data set, the delta item including a reference to the info item and defining a context-based modification of the info item, generating a second data set in a second format comprising the info item and the delta item, and storing the second data set to the computer-readable storage medium.
US09128990B2
The present invention extends to methods, systems, and computer program products for executed stored procedures at parallel databases. Stored procedures are transformed so that execution of the stored procedure is split between a standalone database server and a parallel database coordinator. Execution of the stored procedure is initiated at the standalone database server. At execution time, control-flow statements, variable assignment, expression evaluation, etc., are handled by the standalone database server. SQL statements are passed from the standalone database server to the database for the execution. Results from executed SQL statements can be returned to the standalone database server or to a client. The parallel database coordinator can be added as a linked server to the standalone database server. In some embodiments, a session token is used to share session state between different parties.
US09128984B2
Computer-implemented and associated operating methods evaluate robustness of a query plan by measuring performance with regard to a range of runtime conditions and producing a map of relative performance of the given query plan when compared with alternative plans for a range of conditions. The computer-implemented system comprises logic that evaluates the selected query plan in comparison to multiple alternative query plans in a predetermined range of runtime conditions that include data characteristics. The logic produces a set of performance measurements and analyzes the measured performance to map performance of the selected query plan in comparison to performance of one or more alternative query plans.
US09128983B2
In accordance with certain embodiments, a query from a client may be received at a server, and a default query range may be applied to the query. The query may be executed in a first execution using an index comprising a category of information stored in the database and subject to the default query range. If the number of query results from the first execution is outside a predetermined range, then the query range may be adjusted to obtain a number of query results closer to or within the predetermined range. Additionally, the query may be executed in a second execution using the index comprising the category of information stored in the database and subject to the adjusted query range. Thereafter, the query results obtained from the second execution of the query may be sent to the client.
US09128976B2
An IMS DEDB database restructure operation creates an empty offline DEDB having the desired structure. The offline database is populated with data from a source (online) database while keeping the source database online (i.e., available for access and update operations). Updates to the source database made during this process are selectively processed in parallel with the offline DEDB load operation. When the contents of the offline database is substantially the same as the source or online database, the source database is taken offline, final updates to the offline database are applied whereafter the offline database is brought online, thereby replacing the source database. It is significant to note that updates occurring to the source or online DEDB are applied to the offline DEDB.
US09128975B2
A system and method to dynamically update a data field are disclosed. In some embodiments, data may be received from a plurality of databases and organized into a plurality of data fields. A first data field may be associated with a single database of the plurality of databases. A user may modify the first data field and the system and method may identify a dependency between the first data field and at least a second data field. The second data field may be updated based on the dependency between the first data field and the second data field.
US09128966B2
Aspects provide a method of determining a storage location for a data item, including providing first and second data storage locations, the first location having an appreciably faster access speed than the second, the data storage locations are primary storage locations providing persistent storage, accessing a score associated with the data item, the score being calculated based on a frequency of access; and selecting only one of the storage locations based on the score with respect to other data scores, wherein the data item is stored in only one of the storage locations at any time, re-calculating the scores, wherein the score is accessed from a score table of data items; and in response to re-calculating of the scores, causing a change in the selection of the data storage location, removing the data item from a current storage location and adding the data item to a newly selected storage location.
US09128962B2
A method includes identifying a table over a conventional database used by an application, creating a view of the table equivalent to the identified table in an in-memory database, and calling the view with a same call as used for the identified table such that calling the view via the application provides a same result as would have been obtained from the same call to the table in the conventional database.
US09128947B2
Embodiments of the present invention may include an apparatus and method for automatically installing mobile versions of software applications on a mobile device using quick response (QR) code technology. A software application may initially be loaded on a personal computer in response to a user request. The personal computer may determine if there is a mobile version of the software application available. If there is a mobile version available, the personal computer may generate a QR code that represents an encoded version of a link for the mobile version of the software application. Subsequently, the QR code may be displayed on a display device of the personal computer for the user to scan and access the mobile version of the software application on his/her mobile device.
US09128943B1
A method for tracking resizing and recreation of volumes in a block-based snapshot backup program. In an embodiment, a record ID is associated with a major and minor number assigned to each volume to be backed up. The record ID maintains a unique reference to the bitmap corresponding to a backed up volume in case the minor number is reused by the volume manager driver during a recreate operation. The length of the volume to be maintained is maintained and compared to the length of the to track any resizing of the volume by the volume manager. In the event of any resizing or recreation, the original bitmap can be replaced with an updated bitmap to ensure proper backup of the resized or recreated volumes.
US09128942B1
Many applications and computing environments allow users to migrate data from a source object to a target object (e.g., a file may be cut/pasted, copied, etc.). It may be advantageous to provide users with access to the data (e.g., migrated data at the target object and/or data that has yet to be migrated from the source object) before all of the data is completely migrated (e.g., a user may otherwise have to wait hours for a 2 TB file to be copied between various data volumes). Accordingly, as provided herein, migration of a source object to a target object may be declared as completed, even though the target object may not comprise all of the data that is to be migrated. In this way, an I/O request may be satisfied based upon migrated data within the target object and/or data, not yet migrated, retrieved on-demand from the source object.
US09128941B2
Communications to a server over an in-band communications channel are monitored for requests to access a file. Based on the communications, a request to access a particular file stored by the server is identified. Security and/or audit rules are identified based on the request. A determination is thereafter made that the security and/or audit rules require evaluation of classification information for contents of the requested file. Thus, a determination is made as to whether classification information for the contents of the particular file is available, such as determining whether the classification information is stored in a local classification cache. Responsive to a determination that the classification information is not available, classification information is obtained for the contents of the particular file using an out-of-band communications channel. Thereafter, processing with respect to the request to access the particular file is performed based on the obtained classification information and the one or more security and/or audit rules.
US09128934B2
A user interface for presenting and searching relationships between document objects located on a network is described. The user interface may include a first portion of a screen display for displaying one or more link relationship attributes and a second portion of the screen display for displaying one or more entries from a group consisting of: (a) link references that represent the document objects, (b) link relationship attributes describing the link relationships, (c) link reference attributes describing the link references, and (d) document objects. The displayed entries in the second portion of the user interface are related to the displayed one or more link relationship attributes in the first portion.
US09128933B2
A named entity input is received and a target sense for which the named entity input is to be extracted from a set of documents is identified. An extraction complexity feature is generated based on the named entity input, the target sense, and the set of documents. The extraction complexity feature indicates how difficult or complex it is deemed to be to identify the named entity input for the target sense in the set of documents.
US09128931B2
A system and method of communicating information associated with an appliance is provided. An appliance can present an optical machine-readable representation, such as a linear or matrix barcode, on a display of the appliance. The optical machine-readable representation can encode information associated with an event occurrence for the appliance. A client, such as a computer, smartphone, tablet, etc., can capture information indicative of the optical machine-readable representation. The client computing device can then access information, such as diagnostic information, responsive to the optical machine-readable representation.
US09128928B2
A flash memory device apparatus and method is provided such that data or programming information is uploaded or downloaded between the flash memory device and a host, in response to a single-press of a button associated with the flash memory device. The system can facilitate a number of operations including saving an active window application or associated data, transferring media files to or from media players, providing device-specific and/or data-specific transfer of applications or data and/or providing protection of transferred data or applications.
US09128914B2
Disclosed is a semiconductor integrated circuit capable of efficiently performing debugging. The semiconductor integrated circuit includes a distributing part distributing received packets according to destinations of the packets, a plurality of accumulating parts sequentially accumulating the packets distributed thereto, respectively, a plurality of relaying parts supplying the packets accumulated in one of the accumulating parts to corresponding one of the processing parts, respectively, and an output controlling part assigning the relay permission command to one relaying part designated by a relay permission packet from among the relaying parts when a packet distributed thereto from the distributing part is determined as the relay permission packet.
US09128907B2
A text in a corpus including a set of world wide web (web) pages is analyzed. At least one word appropriate for a document type set according to a voice recognition target is extracted based on an analysis result. A word set is generated from the extracted at least one word. A retrieval engine is caused to perform a retrieval process using the generated word set as a retrieval query of the retrieval engine on the Internet, and a link to a web page from the retrieval result is acquired. A language model for voice recognition is generated from the acquired web page.
US09128903B2
Upon a receipt of an advance notice, an active system computer on which asynchronous replication is performed with a standby system computer stops a business application and transmits to the standby system computer transmission start information indicating start of data synchronization, data accumulated in a transmission queue 118, and transmission completion information indicating completion of the data synchronization in this order. The standby system computer generates and holds first reliability guarantee information indicating that the data received before the transmission start information upon a receipt of the transmission start information, and generates and holds second reliability guarantee information indicating that the data received before the transmission completion information is reliable data upon a receipt of the transmission completion information. Accordingly, while taking advantages of the asynchronous replication to the data replication, reliability of data backed up on the standby system computer is guaranteed upon a failure.
US09128884B2
One or more techniques and/or systems are provided for hosting a virtual machine from a snapshot. In particular, a snapshot of a virtual machine hosted on a primary computing device may be created. The virtual machine may be hosted on a secondary computing device using the snapshot, for example, when a failure of the virtual machine on the primary computing device occurs. If a virtual machine type (format) of the snapshot is not supported by the secondary computing device, then the virtual machine within the snapshot may be converted to a virtual machine type supported by the secondary computing device. In this way, the virtual machine may be operable and/or accessible on the secondary computing device despite the failure. Hosting the virtual machine on the secondary computing device provides, among other things, fault tolerance for the virtual machine and/or applications comprised therein.
US09128883B2
A resource allocation system begins with an ordered plan for matching requests to resources that is sorted by priority. The resource allocation system optimizes the plan by determining those requests in the plan that will fail if performed. The resource allocation system removes or defers the determined requests. In addition, when a request that is performed fails, the resource allocation system may remove requests that require similar resources from the plan. Moreover, when resources are released by a request, the resource allocation system may place the resources in a temporary holding area until the resource allocation returns to the top of the ordered plan so that lower priority requests that are lower in the plan do not take resources that are needed by waiting higher priority requests higher in the plan.
US09128880B2
Method and apparatus to manage software updates of networked data collection devices are disclosed. Example disclosed methods involve in response to receiving a software update, determining if the data collection device is to receive the software update and, if the data collection device is to receive the software update, setting, in memory, a state indicator for the data collection device to an update state. Disclosed methods also include in response to receiving a configuration request from the data collection device when the corresponding state indicator is set to the update state, sending an update command to the data collection device, the update command to include a bill of materials corresponding to the software update and a time for the software update to take effect.
US09128874B2
A method of using microphones to measure a particle velocity comprises steps: arranging a sound source, a first microphone and a second microphone in a space, wherein the first microphone is arranged between the sound source and second microphone, and wherein the first microphone is located at a first position and the second microphone is located at a second position more far away from the sound source than the first position; using the first and second microphones to measure the sound source and obtain first and second acoustic pressures respectively; using the first and second positions and an equivalent source method to establish a free-space Green's function, and using the first and second acoustic pressures and the equivalent source method to establish an acoustic pressure function; and using the free-space Green's function and acoustic pressure function to predict state space of sound amplitude and then obtain a particle velocity.
US09128873B2
Memory bus attached Input/Output (‘I/O’) subsystem management in a computing system, the computing system including an I/O subsystem communicatively coupled to a memory bus, including: detecting, by an I/O subsystem device driver, a hibernation request; setting, by the I/O subsystem device driver, a predetermined memory address to a value indicating that the I/O subsystem is not to service system requests; detecting, by the I/O subsystem device driver, that the I/O subsystem device driver has been restarted; and setting, by the I/O subsystem device driver, the predetermined memory address to a value indicating that the I/O subsystem can resume servicing system requests.
US09128871B2
Methods and apparatuses for enhanced protection of data stored in a non-volatile memory system involve a controller capable of adapting to the failure of one or more non-volatile memory devices in the memory system. The controller stores data in the form of page stripes, each page stripe composed of data pages, and each data page stored in a different non-volatile memory device. The controller also detects failure of a non-volatile memory device in which a data page of a particular page stripe is stored, reconstructs the data page, and stores the reconstructed data page in a new page stripe, where the number of data pages in the new page stripe is less than the number of data pages in the particular page stripe, and where no page of the new page stripe is stored in a memory location within the failed non-volatile memory device.
US09128854B1
A method, computer program product, and computing system for monitoring data requests made by an application being executed on a host to generate a prediction concerning a quantity of data that may be needed by the application in the future. The quantity of data is stored within a backend cache system included within a data array coupled to the host. The quantity of data is provided to the host.
US09128853B1
Systems, methods, and other embodiments associated with a lookup structure for a large block cache are described. According to one embodiment, at least two blocks of data are stored in a cache. A lookup entry is constructed that describes the at least two blocks of data. The lookup entry includes block specific information that describes individual blocks of the at least two blocks of data. The lookup entry is stored in the lookup structure.
US09128852B2
Embodiments of the invention relate to prefetching data on a chip having at least one scout core, at least one parent core, and a shared cache that is common between the at least one scout core and the at least one parent core. A prefetch code is executed by the scout core for monitoring the parent core. The prefetch code executes independently from the parent core. The scout core determines that at least one specified data pattern has occurred in the parent core based on monitoring the parent core. A prefetch request is sent from the scout core to the shared cache. The prefetch request is sent based on the at least one specified pattern being detected by the scout core. A data set indicated by the prefetch request is sent to the parent core by the shared cache.
US09128851B2
Embodiments relate to a method and computer program product for prefetching data on a chip. The chip has at least one scout core, multiple parent cores that cooperate together to execute various tasks, and a shared cache that is common between the scout core and the multiple parent cores. An aspect of the embodiments includes monitoring the multiple parent cores by the at least one scout core through the shared cache for a shared cache access occurring in a base parent core. The method includes saving a fetch address by the at least one scout core based on the shared cache access occurring. The fetch address indicates a location of a specific line of cache requested by the base parent core.
US09128844B2
Embodiments relate to cluster-centric tiered storage with a flexible tier definition to support performance of transactions. Object data is distributed in a multi-tiered shared-nothing cluster. Hierarchical tiers of data storage are assigned different roles within the hierarchy. The tiers are arranged according to a number of cycles required to access a tier. The tiers are managed globally across the cluster and objects are placed in tiers according to a flexible tier definition and the tier arrangement. The probability of object access is computed for objects, and objects are placed on different tiers responsive to the computation and the number of cycles required to access the tier. Objects are moved between tiers responsive to a probability frequency of object access.
US09128838B2
A system and method for direct memory access (DMA) operation provides for receiving DMA requestors, assigning the received DMA requestors to one or more of a plurality of DMA engines for processing the received DMA requestors, and if one of the received DMA requestors is a safety requestor, assigning the safety requestor to at least two DMA engines of the plurality of DMA engines for processing the safety requestor, disabling a bus interface for coupling at least one DMA engine of the at least two DMA engines to memories, comparing the outputs of the at least two DMA engines, and generating an error message if the comparison of the outputs of the at least two DMA engines are different from each other.
US09128835B2
Various embodiments are directed to a gaming device including a background memory validation system. The background memory validation system includes a background kernel thread that validates read-only pages on the gaming device. Additionally, the background kernel thread also minimizes potential timing problems because this process only validates page content in memory that is fully-loaded and functional.
US09128834B2
Implementing memory module communications with a host processor in multiported memory configurations
A method, system and computer program product are provided for implementing ECC (Error Correction Codes) memory module communications with a host processor in multi-ported memory configurations in a computer system. Each of multiple memory modules operating in unison is enabled to identify which memory module is the one required to communicate module specific information back to the host processor. All of the multiple memory modules operating in unison are enabled to generate back to the host processor a valid ECC word, while other multiple memory modules individually being unaware of data contents of the one memory module required to communicate back to the processor.
US09128831B2
An electrical device includes a plurality of apparatus connected with a daisy chain connection through a communication line so that the apparatus communicate with each other through the communication line; and a control unit connected to one of the apparatus at an end stage thereof so that the control unit is configured to communicate with the one of the apparatus. The apparatus includes an address setting unit for setting a specific number to an address of the apparatus according to an address setting command when the apparatus receives address setting data including an address addition instruction as the address setting command for adding the specific number to the address of the apparatus. The apparatus further includes an address setting data transmission control unit for outputting the address setting data to a later stage apparatus when the address setting unit sets the specific value to the address of the apparatus.
US09128826B2
Data storage systems and methods for storing data are described herein. The storage system may be integrated with or coupled with a compute cluster or super computer having multiple computing nodes. A plurality of nonvolatile memory units may be included with computing nodes, coupled with computing nodes or coupled with input/output nodes. The input/output nodes may be included with the compute cluster or super computer, or coupled thereto. The nonvolatile memory units store data items provided by the computing nodes, and the input/output nodes maintain where the data items are stored in the nonvolatile memory units via a hash table distributed among the input/output nodes. The use of a distributed hash table allows for quick access to data items stored in the nonvolatile memory units even as the computing nodes are writing large amounts of data to the storage system quickly in bursts.
US09128821B2
Various embodiments of the present invention are generally directed to an apparatus and associated method for updating data in a non-volatile memory array. In accordance with some embodiments, a memory block is formed with a plurality of types of memory cell sectors arranged in data pages of a first type and log pages of a second type that can be updated in-place. A first updated sector is written to a first log page while maintaining an outdated sector in an original data page, and overwritten with a second updated sector.
US09128806B2
Methods and systems for squaring a binary finite field element are described. In some aspects, a data processing apparatus includes registers and processor logic. A first register stores a sequence of binary values that define a binary finite field element input. The processor logic accesses input components from the first register according to intervals in the sequence. Each input component includes a binary value from each interval in the sequence. In some cases, the intervals are periodic and the binary finite field element corresponds to a sum of phase-shifted input components. The processor logic generates output components based on the input components. The processor logic generates a square of the binary finite field element in the second register based on the output components. The number of input components can be selected, for example, to balance costs of additional processing time against benefits associated with reduced processing hardware.
US09128802B2
A call center (CC) generator includes generator software (GSW) executing on a computerized appliance from a machine-readable physical medium, an input interface for receiving a CC configuration, access to a data repository storing CC software components, a function relating configuration parameters to individual ones of the stored CC software components, and an output interface for delivering a CC SW suite. The CC generator, executing the GSW, considers the CC configuration, applies the relating function, selects CC software components to copy from the data repository, and builds the CC SW suite for output.
US09128800B2
The present invention provides a system and method for providing a personalized platform for accessing internet applications. According to one embodiment of the invention, a social network provider receives a request for installation of an application from a user of the social network, installs the application at multiple points in the user's social network environment, and personalizes interfaces with the application at these integration points based on information about the user available from the social network. The present invention enables applications to be integrated in the social network environment at multiple integration points and to be personalized for and configured by the user.
US09128784B2
Systems, methods, and computer-readable media provide for the transfer of data between electronic devices utilizing a network clipboard. According to various embodiments described herein, a clipboard application residing on a host device associated with a user transmits data from a local clipboard of the host device to a remote network clipboard via a network. A clipboard application associated with a target device associated with the user transmits a request for the data stored on the network clipboard. A copy of the data associated with the user is retrieved from the network clipboard and stored on a local clipboard of the target device. The data is then copied to a target application. This process results from a single network clipboard transaction that includes a cut or copy action on the host device and a paste action on the target device.
US09128768B2
A cloud based service provides Master Data Management (MDM) services to clients. A client may create/modify MDM workflows that are hosted by the cloud based service to assist in meeting their needs. An interface is provided at points within the workflow that is hosted by the cloud based service. The cloud based service utilizes a flexible pipeline that executes predefined configurable blocks. A user can create or customize an existing workflow based on the predefined set of blocks (e.g. execution blocks, conditional blocks, loop blocks). The blocks are configured to receive, process and send information relating to the master data according to a predefined schema. Clients may publish master data changes and/or subscribe to master data changes made by other clients.
US09128765B2
A method of sharing virtual machine resources. The method includes: in response to at least one user logging in to the virtual machine, monitoring file operations taken by the user in the virtual machine; recording the types of file operations; in response to the user logging out from the virtual machine, restoring the virtual machine back to the original state at the time when the user logged in to the virtual machine according to the recorded types of file operations; and in response to receiving a request for virtual machine resources, assigning one of the virtual machines which is idle and restored back to the original state to the requesting user.
US09128760B2
A method to dynamically adjust priority may include providing a boost, by a processing device, to an element relative to at least one other element in response to a boost feature associated with the element being activated. Providing the boost to the element may include providing a predetermined longer duration of use of a shared use resource to the element relative to the at least one other element based on a boost setting associated with the element. The boost results in adjusting a priority of the element by allowing the element to complete a task in a shorter time period.
US09128759B2
An approach is provided in which a processor includes an adder that concurrently generates one or more intermediate results and a boundary indicator based upon instructions retrieved from a memory area. The boundary indicator indicates whether a collective result generated from the intermediate results is within a boundary precision value.
US09128758B2
According to one aspect of the present disclosure, a method and technique for encoding densely packed decimals is disclosed. The method includes: executing a floating point instruction configured to perform a floating point operation on decimal data in a binary coded decimal (BCD) format; determining whether a result of the operation includes a rounded mantissa overflow; and responsive to determining that the result of the operation includes a rounded mantissa overflow, compressing a result of the operation from the BCD-formatted decimal data to decimal data in a densely packed decimal (DPD) format by shifting select bit values of the BCD formatted decimal data by one digit to select bit positions in the DPD format.
US09128755B2
The present invention relates to a method and apparatus for scheduling resources in system architecture. In one embodiment, this can be accomplished by storing temporarily jobs form a plurality of queues, where each queue a weight is set up, forming a set of elements, wherein the set size is based on the weights assigned to each queue, selecting one element from the formed set in an order, wherein the order can be predefined or random order and serving at least one job from the plurality of queues, wherein selection of the job is from the queue that corresponds to element of the formed set.
US09128751B2
An apparatus includes a processing unit configured to determine, using a control application, a type of schema of a selected link. When the schema is of a first type, the control application causes processing associated with the selected link to be performed by a content display module. When the schema is of a second type, the control application causes processing associated with the selected link to be performed by a module different from the content display module. The processing unit can be configured to run an operating system, a control application, and a content display module, such that the control application is interposed between the operating system and the content display module. The control application can determine a type of schema of a selected link.
US09128749B1
Lock free collection of performance data from an application program executing in a computer system having a multi-core central processing unit is described. A data collection mechanism creates a water mark queue that includes a data structure to store an array and plurality of pointers, including head, tail, high water mark and low water mark pointers. A plurality of worker threads is spawned, each configured to collect and store data from the application program. The data collection includes incrementing the head pointer, reading an index from a head element of the array and incrementing the high water mark pointer in a single transaction. A context is retrieved corresponding to the retrieved index. An operation is performed based on information contained in the retrieved context. Subsequently, the tail pointer is incremented, the index is written to a tail element of the array and the low water mark pointer is incremented.
US09128742B1
A computer-implemented method for enhancing virtual machine backup image data may include identifying a virtual machine to be stored as a backup image. The computer-implemented method may also include collecting configuration information that identifies at least one aspect of how the virtual machine is configured. The computer-implemented method may further include storing the backup image of the virtual machine in a backup repository. The computer-implemented method may additionally include associating the configuration information within the backup image in a catalog of virtual machine backup images, the catalog being searchable by the configuration information. Various other methods, systems, and computer-readable media are also disclosed.
US09128739B1
A method includes the step of running a set of instances on at least one cloud for a first time interval, each of the instances comprising a bundle of virtualized resources. The method also includes the step of evaluating one or more performance characteristics of each of the instances in the set of instances over the first time interval. The method further includes the step of determining a first subset of the set of instances to maintain for a second time interval and a second subset of the set of instances to terminate for the second time interval responsive to the evaluating step. The steps are performed by at least one processing device comprising a processor coupled to a memory.
US09128738B2
An information processing device stores, in a storage device, command execution user data associating an attribute of a command with a name of a user entitled to execute the command. When execution of the command is requested, a service of the information processing device extracts, from the command execution user data, a name of a user entitled to execute the requested command and executes the command with the extracted user name.
US09128732B2
A method and an apparatus for runtime compilation that generates non-deterministic and unpredictable code to protect against un-trusted code attacks are described. The runtime compilation may be based on heuristic rules without requiring deterministic behavior reduction operations for all the code generated. The heuristic rules may include estimations on, for example, runtime overhead or cost incurred for code protection, amount of code protection required and/or other applicable factors and their relationships.
US09128730B2
A method for executing a Basic Input Output System (BIOS) tool program in a non-System Management Interrupt (SMI) mechanism is applicable to a computer and includes: bi-directionally transmitting, by an ACPI ASL module and a service module, a corresponding trigger signal; bi-directionally transmitting, by the service module and a driver, the trigger signal; bi-directionally transmitting, by the driver and a real-time service module of a BIOS, the trigger signal; and performing, by the BIOS, event processing according to the trigger signal to obtain a processing result, or performing, by the BIOS, logic operation on the data to obtain operation data.
US09128729B1
Each of a plurality of Basic Input/Output System (BIOS) performance profiles can be determined upon a corresponding performance goal. A particular performance profile can be selected from the plurality of BIOS performance profiles. A BIOS configuration can be determined for a computer system automatically based at least in part on the particular performance profile or a hardware configuration of the computer system. The computer system can be initialized with the BIOS configuration.
US09128723B2
A computer implemented method and apparatus for dynamic Document Object Model (DOM) aware code editing. The method comprising storing, in a DOM model, a plurality of Document Object Model (DOM) elements in one or more HyperText Markup Language (HTML) files for a project; and storing, in the DOM model at least one modification to the DOM that results from execution of one or more JavaScript code files for the project, wherein during JavaScript code editing, the at least one modification to the DOM identifies an interaction between the JavaScript code and the DOM elements.
US09128721B2
The invention provides a technique for targeted scaling of the voltage and/or frequency of a processor included in a computing device. One embodiment involves scaling the voltage/frequency of the processor based on the number of frames per second being input to a frame buffer in order to reduce or eliminate choppiness in animations shown on a display of the computing device. Another embodiment of the invention involves scaling the voltage/frequency of the processor based on a utilization rate of the GPU in order to reduce or eliminate any bottleneck caused by slow issuance of instructions from the CPU to the GPU. Yet another embodiment of the invention involves scaling the voltage/frequency of the CPU based on specific types of instructions being executed by the CPU. Further embodiments include scaling the voltage and/or frequency of a CPU when the CPU executes workloads that have characteristics of traditional desktop/laptop computer applications.
US09128720B2
Methods and apparatus for voltage scaling are provided. In an example, an operational limit of a processor is determined by varying a supply voltage to force a processor interrupt fault and/or a processor reset. A clock frequency and the supply voltage can be maintained substantially constant for a time duration. If these operational parameters do not force the processor interrupt fault and/or the processor reset, the supply voltage is varied again, and the clock frequency and the supply voltage are maintained substantially constant for a second time duration. The variation continues until initiation of the processor interrupt fault and/or the processor reset, at which time least one of a clock frequency, the supply voltage, and a temperature are recorded as an operational limit. After determining the operational limit, the supply voltage is adjusted to within the operational limit.
US09128711B2
A computer system is provided. In one embodiment, the computer system includes a memory, a peripheral device, a central processing unit (CPU), and a peripheral device controller. The CPU stores information about the data transmission in a descriptor in the memory when data transmission between the CPU and the peripheral device is required. The peripheral device controller reads the descriptor from the memory at an access frequency, records whether the descriptor read from the memory requests for data transmission as a recording result, and adjusts the access frequency according to the recording result.
US09128708B2
A power saving method and a power saving system are applied in an optical disk drive. The power saving system comprises a power controlling unit for differentiating the specific sets of circuits not being used at a specific operation rate and powering them down. The sets of circuits not being used will be powered up while the associated operation rate at which they are required to operate is nearly started.
US09128696B1
A system and method for generating command scripts for profile configurations of an Hewlett Packard Virtual Connect Blade enclosure, by parsing a show-all report of the domain, generating a configuration script that includes configuration statements for static entities of the domain; and generating a configuration script that includes configuration statements for dynamic entities of the domain.
US09128692B2
An LED light with a time piece uses a simple light-medium body with a very rough finish to allow light from LED(s) to pass though input-end(s) of the light-medium body and travel within the body and obtain a very even brightness on all surfaces of the light medium that are seen by a viewer. Combined with a milky/frosted front sheet overlay, the light-medium surface can get perfect area illumination effects. The movement for the time display can include analog indicators with a guilt-in light-medium on the top cover to achieve a super slim LED illumination for the time piece. For night light application, the sealed-unit may consist of prong-means and an LED related circuit sealed within a safety standard plastic material and assembled with the night light body to save a lot of cost enable use of all kinds of materials. The invention may also be adapted to an LCD display timepiece.
US09128690B2
A reduced-pin bus system includes a bus having one or more signal lines that are coupled to a bus power supply through a current limiting device. A master unit is coupled to the bus and is arranged to transmit communications across the bus during an active period of the bus and to initiate communications during (and/or at the end of) a quiescent period of the bus. A slave unit is coupled to the bus and is arranged to couple power from the one or more signal lines to a capacitor during the quiescent period of the bus and to consume power from the capacitor during the active period of the bus.
US09128677B2
An input module includes a substrate, at least two bio-keys and a control unit. The substrate has at least two bio-leads and switches. Each of the bio-keys has a key surface, at least one conductive elastic piece and a protrusion. The conductive elastic piece is electrically connected and conducted to the key surface and the bio-leads. The control unit has an input-signal generating element and a biological-signal generating element. The input-signal generating element is configured to generate a first input signal and a second input signal by using the protrusion to toggle the switch. The biological-signal generating element is configured to generate a bioelectric signal through the electrical conduction between the bio-key and the bio-lead. The present invention further provides an electronic device, in which the bioelectric signal is analyzed by an operational unit to generate a biological function index.
US09128675B2
A mobile computer includes: an operation casing 2 including a right side face 2g, a top surface 2a, and a back surface 2d; a lid component 4 configured to cover a battery insertion/detachment opening 6a formed in the right side face 2g; and an engaged component 5 formed on the top surface 2a. The lid component 4 includes: a securing portion 4e secured to a part of the operation casing 2; a lid portion 4a configured to cover the battery insertion/detachment opening 6a; an engaging portion 4d having an engagement hole 4f that engages with the engaged component 5; a first bent portion 4c configured to connect between the securing portion 4e and the lid portion 4a; and a second bent portion 4b configured to connect between the lid portion 4a and the engaging portion 4d, so as to be integrated into the lid component 4.
US09128666B2
An electronic device having a housing structure that is configured to receive at least one glass cover is disclosed. The glass cover serves to cover a display assembly provided within the electronic device. The glass cover can be secured to the housing structure so as to facilitate providing a narrow border between an active display area and an outer edge of the housing structure. The enclosure for the electronic device can be thin yet be sufficiently strong to be suitable for use in electronic devices, such as portable electronic devices.
US09128664B1
A computing device is provided herein. For instance, the computing device comprises base and lid assemblies, and a connector. The base assembly includes a base housing, a first hinge portion attached to the housing, a keyboard, a touch-based input surface, and an electronic component within the housing. The housing includes a first surface at least partly surrounding the keyboard and touch-based input, and a second opposing surface. The lid assembly includes a lid housing, a second hinge portion, and a display, and includes a first surface at least partly surrounding the display and a second surface opposite the first surface. The connector has a third hinge portion, a fourth hinge portion and a body extending therebetween. The third hinge portion is rotatably affixed to the first hinge portion of the base assembly, and the fourth hinge portion is rotatably affixed to the second hinge portion of the lid assembly.
US09128661B2
An apparatus is provided that includes a housing, a display, a communication interface, a processor, and a plurality of detection components each of which is located proximate a respective face of the housing. At least two of the faces of the housing proximate to which two of the respective detection components are located are adjoining faces lying in planes that cut one another, the apparatus thereby supporting a two-dimensional arrangement of apparatuses. The apparatus and other apparatuses may be formed into an arranged group of apparatuses, and in such instances, the processor is configured to receive corresponding indications from the detection components, and data from the other apparatuses in the group via the communication interface. The processor is configured to calculate an output as a function of the number of apparatuses and their arrangement, and configured to communicate the calculated output via the display.
US09128660B2
Methods and devices including providing a device having at least a primary screen and a secondary screen; receiving a first input, where the first input comprises a pinyin input on the primary screen; processing the first input to estimate a character based on the first input; displaying the estimated character(s); and displaying a selection, where the selection includes a chosen character selected from the estimated character(s).
US09128648B2
An image forming apparatus includes execution units configured to execute predetermined functional processing, and switches to a second power state lower than a first power state. After a user selects priority on power saving or priority on convenience as a condition for switching to the second power state, the image forming apparatus receives a plurality of recovery triggers for switching to the first power state. A number of times of detection of each recovery trigger received is stored. If the user selects priority on convenience, it is determined whether the number of times of detection of each recovery trigger requiring a large power amount consumed by execution units associated with each recovery trigger falls below a predetermined threshold. If it is determined that the number of times of detection of a recovery trigger falls below the predetermined threshold, the recovery trigger may be disabled.
US09128640B2
A consistency assessment system for assessment of consistency of a software product includes a mapping module to obtain a plurality of configuration elements associated with the software product being developed, where each of the plurality of configuration elements influence software product development. Each of the plurality of configuration elements pertains to one of a plurality of element categories influencing software product development. The mapping module further identifies based on one or more identifiers, association of at least one configuration element from among the plurality of configuration elements with at least one another configuration element from among the plurality of configuration elements. Upon identification, an assessing module determines a requirement consistency index (RCI) for assessment of consistency of the software product. The RCI indicates an overall consistency of the software product.
US09128639B1
An array of disk drives is disclosed comprising a controller, a plurality of disk drives, wherein the controller is configured to transmit a first access command out of a group of access commands to a first disk drive in the array; transmit a plurality of the access commands out of the group of access commands to other disk drives in the array; and transmit a completion status to the first disk drive, wherein the completion status identifies a status of the plurality of access commands transmitted to the other disk drives.
US09128637B2
The present disclosure includes methods and devices for logical unit operation. One device embodiment includes a number of logical units, wherein each of the number of logical units has a unique address. The device includes control circuitry coupled to the number of logical units and configured optionally to control more than one of the number of logical units with one of a number of commands and one address.
US09128636B2
Multiple storage systems have capability to provide thin provisioning volumes to host computers and capability to transfer (import/export) management information regarding thin provisioning between storage systems. Moreover, at least one of the storage systems posses capability to provide storage area of other storage system as own storage area virtually via connection to the other storage system (i.e. external storage). Target storage system achieves efficient migration and unifying storage resource pool by importing or referring the management information obtained from source storage system and by utilizing the source storage system as external storage. One implementation involves method and process for migration of thin provisioning volumes using chunks having same length between source storage system and destination storage system. In this implementation, storage resource pool is unified by importing management information from the source storage system, and automated page-based relocation is performed to adjust actual location of data.
US09128634B1
The present disclosure includes systems and methods relating to packed command management for non-volatile storage devices. In some implementations, a device includes: a host controller configured to transfer data between a host memory and a storage device; and a non-transitory medium encoding host software configured to prepare a packed command, which represents more than one command, by loading pointers to memory blocks associated with the packed command into a host memory; wherein the host controller is configured to assert an interrupt to the host software, for at least one command of the packed command, after data transfer for the at least one command is completed, but before data transfer for all of the commands of the packed command is completed.
US09128620B2
A data storage device includes a write protection data structure that includes a first set of entries corresponding to a first set of ranges of memory addresses. A first indication stored in an entry, in the first set of entries, corresponds to an absence of write-protected data between a lowest address of the range of addresses corresponding to the entry and a highest address of a memory. A second indication stored in the entry corresponds to write-protected data within the range of addresses. The data storage device also includes a write protection map that includes a second set of entries corresponding to a second set of ranges of the memory addresses. The device is configured to locate, in the write protection data structure, an entry corresponding to a range of memory addresses.
US09128606B2
A mobile terminal and controlling method thereof are disclosed, by which various and convenient functions are provided through screen partition in consideration of a plurality of users. The present invention includes a touchscreen recognizing a touch input and a controller setting a reference line on the touchscreen to correspond to a 1st pattern touch input, the controller partitioning the touchscreen into a 1st region and a 2nd region in accordance with the set reference line, the controller controlling an image displayed on the 1st region to be displayed on the 2nd region in a manner of being reversed.
US09128601B2
Described are methods, devices and computer-readable media for displaying, on a touch screen display, a user interface that includes an unlocked element, detecting user inputs that include movement of a finger contact on the unlocked element toward the first location, wherein the first location is in respective direction from the unlocked element. Fingerprint data is obtained based on the finger movement, and based on the obtained fingerprint data, it is determined whether the user inputs meet unlock criteria or not.
US09128596B2
A method is provided for selecting a region of interest in an electronic document and displaying the selected region in a manner that is adapted to the capabilities of a display. The method may comprise such steps as loading a document, selecting a position within said document, analyzing the layout of the document in order to identify a region of interest containing said position, and displaying said region of interest on said display in a manner that aligns the region of interest with a window of said display. Also described is a device configured to perform the method and a computer program product including instructions for performing the method on a computing device.
US09128594B1
An apparatus for controlling an aviation display is provided. The apparatus includes processing electronics configured to cause the aviation display to switch, in response to a user input, a first format for aviation data and a second format for aviation data. The first format includes a full format image of live data and the second format includes a scaled representation of the live data.
US09128593B2
A method of providing an interactive content to a prospective user at a mobile device, the mobile device including a non-transitory computer readable medium including a computer executable program code and a processor for executing the computer executable program code is described. The method includes steps for initiating capture of an audio stream by shaking the mobile device; capturing the audio stream via a microphone in the mobile device; converting the captured audio stream into an audio fingerprint; sending the audio fingerprint to a server; receiving the interactive content from the server if there is a match between audio fingerprints stored on the server, and the audio fingerprint sent by the mobile device; and displaying the interactive content on the mobile device.
US09128591B1
Systems and methods are provided for generating an identifier that identifies a specific position within content. For example, at least a portion of content may be presented in a manner such that any position within the presented content can be selected, such as a specific word or line of text content. A selection may be received indicating a position within the content, where the selection corresponds to a request to generate an identifier that identifies the selected position. In response, an identifier may be generated that includes information identifying the content and the position within the content, such that selection of the identifier causes presentation of a representation of the content at the given position.
US09128588B2
Methods and systems receive a service name, a service description, and/or operational steps of a service being registered. A first menu of previously established service class choices is provided in ranked order based on the service name, service description, and/or operational steps. Similarly, second and third menus of previously established class input/output mappings to inputs and outputs (required and produced by the operational steps of the service being registered) is presented in a ranked order, based on similar input/outputs of the selected service class. A fourth menu of previously established class transformations is provided in ranked order based on the similarity of inputs and outputs required for the operational steps of the service being registered, and inputs and outputs of the selected service class. The service is registered based on the selected service class, the selected class input mappings, the selected class output mappings, and the selected transformations.
US09128587B1
A system, method, and computer program product are provided for presenting service options to a user utilizing a three-dimensional structure. In use, a first group of service options are presented to a user, utilizing a three-dimensional structure. Additionally, a selection of one or more of the first group of service options by the user is received. Further, a selection of a depth element associated with the three-dimensional structure by the user is received. Further still, a second group of service options are presented to the user utilizing the three-dimensional structure, based on the selection of the one or more of the first group of service options and the selection of the depth element.
US09128581B1
In some implementations, a device displays a user interface that provides supplemental information in connection with a digital work. For example, the supplemental information may include a listing of objects identified in the digital work. Further, a visual representation may be displayed with each listed object. The visual representation for each listed object may provide a representation of at least one location of at least one occurrence of the object in the digital work. The objects may be displayed according to a supplemental information view, a page view, a chapter view, a book view, a series view, a library view, or the like. Additionally, one or more object buttons may be displayed concurrently with the listing of objects. The object buttons may correspond to the types of objects displayed, and may be selected to limit the displayed objects to a particular type.
US09128580B2
A system and method are provided for employing an intelligent stencil mask to interact with a touch screen interface and thereby reduce the probability of accidental control function activation. A touch screen interface onboard an aircraft is coupled to a processor and is configured to generate a first virtual mask having a first region and a second region. A user interaction is then detected with one of the first region and the second region. A first reconfigured virtual mask is generated if the user interacted with the second region. However, an aircraft control function is activated if the user interacted with the first region.
US09128575B2
An intelligent input method and intelligent input system are disclosed. The intelligent input system includes an electronic device and an input device. The intelligent input method comprises the following steps. Firstly, a touch input is received through an input interface of an input device. Then, plural control areas on the input interface are defined according to a touch position of the touch input on the input interface. The plural control areas are respectively correlated with plural input functions of the input device. The intelligent input method allows the user to input or select a target object or browse a web page or operate any graphical user interface containing randomly-distributed objects in an electronic device such as an intelligent TV or a digital multimedia player. Consequently, the target object can be selected and inputted in an intelligent, quick and intuitive manner.
US09128570B2
A capacitance sensing system can filter noise that presents in a subset of electrodes in the proximity of a sense object (i.e., finger). A capacitance sensing system can include a sense network comprising a plurality of electrodes for generating sense values; a noise listening circuit configured to detect noise on a plurality of the electrodes; and a filtering circuit that enables a filtering for localized noise events when detected noise values are above one level, and disables the filtering for localized noise events when detected noise values are below the one level.
US09128567B2
Systems and related methods providing for touch sensors having a waveguide reflective array within a major reflective array are discussed herein. A touch sensor may include a substrate configured to propagate surface acoustic waves. The substrate may include a front surface, a back surface including the reflective arrays, and a connecting surface joining the front surface and the back surface. The reflective arrays may be configured to cause the surface acoustic waves to propagate from the back surface, via the connecting surface, to the front surface. The touch censor may further include circuitry configured to determine a coordinate of a touch event on the front surface based on received attenuations in the surface acoustic waves.
US09128564B2
An optical touch system including a touch surface, a reflection structure and light source modules is provided. The reflection structure and the light source modules are disposed at a periphery of the touch surface. Each light source module has a light-emitting unit and a sensing unit. The sensing unit obtains a brightness value distribution of a sensing light emitted by the light-emitting unit after the sensing light is reflected by the reflection structure, so as to sense touch input. The periphery of the touch surface includes first and second sections. When the light-emitting unit located on the first section emits the sensing light, the sensing light is not reflected by the reflection structure at the light source modules located on the second section so that low-brightness areas are formed, and the light-emitting units of the second group emit compensation lights correspondingly. In addition, a touch sensing method is also provided.
US09128558B2
A method for force detection of a deformable touch element with a capacitive touch-screen device includes providing drive and sense electrode arrays and a touch-detection circuit connected to the electrodes for detecting capacitance at a touch location. No-touch capacitance, light-touch capacitance, and heavy-touch capacitance are sensed with the touch-detection circuit at the touch location in response to forcible deformation of the deformable touch element proximate to the touch and a force signal reported.
US09128553B2
A sensing apparatus that includes a polylactic acid film having a first surface and an opposing second surface. The polylactic acid film is molecularly oriented and thermally treated so as to have a shear piezoelectric property. An electrode arrangement is provided adjacent at least one of the first and second surfaces of the polylactic acid film, and is configured to detect a relative position of an input on the polylactic acid film and detect a pressure of the input toward the polylactic acid film.
US09128544B2
A terminal for simply selecting one of menus in multitasking operation and displaying the selected menu as an entire image on a screen in consideration of user convenience, and its control method are disclosed. The terminal includes a display module; a user input unit configured to detect a touch input; and a controller configured to slide currently executed menus according to a pre-set method if the input touch continues by longer than a particular time, selecting one of executed screen image of the slid menu, and display it as an entirely magnified image.
US09128543B2
A touch pad device and method for determining a position of an input object on the device uses multiple sensing electrodes to produce signals induced by mutual capacitive coupling that are dependent on which conductors of the device are being electrically contacted by the input object. These signals are then processed to determine the position of the input object on the touch pad device.
US09128542B2
A combination touch and transducer input system is provided, which facilitates user input into an electronic system with a finger and/or a transducer (e.g., a stylus). The system includes a transducer configured to generate an electric field, and a sensor including an array of electrodes and a controller. The transducer is configured to transmit digital data, such as pen pressure data and switch status data, to the sensor. The sensor controller operates both in a touch sensing mode and in a transducer sensing mode. During the touch sensing mode, the controller determines a position of a proximate object (e.g., a finger) by capacitively sensing the object with the array of electrodes. During the transducer sensing mode, the controller determines a position of the transducer based on a signal received by the array of electrodes from the transducer, and also receives and decodes the digital data encoded in the received signal.
US09128535B2
The portable electronic device includes an operation unit, a storage unit, a setting unit, and a control unit. The operation unit inputs characters. The storage unit stores a first conversion table and a second conversion table different from the first conversion table. The second conversion table is different from the first conversion table. The setting unit sets a first mode and a second mode. In a case in which the first mode has been set by the setting unit, the control unit refers to the first conversion table when characters input by way of an operation of the operation unit are converted into another type of characters or character set. In a case in which the second mode has been set by the setting unit, the control unit refers to the second conversion table when characters input by way of an operation of the operation unit are converted into another type of characters or character set.
US09128530B2
Hand pointing has been an intuitive gesture for human interaction with computers. A hand pointing estimation system is provided, based on two regular cameras, which includes hand region detection, hand finger estimation, two views' feature detection, and 3D pointing direction estimation. The technique may employ a polar coordinate system to represent the hand region, and tests show a good result in terms of the robustness to hand orientation variation. To estimate the pointing direction, Active Appearance Models are employed to detect and track, e.g., 14 feature points along the hand contour from a top view and a side view. Combining two views of the hand features, the 3D pointing direction is estimated.
US09128527B2
A mobile terminal and touch recognizing method therein are disclosed, by which a multi-touch can be recognized. The present invention includes receiving a plurality of touches simultaneously using a touchscreen, consecutively receiving a plurality of images including a plurality of the received touches for a predetermined time using a camera provided under the touchscreen, determining patterns and pattern changes of a plurality of the touches included in a plurality of the images, respectively, and recognizing a gesture by a plurality of the touches in accordance with a result of the determining step. Moreover, the touch pattern includes at least one selected from the group consisting of a touch number, a touch point, a touch size and a touch figure.
US09128523B2
Haptic effects are dynamically generated for content presentation on a device through analysis of the content. During content playback, audio data for the content may be analyzed to determine low frequency audio data. The low frequency audio data is mapped from a low frequency range to a haptic control frequency range of one or more haptic actuators included in the device. This mapping may be used to generate a control signal to drive the one or more haptic actuators. The haptic effects and the content may be synchronized to one another during the presentation of the content on the device. The haptic actuator control signal may be amplified proportionally to the amplitude of the low frequency audio data.
US09128515B2
A control device for providing a reconfigurable operator interface for a medical apparatus is provided. The control device comprises a control surface comprising at least one control actuator arranged on the control surface. The control device further comprises a plurality of modules arranged side-by-side and attached to each other via adjacent abutting side surfaces in a liquid-tight manner, wherein the plurality of modules comprise a first terminal module having a closing end surface and an abutting side surface opposite the closing end surface, and a second terminal module having an abutting side surface facing towards the abutting side surface of the first terminal module, and an opposite closing end surface. Operation of the control device is enabled when all the abutting side surfaces of the plurality of modules are in an attached state.
US09128512B2
Provided is a server, wherein an image group and a terminal ID are received from an imaging terminal, a first ID specifying a first image among the image group, the terminal ID, and the first image are stored in a first storage, a second ID specifying a second image among the image group, the terminal ID, and the second image are stored in a first storage, a user ID and a terminal ID are received from an data terminal, the user ID and the terminal ID are stored in a second storage, the terminal ID is extracted by conducting a search thereof inside the second memory using the user ID as the key, the first image and the second image are extracted as a result of conducting a search thereof inside the first storage using the terminal ID as the key, a first summary image is stored in association with the terminal ID and the first ID in a third storage, a second summarized image is stored in association with the terminal ID and the second ID in the third storage, and the first summary image and the second summary image are sent to the data terminal.
US09128511B2
A semiconductor device includes a characteristic code storage unit configured to store signal transfer characteristic information input through a given pad and output a control code corresponding to the signal transfer characteristic information, and a characteristic reflection unit configured to reflect the signal transfer characteristic information in an input signal input through the given pad, in response to the control code, and to output the reflected input signal.
US09128501B2
An integrated circuit having a regulator circuit capable of tracking reference voltages is provided. The integrated circuit includes shunt regulator circuitry. The shunt regulator circuitry includes a shunt regulator circuit and a voltage tracking circuit. The shunt regulator circuit has an output on which a regulated voltage is provided. The shunt regulator circuit also provides electrical current to the output when the regulated voltage is outside of a voltage range bounded by first and second reference voltages. The voltage tracking circuit may be coupled to the shunt regulator circuit. The voltage tracking circuit may generate the first and second reference voltages. In one instance, the first voltage is greater than the regulated voltage and the second voltage is less than the regulated voltage.
US09128500B2
A switching circuit and a method of operating the same are disclosed. In an embodiment, the switching circuit includes a switching transistor adapted to control operation of the switching circuit according to a control signal applied to the control terminal of the switching transistor, a regulating circuit adapted to generate the control signal, and a detecting circuit adapted to sense a voltage at the control terminal when the switching transistor is in an OFF state and to generate a drive signal according to the sensed voltage. The regulating circuit is adapted to generate the control signal based on the generated drive signal.
US09128491B2
The invention relates to a device for regulating a pressurized gas, said device including: a stopper (4) engaging with a seat (5) and capable of closing a pressurized gas passage; a so-called low-pressure chamber (29) downstream from the seat (5), the low-pressure chamber including a plate (27) to which the stopper (4) is coupled, and the plate being subjected to the force of a spring (30) housed in said chamber (29) and arranged concentrically relative to the seat (5) and the fastening means (28) thereof. The chamber (29) is defined by a diaphragm (26) in free contact with the plate (27). The opposite surface of the diaphragm (26) is subjected to the force of a spring (20) having a prestress which is adjustable via control means (13, 14). The control means are indexed according to two positions: a first prestress release position for ensuring the closure of the device at the stopper (4), and a second calibrated prestress position of the diaphragm (26) corresponding to the regulator operational position. A sealed chamber (24) defined by the surface of the membrane (26) opposite the low-pressure chamber (29) is formed by the prestress control means for ensuring the connection to a detector for detecting the presence of a leak or of the used gas in order to detect a potential leak at the diaphragm.
US09128489B2
A distributed control system is provided wherein a master controller inductively delivers power and data to a plurality of remote slave modules or controllers via a plurality of coupling loops formed along a length of transmission line. Each of the remote slave modules, in turn, inductively delivers return data to the master controller via the plurality of coupling loops. The use of inductive coupling provides an advantage over the state of the art because no direct galvanic electrical connection is required between the transmission line and the remote slave modules which promise to simplify installation and enhance long-term reliability. Example applications for the control system described herein include agricultural irrigation systems where individual sprinkler and valve components may be controlled collectively, individually, or in groups or subsets, to vary application rates according to prescribed irrigation parameters.
US09128480B2
A safety controller controls an automated installation on the basis of project data representing an individual application running. The safety controller has a plurality of controller hardware components. At least some controller hardware components have a respective project data memory. The project data memories each are designed to store project data supplied to them. The safety controller includes a connecting unit, such as a communication network, which connects the controller hardware components to one another. The safety controller also has a distribution unit for distributing at least some of the project data via the connecting unit to at least some of the project data memories.
US09128479B2
An automation control and monitoring system includes an operating system and a data model. The operating system is configured to receive a request for instantiation of an object representing an attribute of the automation control and monitoring system. The operating system is also configured to generate an object identifier when the request for instantiation is received, wherein the object identifier is unique from any other object identifiers employed by the operating system. The data model is configured to store and associate the object with the generated object identifier such that any component of the automation control and monitoring system may access the object by referencing the object identifier.
US09128478B2
A method for selecting a communication system assigned to a transmission network of an automation system, where a transmission network with a plurality of subscribers, connected to the transmission network, of one or more automation systems is displayed, or is capable of being displayed, on a display unit. The transmission network is assigned to a plurality of communication systems, where the plurality of communication systems are each designed or configured for communication over the transmission network between at least two of the subscribers connected to the transmission network. By selecting a selection area assigned to the transmission network on the display unit by a selection device, the plurality of communication systems assigned to the transmission network are displayed on the display unit. Subsequent to selection of the selection area assigned to the transmission network by the selection means, one of the displayed communication systems is then selectable by means of the selection means.
US09128476B2
Methods and systems for a secure robotic operational system include but are not limited to receiving an authorization associated with a directive to perform robotic operational tasks regarding one or more objects; verifying the authorization associated with the directive; and controlling operation of the robotic operational system via controlling a plurality of robotic elements, each robotic element of the plurality of robotic elements individually and/or in combination performing one or more functions in accordance with the authorization.
US09128475B2
A processor comprises a plurality of processing units operating in parallel. Each processing unit is associated with a time signal generator upon the expiry of which the corresponding processing unit is capable to set expired time signal generator to a predefined duration of time. In case an end of the predefined duration of time deviates less than a predefined duration of time from a scheduled expiry of a time signal generator assigned to a different processing unit; predefined duration of time is modified.
US09128472B2
A library of cloud templates for configuring cloud-based industrial solutions is provided. A cloud template provisioning system provides a platform for location and retrieval of a variety of cloud templates that facilitate configuration of cloud-based industrial applications, including control panel templates, dashboard templates, data historian templates, virtual machine management templates, and other such templates. The cloud templates can be installed and executed on a client device to provide an intuitive interface for configuring various aspects of the cloud-based solution.
US09128441B2
An image forming apparatus includes a charging device configured to uniformly charge a surface of a photoconductive element; an image writing device configured to write an image in the charged photoconductive element by light to form an electrostatic latent image; a developing device configured to visualize the formed electrostatic latent image as a toner image; a transfer device configured to transfer the toner image to a sheet recording medium; a fixing device configured to fix the transferred toner image onto the medium; and a surface information detecting device configured to detect surface information of a fixing member of the fixing device. The surface information detecting device radiates optical spots on a surface of the fixing member in a direction crossing a conveying direction, receives reflected light of each optical spot, and detects the surface information of the fixing device based on the detection results of the reflective lights.
US09128438B2
A method of determining a media weight using a media stiffness sensor in an imaging device. A media sheet is staged having a cantilevered portion which is deflected by a contact member translated into the cantilevered portion. Based on the energy used to move the contact member through a travel distance, a media weight can be determined. An operating parameter of the imaging device may be adjusted based on the media weight that was determined.
US09128430B2
One disclosed aspect of the embodiments relates to power control of a heater in a fixing unit. A plurality of control tables having different ratios of phase control waveforms and wave number control waveforms in one control cycle have been set, and a control table is selected depending on a set target temperature.
US09128424B2
An image forming apparatus includes an image carrier configured to carry thereon a developer image, an endless belt configured to be rotated while contacting the image carrier, a first cleaning roller having an outer surface made of semiconductor material and configured to electrically remove attachments attached on the endless belt, and a backup roller made of metal and arranged to oppose the first cleaning roller with the endless belt being interposed therebetween. The endless belt has a nip portion at which both the backup roller and the first cleaning roller contact the endless belt while opposing each other, and the first cleaning roller contacts the endless belt at a more upstream side than the nip portion in a moving direction of the endless belt.
US09128414B2
A gasket seal is disclosed. The gasket seal containing a gasket defining an opening containing a first gasket longitudinal edge, a second gasket longitudinal edge, a gasket transverse edge, wherein the gasket transverse edge forms a 90 degree angle with the first gasket longitudinal edge and the second gasket longitudinal edge, a seal strip containing a first seal longitudinal edge, a second seal longitudinal edge, and a seal transverse edge, wherein the seal transverse edge forms an acute angle with the first seal longitudinal edge wherein the seal transverse edge forms an obtuse angle with the second seal longitudinal edge, wherein the seal strip is removably coupled with the gasket.
US09128409B2
An image forming apparatus is provided. The image forming apparatus includes a plurality of photosensitive members arranged to align in parallel with one another, an exposure device arranged in an upper position with respect to the plurality of photosensitive members and configured to expose the photosensitive members to light, an exposure controller arranged in an upper position with respect to the exposure device and configured to control the exposure device according to inputted image data, a power board, arranged in a lower position with respect to the plurality of photosensitive members and configured to convert alternate current power to direct current power, and a voltage converter arranged in an upper position with respect to the exposure device and configured to convert the direct current power supplied from the power board into an at least single-leveled first voltage and supply the first voltage to the exposure controller.
US09128398B2
A toner for forming an electrophotographic image is provided, wherein the toner includes at least four types of binder resins, wherein the binder resins includes at least: a crystalline polyester resin (A); a non-crystalline resin (B); a non-crystalline resin (C); and a composite resin (D) which includes a condensation polymerization resin unit and an addition polymerization resin unit, wherein the non-crystalline resin (B) includes a chloroform insoluble matter, wherein the non-crystalline resin (C) has a softening temperature (T½) lower than that of the non-crystalline resin (B) by 25° C. or more, and wherein the toner has a main peak between 1,000 to 10,000 in a molecular weight distribution obtained by GPC from a tetrahydrofuran soluble matter, and the toner has a half-value width of the molecular weight distribution of 15,000 or less.
US09128394B2
An electrophotographic toner produced by mixing a dispersion of colorant particles containing a colorant and a dispersion of release agent particles containing a release agent and having a volume average particle diameter smaller than that of the colorant particles, aggregating the colorant particles and the release agent particles in the dispersion to produce first aggregates, mixing a dispersion of resin particles containing a binder resin and having a volume average particle diameter smaller than that of the release agent particles in the dispersion containing the first aggregates, and aggregating the first aggregates and the resin particles in the dispersion of the first aggregates and the resin particles to coat the first aggregates with the resin particles, producing second aggregates.
US09128387B2
A light source includes a plurality of ultraviolet (UV) light emitting diodes (LEDs) and an LED phase shift controller coupled to the plurality of UV LEDs adapted to control the phase shift of each UV LED in the plurality of UV LEDs. The plurality of UV LEDs forms a UV LED array. An ultraviolet lithography system can include a light source as described above. The system can further include a mirror assembly in a light path of the light source, the mirror assembly having a polarization mirror with an interference coating. A method provides a light source for an ultraviolet lithography system including the element of providing an plurality of UV LEDs that emit UV light and the element of controlling a phase shift of the plurality of UV LEDs with an LED phase shift controller coupled to each UV LED or arrays of the UV LEDs in the plurality of UV LEDs.
US09128386B2
The present invention discloses an apparatus of photolithography process to a liquid display panel, comprising: a platform, employed for loading the liquid display panel; a power supplying device, employed for supplying power to the liquid display panel; an ultraviolet light source supply device, employed for providing the ultraviolet light; a light distributing plate, employed for homogenizing the ultraviolet light. The present invention also discloses a method of photolithography process to a liquid display panel. The monomer can plenty reacts without damaging liquid crystal molecules according to the present invention.
US09128382B2
A method for processing a substrate includes arranging a substrate including masked portions and unmasked portions in a process chamber; creating plasma in a process chamber; supplying a passivation gas mixture that includes nitrogen or carbon to create a plasma passivation gas mixture; exposing a substrate to the plasma passivation gas mixture to create a passivation layer on the unmasked portions of the substrate; supplying a stripping gas mixture that includes oxygen to the plasma to create a plasma stripping gas mixture; exposing the substrate to the plasma stripping gas mixture to strip at least part of the masked portions and at least part of the unmasked portions; and repeating creating the passivation layer and the stripping to remove a predetermined amount of the masked portions.
US09128358B2
A second projector is configured to be able to connect with a first projector via a USB cable including a VBUS line. The second projector includes an image projecting unit that modulates light emitted from a light source and projects the light, a USB communication unit that detects, in a standby state, the supply of power via a VBUS from the first projector, and a control unit that performs control to switch an operating state of the second projector between the standby state and a normal operating state. When the supply of power of the VBUS is detected by the USB communication unit, the control unit activates the second projector from the standby state to the normal operating state.
US09128344B2
An LED vehicle headlamp includes an LED light source, at least one electrochromic device optically coupled to the LED light source, and a collimator positioned between the LED light source and the electrochromic device. The electrochromic device has an alterable light transmission characteristics in response to voltage/current level applied thereto. The collimator is configured for collimating and converging light emitted from the LED light source and directing light into the electrochromic device. When a forward bias voltage/current is applied to the electrochromic device, the visible light transmission of the electrochromic device decreases accordingly to generate a first light intensity distribution pattern, which is a low beam. When a backward bias voltage/current is applied to the electrochromic device, the visible light transmission of the electrochromic increases accordingly to generate a second light intensity distribution pattern (high beam) different from the first light intensity distribution pattern.
US09128337B2
A display apparatus includes a display panel, and at least one flexible printed circuit board connected to the display panel. The display panel includes signal lines, pixels connected to the signal lines, and contact pads provided at one end of the signal lines. The flexible printed circuit board includes a fan-out part including a plurality of connection lines corresponding to the contact pads in a one-to-one correspondence, overlapping with the contact pads and connected to the contact pads, and a driving driver connected to the connection lines, the driving driver applying a driving signal to the pixels.
US09128334B1
The present invention provides a liquid crystal display (LCD) panel and a display apparatus using the same. The LCD panel comprises a first substrate, a second substrate, a liquid crystal layer and quarter wave (λ/4) pattern retarder films. The second electrode of the second substrate comprises first sub-pixels and second sub-pixels. When images are displayed by the pixels, a voltage difference between a first voltage of the first sub-pixels and a second voltage of the second sub-pixels is inversely proportional to a grayscale of the images displayed by the pixels. The present invention can mitigate the viewing angle problem of the pixels.
US09128326B2
A supporting member usable with a backlight unit of an image display apparatus includes a supporting portion that is formed of a transparent material, is disposed below the diffuser plate to support the diffuser plate, and has a first end being in contact with the diffuser plate; and a base that is formed at a second end of the supporting portion and fixes the supporting portion to an under chassis of the backlight unit.
US09128320B2
A three-dimensional display including a display and a micro-lens is provided. The display has a plurality of pixel units thereon, and each pixel unit has a pixel pitch i. The micro-lens is disposed at a side of the display, the micro-lens has a plurality of lens units thereon, and each lens unit has a lens pitch l. A right eye viewing zone and a left eye viewing zone are formed if an image displayed from the display passes though the micro-lens, wherein a distance between the center of the right eye viewing zone and the center of the left eye viewing zone is wz, and lens pitch l satisfies: 2 i > l ≥ 2 i × w z w z + i , wz is between 70 and 500 mm and i is between 0.1 and 500 μm.
US09128313B2
A method of manufacturing a liquid crystal display includes disposing a gate electrode and a light blocking member on a substrate, disposing a source electrode and a drain electrode on the gate electrode to form a thin film transistor, disposing a data line on the light blocking member, disposing an organic layer on the thin film transistor and the data line, exposing a first convex part of the organic layer to light in a first area corresponding to the thin film transistor during an exposure process, and exposing a second convex part of the organic layer to the light in a second area corresponding to the data line during the exposure process using a mask. The mask includes a first transflective part aligned with the first area and a second transflective part aligned with the second area during the exposure process.
US09128311B2
A liquid crystal display device using a pseudo-dot inversion driving system includes a pixel circuit arranged in a matrix shape in a row direction and a column direction. First and second gate lines extend in the row direction. First and second signal lines extend in the column direction. The pixel circuit includes a pixel electrode arranged between the first and second signal lines and electrically connected with the first signal line through a switching element. Parasitic capacitance formed between the pixel electrode and the first signal line is smaller than the parasitic capacitance between the pixel electrode and the second signal line.
US09128310B2
A method, comprising modulating digital data onto an optical carrier. Modulating includes intensity splitting the optical carrier in an input optical coupler of an interferometer. The interferometer including two or more controllable optical waveguides located on a substrate, each controllable optical waveguide connecting the input optical coupler to an output optical coupler of the interferometer and having a two-state modulator along a segment thereof. Modulating include optically modulating separate data streams onto each of the optical carriers produced by the splitting. The two or more controllable optical waveguides are connected to transmit an output to the output optical coupler, substantially different light amplitudes and/or phases when the two-state modulators of the two or more controllable optical waveguides are in different states, as driven by the data streams having different information content. The two or more controllable optical waveguides are configured to modulate the light amplitudes and/or phases in a substantially same manner when the two-state modulators are in identical states.
US09128303B1
An eyeglass assembly that enables eyeglasses to be worn more comfortably when lifted above the eyes and onto the head. The eyeglasses have a frame with a bridge. Two pad arms may extend from the frame under the bridge. Two nose pads are provided at attach to the frames either directly or with the pad arms. Each of the nose pads contains a nose contact surface. Two complex pad structures are provided that either replace or attach to the nose pads. Each of the complex pad structures has a first contact surface and a second contact surface. The first contact surface lays parallel over the nose contact surface of the nose pad. The second contact surface is oriented to be generally perpendicular to the first contact surface. When the set of eyeglasses are lifted above the eyes, the second contact surface can directly rest against the wearer's head without causing discomfort.
US09128297B2
An endoscope including a bending portion in an insertion portion comprises multiple pulling members, an operation device, a driving force transfer mechanism and a biasing mechanism. The multiple pulling members are mounted on the bending portion. The operation device generates a driving force for pulling the pulling members in conjunction with a turning operation. The bending portion is bent by the operation device between an approximately straight state and a bending state. The driving force transfer mechanism transfers the driving force generated in conjunction with the turning operation of the operation device to the pulling members. The biasing mechanism provides the driving force transfer mechanism with a biasing force for turning the operation device in a reverse direction to the turning operation direction in a state where the bending portion is bent by turning the operation device.
US09128295B2
A liquid crystal lens panel includes a first substrate, a second substrate, and a liquid crystal layer. The first substrate includes a first base substrate, a lens common electrode disposed on the first base substrate, and a first alignment layer disposed on the lens common electrode, the first alignment layer including a first alignment direction. The second substrate includes a second base substrate opposite to the first base substrate, a plurality of lens electrodes that extend in a lens axis and is parallel with each other, and a second alignment layer disposed on the plurality of lens electrodes, the second alignment layer including a second alignment direction substantially perpendicular to the first alignment direction. The liquid crystal layer is disposed between the first and second alignment layers.
US09128294B2
A liquid crystal material is driven in a twisted nematic mode so that while liquid crystal molecules lose, on a stripe electrode, rotary power toward a direction along an electric field by a voltage applied between the stripe electrode and a second electrode and form, in a region between the adjacent stripe electrodes, refractive index distribution of a lenticular lens that includes a cylindrical lens in which a cylindrical axis is arranged in a first direction. The cylindrical lens faces at least two rows of pixels, and has an effective refractive index for causing light from the at least two rows of pixels to advance in separating directions from each other after emission from a second polarizing plate. A distance d of a cell gap and an interval s between the adjacent stripe electrodes satisfy the relation of 3.5≦s/d≦7.
US09128293B2
An image display apparatus includes a stereoscopic image display apparatus configured to display a stereoscopically visible image, and a planar image display apparatus configured to display a planar image. An adjustment section of the image display apparatus adjusts relative positions, relative sizes, and relative rotations of a left-eye image taken by a left-eye image imaging section and a right-eye image taken by a right-eye image imaging section. The adjusted left-eye image and the adjusted right-eye image are viewed by the left eye and the right eye of the user, respectively, thereby displaying the stereoscopic image on the stereoscopic image display apparatus. The adjusted left-eye image and the adjusted right-eye image are made semi-transparent and superimposed one on the other, and thus a resulting superimposed planar image is displayed on the planar image display apparatus.
US09128290B2
The present invention provides an apparatus and method for combining lane information with a far-infrared image, by combining an image taken by a far-infrared image capturing device with a lane information image, and displaying the combined image such that a driver can visualize the location and position of the road lanes on a night vision image that allows visualization of objects such as, for example, animals, people, vehicles, and the like, in the road at night, or in inclement weather conditions, thereby ensuring safe driving while preventing the driver from veering out of a road lane.
US09128279B2
A wavelength-tunable interference filter comprising a first substrate, a second substrate facing the first substrate, a first reflective film provided on the first substrate, a second reflective film provided on the second substrate, the second reflective film facing the first reflective film, a first electrode provided on the first substrate, and a second electrode provided on the second substrate, the second electrode facing the first electrode, wherein the first electrode includes a first electrode layer and a second electrode layer, the first electrode layer has a first in-plane internal stress which is compressive, and the second electrode layer has a second in-plane internal stress which is tensile.
US09128278B2
A dust cleaning device includes a tray, a cover assembled to the tray, and an air nozzle. The tray defines recesses for receiving lens barrels. A bottom of each of the recesses defines a through hole communicating with the lens barrel. The cover includes a main body and an inlet tube. The main body includes a top wall, a bottom wall, sidewalls, guide passages between the top and bottom walls, an inlet passage, and outlet passages. The inlet tube extends from the top wall. The guide passages criss-cross and communicate with each other. The sidewalls shield the guide passages. The inlet passage communicates with an inside of the inlet tube and one of the guide passages. The outlet passages communicate with the guide passages and are exposed at the bottom wall. The outlet passages are aligned with the respective recesses. The air nozzle is mounted in the inlet tube.
US09128276B2
An optical imaging system includes, in the order from an object side to an image side, a first lens element with positive refractive power, a second lens element, a third lens element, a fourth lens element, and a fifth lens element. Each of the fourth lens element and the fifth lens element includes at least one aspheric surface. The fourth lens element and the fifth lens element are made of plastic. The fifth lens element includes a concave image-side surface and at least one inflection point. An air gap is formed on an optical axis between every two lens elements adjacent to each other among all lens elements, and the optical imaging system further includes a stop.
US09128275B2
A variable magnification optical system includes a negative first lens group, a stop, and a positive second lens group. The distance in an optical axis direction between the first and the second lens groups is reduced when magnification is changed from the wide angle end to the telephoto end. The stop is fixed with respect to an image plane when magnification is changed, and the first lens group includes a positive lens, a negative lens, a negative lens, and a positive meniscus lens with a convex surface on the object side in order from the object side. The optical system satisfies predetermined conditional expressions with respect to the average Abbe number of the positive lens and the positive meniscus lens of the first lens group at the d-line, and the focal length of the entire system at the wide angle end and the focal length of the negative lens.
US09128273B2
A zoom lens includes a first lens unit of a positive refractive power, a second lens unit of a negative refractive power, a third lens unit of a positive refractive power, and a rear lens group including one or more lens units in order from an object side to an image side, the first, second, and third lens units being moved towards an object side during zooming from a wide-angle end to a telephoto end with respect to an image plane, wherein the first lens unit includes a positive lens and a negative lens, and movement amounts of the first, second, and third lens units during zooming from a wide-angle end to a telephoto end and a focal length of the entire zoom lens at the wide-angle end are appropriately set.
US09128271B2
A super wide angle lens substantially consists of a positive first lens group in which a positive first lens, a negative second lens, a negative third lens, a negative fourth lens, a positive fifth lens, a sixth lens unit that is a cemented lens, a seventh lens, an aperture stop, and an eighth lens unit that is a cemented lens are arranged in this order from an object side, a second lens group in which a first lens unit that is a positive single lens or a cemented lens and a second lens unit that is a cemented lens are arranged in this order from the object side, and a third lens group including a positive lens. The super wide angle lens is structured in such a manner to satisfy conditional formula (1): 0.8<(T16+T17)/f<2.5.
US09128270B2
An imaging lens consists of seven lenses of a first lens that has positive refractive power in the vicinity of an optical axis and a convex surface facing an object side in the vicinity of the optical axis, a second lens, a third lens, a fourth lens, a fifth lens, a sixth lens, and a seventh lens having a concave surface facing an image side in the vicinity of the optical axis, and at least one of the surfaces of which includes an inflection point, and both of the surfaces of which are aspherical, which are in this order from the object side. Further, each of the first lens through the seventh lens is a single lens.
US09128269B1
A lens array includes a plurality of micro-lens modules. Each of the micro-lens modules includes a first lens group and a second lens group. The first lens group and the second lens group are arranged sequentially from an object side to an image side along an optical axis. An effective focal length (EFL) of the first lens group is f1, an EFL of the second lens group is f2, and the micro-lens modules satisfy a following condition: −0.2
US09128267B2
An imaging lens substantially consists of, in order from an object side, five lenses of a first lens that has a positive refractive power and has a meniscus shape which is convex toward the object side, a second lens that has a biconcave shape, a third lens that has a meniscus shape which is convex toward the object side, a fourth lens that has a meniscus shape which is convex toward the image side; and a fifth lens that has a negative refractive power and has at least one inflection point on an image side surface. Further, the following conditional expression (1) is satisfied. 1.4
US09128262B2
A fiber optic telecommunications device includes a rack for mounting a plurality of chassis, each chassis including a plurality of trays slidably mounted thereon and arranged in a vertically stacked arrangement. Each tray includes fiber optic connection locations and a cable manager coupled to the tray and also coupled to the chassis, the cable manager for routing cables to and from the fiber optic connection locations and defining a plurality of link arms pivotally connected such that the manager retracts and extends with a corresponding movement of the tray, wherein the link arms pivot relative to each other to prevent cables managed therein from being bent in an arc having a radius of curvature less than a predetermined value, each link arm defining a top wall, a bottom wall, and two oppositely positioned sidewalls, each link arm defining an open portion along at least one of the sidewalls and an open portion along the top wall for receiving cables therein, the open portions along the top wall and the at least one of the sidewalls communicating with each other.
US09128261B2
An optical communication module according to the present invention includes an optical semiconductor element with an optical function region that performs light-receiving function or light-emitting function, while also including a first resin member covering the optical semiconductor element and made of a resin that transmits light emitted from the optical function region or light to be received by the optical function region, and a second resin member covering the first resin member. The optical communication module includes an attachment hole for attaching an optical fiber. The attachment hole exposes a part of the first resin member and is open at an outer surface of the second resin member.
US09128255B2
The invention prevents an LC type optical connector plug from seriously harming a body of a worker, particularly eyes of the worker in a work for fitting the LC type optical connector plug having various concavo-convex shapes. A connector housing (1) has in its inner side of a side wall a guide groove line (7a, 7b, 12) which inserts and guides LC type optical connector plugs (P1, P2) from its fitting portion, and a recess portion (11b) which conforms to a swing motion of a shutter plate (11), and the guide groove line (7a, 7b, 12) is constructed by cutting a part of the guide groove line (7a, 7b, 12) so as to form the same planar shape by forming the recess portion (11b).
US09128253B2
The rotary connector is intended for use in the field of fiber optic communication and information transfer. The rotary optical cable connector includes a housing, in which two units with guide sleeves are arranged opposite one another, each having the ends of optical cables fastened therein. One of the units is able to rotate, and the other is fixed. A prism is situated between the guide sleeves, and retainers in the form of rods with a cruciform cross-section are secured in the sleeves. The optical cables are disposed in the recesses in the aforesaid retainers and the ends of the cables line up with gradient-index lenses. The rotary connector transmits four rotating light beams with minimal loss.
US09128252B2
A method and apparatus for routing light signals. A light signal is sent into a first optical fiber core in an optical coupler having an input region, a coupling region, and an output region. The first optical fiber core is located in a cladding having a substantially circular cross section. The light signal is coupled between the first optical fiber core and one of the first optical fiber core and a second optical fiber core in the coupling region of the optical coupler based on a position of the coupling region as the light signal travels through the coupling region to the output region of the optical coupler using a switching system configured to move the coupling region between one of a first position and a second position.
US09128249B2
An optical measurement method that can suppress variation in detection sensitivity even if an optical probe is bent, and an optical probe suitably used for the method are provided. An optical probe 10 includes an optical fiber 11 that transmits light between a proximal end 11a and a distal end 11b, an optical connector 12 connected with the optical fiber 11 at a side of the proximal end 11a, a focusing optical system 13 and a deflecting optical system 14 optically connected with the optical fiber 11 at a side of the distal end 11b, and a support tube 15 and a jacket tube 16 surrounding the optical fiber 11 and extending along the optical fiber 11. The optical fiber 11 is twisted by a number of turns in a range from one turn/m to 50 turns per meter around an axis of the optical fiber as the center and fixed relative to the support tube 15.
US09128246B2
On-chip non-reciprocity can be achieved by employing micron-sized optomechanical (OM) devices that are fabricated on-chip and which can be integrated with other optical elements. Non-linear coupling between light and a mechanical mode inside a resonator can provide a non-reciprocal response of the OM system, which can be induced and fully controlled by an external driving electromagnetic field. By choosing different resonator and/or waveguide configurations and by tuning different system parameters, the same OM coupling mechanism can be used to provide isolation (e.g., as an optical diode), non-reciprocal phase shifting, and/or routing applications. Even in the presence of a finite intrinsic mode coupling inside the resonator, non-reciprocal effects remain large for a sufficiently strong OM coupling. The disclosed systems, methods, and devices can be applied on a single photon level, which may find use for various non-reciprocal applications in the classical optical as well as the quantum regime.
US09128239B2
In an optical device, a first spring connects a first lens frame and a second lens frame for exerting a spring force thereon so that first pins of the first lens frame and second pins of the second lens frame abut a first cam groove and a second cam groove of a cam barrel respectively. A second spring connects the second lens frame and a third lens frame for exerting a spring force thereon so that the second pins of the second lens frame and third pins of the third lens frame abut the second cam groove and a third cam groove of the cam barrel respectively. The first spring may be a compression spring, and the second spring may be an extension spring.
US09128231B2
This display device is provided with: a light source unit having a light source and a light source substrate; a display panel; a light receiving face that is disposed on the back side of the display panel, and upon which light is incident; a light guide plate having a light exiting surface that emits light toward the back side of the display panel; a wall that faces the light receiving face in such a manner that a gap is formed between the light receiving face and the wall; a light source support member that supports the light source unit, and is inserted with the light source unit in the gap etc. from the back side of the light guide plate; and an elastic member that is disposed on the light source support member, protrudes farther toward the light receiving surface than the light source, is inserted in the gap before the light source unit, and is formed of an elastic material.
US09128225B2
The present invention relates to a backlight unit with sag control patterns, comprising a light source formed in a side surface of a light guide plate; and a plurality of optical patterns formed on a lower surface of the light guide plate, sag of the plurality of optical patterns increasing as the optical patterns become more distant from the light source. By controlling sag of optical patterns formed in a light guide plate, efficiency of light emitted from a backlight unit can be improved and uniformity of the light can be maintained. Also, since sag of optical patterns can be controlled, by increasing the number of optical patterns (by improving fill factor), light efficiency and uniformity can be controlled easily. Also, compared with a conventional method for manufacturing white dot patterns, white dot patterns can be more efficiently manufactured in terms of development time and costs.
US09128222B1
A lighting apparatus includes a light-diffusive plate having opposing faces bounded by one or more sides. The plate has disruptions on a first face of the opposing faces and a first channel along at least a portion of a first side of the one or more sides. A first cover has first and second surfaces disposed over the first channel with the first surface facing the first side of the light-diffusive plate. A plurality of light-emitting diodes (LEDs) is disposed on the first surface of the first cover and within the first channel. The LEDs electrically coupled with wiring are integrated with the first cover.
US09128220B2
A light guiding element has a first principal surface, a second principal surface which opposes the first principal surface, a first lateral surface which intersects with the first principal surface and the second principal surface, and a second lateral surface which opposes the first lateral surface. The light guiding element allows light incoming from the first lateral surface to propagate between the first principal surface and the second principal surface. The light guiding element includes a portion in which a refractive index varies substantially continuously from the first principal surface toward the second principal surface.
US09128202B2
A method of collecting data from wireless sensor units arranged in a network. The method may comprise the steps of initiating distribution of control signals to the wireless sensor units, acquiring data with the wireless sensor units by sensing one or more physical parameters, each of the wireless sensor units transmitting the acquired data in response to the control signals; and each of the wireless sensor units transmitting of at least a portion of the acquired data according to a prioritizing algorithm associated with each respective wireless sensor unit.
US09128199B2
Systems and methods may be provided for setting up a geophysical seismic information-gathering grid utilizing an alternating source pattern as well as an alternating receiver pattern using base patterns including but not limited to “I+H” or “H+I” and “box plus.” Use of such base patterns may allow seismic data to be collected and processed using a reduced number of sources and receivers to provide a seismic imaging plot having increased and noticeably improved resolution than is presently available.
US09128198B2
The present application discloses an X-ray imaging apparatus for determining a surface profile of an object under inspection that is positioned at a distance from the apparatus. The X-ray imaging system has an X-ray source for producing a scanning beam of X-rays directed toward the object, a detector assembly for providing a signal representative of an intensity of X-rays backscattered from the object, and processing circuitry to determine a time difference between when the X-ray source is switched on and when the backscattered X-rays arrive at the detector assembly. The processing circuitry is adapted to output data representative of the surface profile of the object under inspection.
US09128188B1
Systems, methods, and articles of manufacture for automatic target recognition. A hypothesis about a target's classification, position and orientation relative to a LADAR sensor that generates range image data of a scene including the target is simulated and a synthetic range image is generated. The range image and synthetic range image are then electronically processed to determine whether the hypothesized model and position and orientation are correct. If the score is sufficiently high then the hypothesis is declared correct, otherwise a new hypothesis is formed according to a search strategy.
US09128180B2
Techniques and tools for reducing power consumption of computing devices (e.g., mobile devices such as mobile phones and tablet computers) that perform position tracking operations are described. In described examples, a low-power processor calculates (e.g., in real time) position information (e.g., GPS position fixes) based on information received from a positioning system (e.g., GPS) and stores the position information for later use in a buffer associated with the low-power processor (e.g., in storage on the low-power processor). Described examples allow position information to be calculated in real time and stored while the device is in a low-power state, and can be used with location-based applications that do not require position information to be delivered to the application in real time.
US09128178B2
A correlation calculation process execution method utilizes a first mode and a second mode as a positioning mode that performs a correlation calculation process on a received signal of a positioning signal that is spread-modulated by a spreading code and a signal replica of the spreading code, the first mode being a mode in which correlation values are averaged in a first mode process period to output a correlation value, and the second mode being a mode in which correlation values are integrated in a second mode process period to output a correlation value, the method including repeating the first mode and the second mode while setting an intermediate time of the first mode process period to be the same as an integration reference time of the second mode process period, and variably setting a ratio of an ON/OFF period in at least one period of the first mode process period and the second mode process period.
US09128166B2
There is provided a secondary battery tester for testing a state of a secondary battery based on an impedance characteristic of the secondary battery. The tester includes: an impedance acquiring section configured to acquire an impedance value of the secondary battery; and a determining section configured to determine a state of a solid electrolyte interface (SEI) layer of the secondary battery based on the impedance value acquired by the impedance acquiring section.
US09128161B2
A voltage monitoring device monitors voltage of each of battery cells connected in series to one another to configure an assembled battery. The device includes a capacitor circuit, a filter circuit, an input side connection switching unit, a potential difference detection unit, and an output side connection switching unit. The capacitor circuit includes a plurality of capacitors connected in series to one another. The filter circuit includes a plurality of resistors connected to an electrode terminal of each of the battery cells. The plurality of resistors are divided into a first resistor group and a second resistor group. The first resistor group is connected to a connection point between adjacent capacitors of the plurality of capacitors. The second resistor group is connected to an independent end of the plurality of capacitors. A resistance value of the first resistor group is smaller than a resistance value of the second resistor group.
US09128150B2
An integrated circuit includes an LBIST controller operative to run a test program on at least one selection of core logic of the integrated circuit to test the operability of the at least one selection of core logic. The integrated circuit also includes a monitoring logic structure operative to detect at least one type of operation executed for the test program from at least one particular control signal activated by the LBIST controller for controlling the at least one selection of core logic to execute the test program from among at least one control signal for controlling operations on the at least one selection of core logic.
US09128147B2
A test board can be inserted to a test head and removed from the test head while the connecting section for mounting thereon devices under test is mounted on the upper portion of the test head. A test head for retaining therein at least one test board for testing devices under test, includes: a casing provided with, on one side surface thereof, an opening through which the at least one test board is inserted and removed, the casing retaining therein the at least one test board with an upper side thereof oriented towards an upper surface of the casing; and a mounting member that guides a lower side of the at least one test board through the opening to a pre-set position, imposes an upward force to the lower side of the at least one test board, thereby mounting the at least one test board to the casing.
US09128145B2
A semiconductor apparatus includes: an output timing controller configured to delay an applied external read command by a predetermined time and generate a normal output enable flag signal, during a normal mode, a test output timing controller configured to generate a DLL clock signal from an external clock signal, delay the applied external read command in synchronization with the DLL clock signal, and output the delayed applied external read command as a test output enable flag signal, during a test mode, and a multiplexer (MUX) configured to output any one of the normal output enable flag signal or the test output enable flag signal as an output enable flag signal.
US09128135B1
A system including a plurality of actuation devices with each actuation device configured to have a metalized and charged to an electrical potential rear part which moves to a designated position representative of a designated manipulation, when at least one actuation device is manipulated, a capacitive sensor array configured to measure a composite electric field produced by the plurality of actuation devices, an acquisition device configured to acquire electric field data indicative of the measured electric field, a converter configured to convert the acquired electric field data into analog values, and a processor configured to evaluate to the analog values to determine which of the at least one actuation devices was manipulated, how the manipulation reflects operation of the control panel, or to provide a response indicative of the manipulation. A method and a computer program product are also disclosed.
US09128134B2
A tester for testing a transformer is provided. The tester comprises a primary voltmeter and a plurality of secondary voltmeters. The tester may also comprise an ammeter in series with a voltage source configured to apply voltage to the transformer. The primary voltmeter is configured to measure voltage induced across a primary winding of the transformer, while the secondary voltmeters may simultaneously measure voltage outputs at secondary windings of the transformer. The tester is configured to calculate ratios, saturation curves, and knee points for multiple winding combinations based on the measurements simultaneously obtained by the ammeter and the primary and secondary voltmeters.
US09128131B2
A device and method for more accurately measuring power consumption in a residential application without having to make connections to high voltage sources in a distribution panel. Since the device calculating the power consumption generally needs to be powered to perform its functions (e.g., plugged into wall outlet), the disclosure utilizes the power supply as a voltage source for measuring voltage without having to make connections to the panel.
US09128121B2
A mechanism is described for facilitating a dynamic electro-mechanical interconnect capable of being employed in a test system according to one embodiment. A method of embodiments of the invention may include separating, via a cavity, a first conductor of an interconnect from a second conductor of the interconnect, and isolating, via the cavity serving as a buffer, a first electrical path provided through the first conductor from a second electrical path provided through the second conductor.
US09128120B2
Disclosed is a probe which stably transmits a test signal. The probe electrically connects a semiconductor device and a tester for testing the semiconductor device. The probe may include an upper plunger which is configured to be electrically connected to the semiconductor device; a lower plunger which is configured to be electrically connected to the tester; an elastic member which is disposed between the upper plunger and the lower plunger, and elastically biases the upper and lower plungers to have them spaced from each other; a conductive member which is disposed in an inside or outside of the elastic member and electrically connects the upper plunger and the lower plunger; and a barrel which accommodates therein the upper plunger, the lower plunger, the elastic member and the conductive member.
US09128119B2
An electronics system module includes a primary electrical circuit including input connectors and output connectors and a filter circuit connected between the primary electrical circuit and ground. The module also includes a switch element connected between the primary electrical circuit and ground. The switch element is configured to be engaged by a test connector to open the switch to disconnect the primary electrical circuit from ground. The test connector includes electrical connectors configured to connect to the input connectors and the output connectors of the primary electrical circuit. The switch element is configured to automatically close based on the test connector being disengaged from the switch element.
US09128117B2
A method for sharpening a nanotip involving a laser-enhanced chemical etching is provided. The method includes immersing a nanotip in an etchant solution. The nanotip includes a base and an apex, the apex having a diameter smaller than a diameter of the base. The method also includes irradiating the nanotip with laser fluence to establish a temperature gradient in the nanotip along a direction from the apex to the base of the nanotip such that the apex and base are etched at different rates.
US09128108B2
The invention relates to an immunoassay method and kit for the detection and/or the determination of mephedrone, mephedrone metabolites and related compounds. The invention is underpinned by a novel antibody, derived from a novel immunogen, that is sensitive and binds to mephedrone, mephedrone metabolites and related compounds.
US09128093B2
The present invention relates to systems and devices to treat and/or prevent inflammatory conditions within a subject and to related methods. More particularly, the invention relates to systems, devices, and related methods that sequester leukocytes and/or platelets and then inhibit their inflammatory action.
US09128088B2
The present invention allows a screening method for identifying novel drugs for the treatment of tuberculosis as well as a diagnostic method for identifying clinical strains that are resistant to these novel drugs. In particular, the present invention relates to a method for screening in vitro drug candidates for the treatment of tuberculosis by interfering with the arabinogalactan biosynthesis, the said method comprising a step of putting into contact a Mycobacterium tuberculosis cell culture over-expressing a protein that performs the transformation of decaprenyl-P-ribose to decaprenyl-P-arabinose and that can be encoded by rv3790 gene or homologues thereof or any open-reading artificial frame whose gene product is identical or homologue to Rv3790 protein, with a drug candidate and then evaluating the percentage of inhibition caused by the drug candidate against a control in an assay test, such as an antibacterial test or an enzymatic test.
US09128084B2
A detection system (100) and a sensor chip (1) for detecting target molecules, and thus corresponding analytes in a sample is described. Typically the detection system (100) includes a sensor chip (1). The sensor chip (1) comprises on its detection surface (33) a dissolvable reagent layer (5). When the dissolvable reagent layer (5) is in contact with sample fluid, free reagent is generated, assisting in the interaction between a label and target molecules, thus allowing for label based detection. The sample thereby is exposed to mobile reagents in a burst. The reagent layer may contain an enzyme allowing enzymatic assays.
US09128078B2
A technique is provided for manufacturing a nanogap in a nanodevice. An oxide is disposed on a wafer. A nanowire is disposed on the oxide. A helium ion beam is applied to cut the nanowire into a first nanowire part and a second nanowire part which forms the nanogap in the nanodevice. Applying the helium ion beam to cut the nanogap forms a signature of nanowire material in proximity to at least one opening of the nanogap.
US09128076B2
The present techniques are directed to a method for microprobe analyses of isotope ratios in inhomogeneous matrices. The method includes selecting matrix standards that have matrices that resemble a target matrix. A bulk isotope analysis is run on each of the matrix standards to determine a bulk isotope ratio value. A microprobe analysis is run on each of the matrix standards to determine a microprobe isotope ratio values for each of the plurality of matrix standards. Spurious values are eliminated from the microprobe isotope ratio values. The microprobe isotope ratio values are averaged for each of the matrix standards to create an average microprobe isotope ratio value associated with each of the matrix standards. The bulk isotope ratio value for each of matrix standards is plotted against the average microprobe isotope ratio value associated with each of the matrix standards to create a matrix corrected calibration curve.
US09128073B2
The invention provides a needle moving device which can detect a fault in a signal provided by a system controller to a performing device. An X-direction driving motor (4a) and a Y-direction driving motor (4b) in a driving portion (4) of an autosampler (1a) are provided with encoders (12a, 12b) for measuring moving distances of a needle (2) in respective directions from rotation numbers of the respective driving motors (4a and 4b). A determining portion (20) provided to a system controller (1b) locates a position of the needle (2) after the movement based on signals from the encoders (12a, 12b) and determines whether the position is a position of a designated sample vessel.
US09128071B2
A liquid mixing device that decreases a concentration non-uniformity in the flow direction of a mobile phase and a liquid chromatograph that uses the liquid mixing device are provided. The liquid mixing device is configured to include a flow channel unit that is made from an introduction channel, a branch portion that is positioned in a downstream of the introduction channel, multiple branched flow channels that branch from the branch portion, a junction portion in which the multiple branched flow channels join together, and a discharge channel of the downstream of the junction portion. The multiple branched flow channels are different in terms of any one of, or several of width, depth, and length that are associated with an external shape, and a structure filling the inside of the flow channel and thus the times for the liquid to pass through the branched flow channels are different from each other.
US09128063B2
Apparatuses and methods for measuring stress or strain in a conductive material without physical contact with the material are provided. The device comprises an inductor circuit configured to induce an alternating current into the material along a first path; and a detector configured to detect a signal representative of the stress in the material along the first path when current is induced in the material.
US09128056B2
The present invention provides a sample holding carrier that can accurately measure a sample with a simple configuration, and a fluorescence detection system and device that use the same. Biosensor substrate includes: base substrate on which excitation light is incident from a lower surface; reflecting film that is arranged on an upper surface of base substrate to partially reflect the excitation light; and plural wells that are arranged on an upper surface side of reflecting film and have bottom surface portions. The excitation light is converged to be incident on base substrate. Distance from reflecting surface that is of a boundary between reflecting film and base substrate to bottom surface portion of well is less than or equal to a focal depth of the excitation light. Therefore, the sample accommodated in bottom surface portion of well can surely and efficiently be irradiated with the excitation light, and accurately be measured.
US09128055B2
Provided is an information processing apparatus including an estimation unit that expresses a light intensity distribution, which is obtained by irradiating light to a measurement object of a measurement target having a plurality of substances with mutually different responsive characteristics to the light on a surface and/or an inside of the measurement object, as a linear combination of light intensity distributions, which are obtained by irradiating the light to reference measurement objects, each of which has a single substance, models the light intensity distribution obtained from each of the reference measurement objects so as to follow a predetermined probability distribution, and estimates a combination coefficient of the linear combination from the light intensity distribution obtained from the measurement object of the measurement target.
US09128054B2
A detection apparatus and method for an ion migration spectrum include acquiring an ion migration spectrum of pure carrier gas and an ion migration spectrum of carrier gas containing a test substance sample and performing differential process on the ion migration spectrum of the pure carrier gas and the ion migration spectrum of the carrier gas containing the test substance sample to acquire a differential spectrum. The value of a characteristic peak of the differential spectrum represents properties of the sample of substances. The method avoids interferences on the migration spectrum from interference sources of the apparatus itself, thereby improving detection sensitivity and accuracy of the ion migration spectrum, and migration spectrum shift caused by variations in the environmental conditions can be found and corrected through the differential process on the migration spectrum of the pure carrier gas, thereby achieving self-stableness and self-correction of the ion migration spectrometer.
US09128050B2
An apparatus and method for inspecting a graphene board. The graphene board inspecting apparatus for inspecting a graphene board on which at least one graphene layer is formed includes: a light processing unit which emits at least one light on the graphene board, receives the at least one light penetrating the graphene board and converts the received at least one light to an output signal; a transmittance detecting unit which receives the output signal from the light processing unit to inspect a transmittance of the at least one light penetrating the graphene board; and a determination unit which is connected to the transmittance detecting unit and receives the detected transmittance to determine a state of the graphene board by analyzing the detected transmittance.
US09128048B2
A method for assessing the cure status of a fibrous blanket manufactured with mineral fibers and binder is disclosed and comprises a using an online optical reflectance measurement as an assessment of cure status. The optical reflectance measurement may preferably be a color image taken of any surface, and in particular of a sectioned face, after which the image is optionally divided into multiple regions of interest (ROI) and analyzed for a color system variable that is representative of cure status. In some embodiments, the color system variable is the B value. Alternatively, the optical reflectance measurement may be UV or IR reflectance of a sectioned face. When two or more regions of interest are defined on a sectioned face, comparative information is valuable to assess cure at different levels, layers or portions of the interior of the fibrous product.
US09128042B2
The present invention is applied for an image capturing device having a light source and a camera that captures an image of a measurement subject placed in an optical path that lies between said camera itself and said light source. The image capturing device according to the present invention includes a control unit that subtracts a plurality of frame images captured by said camera during an OFF period of said light source from a plurality of frame images captured by said camera during an ON period of said light source, the number of frame images captured by said camera during the OFF period being the same as that number of frame images obtained by said camera during the ON period and integrates the differences between their images.
US09128037B2
The invention relates to a measurement apparatus for the determination of gas concentrations. The apparatus comprises two spectral channels, wherein the channels are separated by a single chopper wheel. The chopper wheel has several functions. On the transmitting side, it brings the light of the two light sources on the same measuring path, on the receiving side it associates the light to the associated receiver; it has its chopper function to use the lock-in technique; and it opens the possibility to implement an easy zero point correction.
US09128019B2
The current invention relates to a method and apparatus for assessing the condition of a pipeline and also predicting the future rate of deterioration and/or possible failure of the pipeline. The method includes the steps of selecting at least one portion of the pipeline for which the prediction is to be made and, for that portion, monitoring or inspecting and assessing the condition of the pipeline wall, and typically also assessing the condition of any coating of the pipeline at said portion as well as the condition of the soil adjacent the pipeline. The measurement is performed along the length of the portion and preferably around the circumference of the pipeline at said portion. Data is collected for each cell of a grid which represents the said portion and on the basis of the measured data and, selectively, previous data and or reference data, an accurate prediction can be made as to the future condition of the pipeline and also identify potential future problems or required remedial works.
US09128015B2
Systems and methods are provided for sample processing. A device may be provided, capable of receiving the sample, and performing one or more of a sample preparation, sample assay, and detection step. The device may be capable of performing multiple assays. The device may comprise one or more modules that may be capable of performing one or more of a sample preparation, sample assay, and detection step. The device may be capable of performing the steps using a small volume of sample.
US09128014B2
Systems and methods are provided for producing fluids with desired concentration factors from the given supply of any two concentration factors, one greater than the target CF and one less than the target CF, of the same fluid. According to one embodiment, a method is provided that stores intermediate waste droplets from a sequence of mix and split steps and repeats certain steps of the sequence using the stored intermediate waste droplets. Such a method may produce additional target CF droplets faster than repeating the entire sequence. In another embodiment, a method of volumetric error resilient target CF droplet generation has been described, and includes reusing the stored intermediate waste droplets and involves a collection of capacitive sensing circuits associated with some electrode platforms.
US09128010B2
Methods for monitoring scale deposition in a water-containing industrial process are disclosed. In certain embodiments, the water-containing industrial process is an aqueous cooling system. In certain embodiments, the methods incorporate fluorometric monitoring and control techniques along with a piezoelectric microbalance sensor. A particular embodiment of a piezoelectric microbalance sensor is additionally disclosed, along with at least one method for using the particular embodiment that is independent of whether fluorometric monitoring and control techniques are utilized.
US09128000B2
A potentiostat data link (PDL) unit is provided which can remotely monitor the formation and growth of cracks in metal structures. A PDL includes a sealed box containing two or more modified potentiostats, a power supply, a CPU, a memory device, and computer networking capability. The PDL can be mounted in a remote, difficult-to-access location. Each potentiostat has a lead to a sensor affixed to a structure to be analyzed for the presence of growing cracks due to metal fatigue in a metal structure.
US09127997B2
A measuring element for measuring forces that includes a first measuring element part by which at least one force to be measured is received, a second measuring element part by which at least one force to be measured is received, the second measuring element part being spaced from the first measuring element part, and a plurality of sensors extending between the first measuring element part and the second measuring element part and configured to measure the at least one force received by the first and second measuring element parts.
US09127995B2
A force transducer, in particular a weighing cell, includes a spring body, which deforms under the action of a force or load to be measured, and a sensor that includes two separate sensor parts mounted at different locations of the spring body and that generates a sensor signal which is dependent on the relative position of the sensor parts with respect to each other. In order to improve the adaptation of the sensor to the spring body, one of the sensor parts is attached to the spring body with interposition of an electromechanical actuator and a control device is present, which controls the actuator dependent on the sensor signal in the direction of a reduction in the positional difference of the sensor parts.
US09127989B2
A microwave ablation system incorporates a microwave thermometer that couples to a microwave transmission network connecting a microwave generator to a microwave applicator to measure noise temperature. The noise temperature is processed to separate out components the noise temperature including the noise temperature of the tissue being treated and the noise temperature of the microwave transmission network. The noise temperature may be measured by a radiometer while the microwave generator is generating the microwave signal or during a period when the microwave signal is turned off. The microwave ablation system may be configured as a modular system having one or more thermometry network modules that are connectable between a microwave applicator and a microwave generator. Alternatively, the modular system includes a microwave generator, a microwave applicator, and a microwave cable that incorporate a microwave thermometry network module.
US09127985B2
Embodiments of the invention provide a simple and robust system that allows non-resonant background to be removed from anti-Stokes signals generated during coherent anti-Stokes Raman spectroscopy (CARS) even when using cheaper laser systems, which do not have transform limited pulses. In particular, resonant CARS signals have a real and imaginary component. The imaginary component is directly related to the spontaneous Raman spectrum, for which there are already large spectral databases to allow chemical identification. The NRB signal, on the other hand, only has a real component. Within embodiments of the invention we recover the imaginary component of the entire CARS signal by simultaneously generating two CARS signals at orthogonal polarisations: one has the imaginary components destructively interfering with (i.e. subtracted from) the real components, the other has them constructively interfering. Measuring these two polarisations and subtracting them therefore cancels out the real part of the signal, leaving only the imaginary components.
US09127984B2
A SERS-active structure includes a substrate, at least one metal nanoparticle, a dielectric layer and a metal nanolayer. The metal nanoparticles are disposed on the substrate. The substrate and the metal nanoparticles are covered by the dielectric layer, so that the dielectric layer forms a recessed portion with a dihedral angle formed by a surface of the dielectric layer at which the at least one metal nanoparticle contacts the substrate. The dielectric layer is covered by the metal nanolayer and the metal nanolayer has a gap located at and exposing the recessed portion.
US09127983B1
The resonant frequency of an optical micro-resonator may be controlled by “locking” an operating frequency/wavelength of the resonator using CMOS compatible electronic components.
US09127979B2
An optical measuring device includes a case, a reflective layer and a light collecting lens module. A measuring chamber and a channel, which is connected to the measuring chamber and is connected to an opening of the case, reside in the case. The reflective layer is disposed onto an inner surface of the measuring chamber. The light collecting lens module is located inside the channel. A light beam emits into the channel of the optical measuring device through an opening, passes through the light collecting lens module and enters the measuring chamber afterward.
US09127972B2
Method and system for calibrating a mass flow sensor. The mass flow sensor includes an impact sensor that receives an impact force due to collisions with a plurality of solid particles to generate an output signal. A model relates a mass flow input to the output signal. At least one measurable parameter is varied over a plurality of samples by varying a physical component of the mass flow sensor, and a generated output signal is received. The model can be calibrated based on the received output signal for each of the plurality of samples. A mass-flow input can also be estimated while simultaneously updating the model.
US09127970B2
A hydraulic device including an autonomous electronic sensor assembly that has at least one miniature sensing element. Sensing elements of this type require a minimal amount of space. It is especially preferred if the sensor assembly has at least one miniature transmitter. As the hydraulic device does not then require any sensitive electric cables for signal transmission, the reliability of its monitoring capabilities is optimized.
US09127968B2
A flexible optical impact detection sensor is mounted on an outboard portion of the front bumper for signaling an offset rigid barrier impact event to a forward corner of a motor vehicle and deployment of a small offset rigid barrier airbag mounted on the front rail. The airbag is attached proximate a distal end of a front rail. The flexible optical impact detection sensor, attached to a rear surface of an outboard portion of the front bumper, generates a signal upon a corner impact event, whereby a controller processes the signal generated by the impact detection sensor and electrically actuates an inflator upon a predetermined impact severity. The airbag in the inflated condition acts against the offset rigid barrier to generate a lateral force against the offset rigid barrier to push the motor vehicle away from the barrier and thereby redirect impact energy by lateral movement of the motor vehicle.
US09127963B2
A method for selection of bellwether smart meters from a plurality of smart meters in a power grid can include for at least each of a subset of the plurality of smart meters, monitoring a meter; determining at least one anomaly in the meter, in response to a determination of an anomaly in the meter, assigning a weight to the anomaly, determining a sum of weights of anomalies in the meter and selecting a sub group of the plurality of smart meters as bellwether meters.
US09127961B2
A projected route between a first location and a second location is determined. A first point-of-interest associated with a third location proximate to the projected route is determined. The first point-of-interest is presented to a user. Additionally or alternatively, a plurality of locations are identified. Each location of the plurality of locations is associated with a respective time. A point-of-interest is received from a user. The point-of-interest is associated with a point-of-interest location. A projected route including the plurality of locations and the point-of-interest location is determined based at least in part on at least one time associated with the plurality of locations.
US09127958B2
Values of a variable affecting the determination of the driver of a shared ride may be calculated. Each value may be associated with a respective potential driver. An optimal value from the calculated values may be selected. A potential driver associated with the selected optimal value may be assigned as the driver of the shared ride. The variable may be carbon emission, electricity consumption, passenger to driver role ratio, driving distance, driving time, vehicle size, fuel efficiency, electricity to gasoline usage ratio, accident occurrence, vehicle safety, vehicle comfort, or vehicle speed. The optimal value may be the lowest value or the highest value from the calculated values. Each value may be calculated based on parameters specified by the respective potential driver.
US09127947B2
A method and system for tracking and updating bias in an inertial sensor by determining a maximum bias drift and a noise band for a sensor, determining a prior bias value of the sensor, and measuring a current bias value of the sensor. The method and system can further include calculating a bias difference between the prior bias value and the current bias value, and updating the prior bias value with the current bias value if the current bias value is within the noise band and the bias difference is less than or equal to the maximum bias drift.
US09127939B2
The present invention provides a stitch measurement method for making a plurality of partial measurements, and obtaining an overall shape by combining partial measurement results, including a step of dividing, on lattices, each peripheral partial measurement region including an external portion of an overall measurement region into a first region inside the overall measurement region and a second region outside the overall measurement region, and dividing each central partial measurement region which does not include any external portion of the overall measurement region into a first region and a second region according to division patterns of the peripheral partial measurement region, a step of formulating first orthogonal function sequences on the first regions, and a step of defining linear combinations of respective functions of the first orthogonal function sequences on the first regions as first system errors for the respective partial measurement regions on the overall measurement region.
US09127938B2
This disclosure provides systems, devices, and methods for capturing and measuring surface topography. This disclosure provides a high resolution retrographic sensor comprising a volume of elastomer and a thin, opaque reflective membrane. The reflective membrane is arranged to conform to a specimen that contacts it. The disclosure provides a high resolution visualization system comprising the retrographic sensor and an illumination source. Also provided are high resolution measurement systems comprising the retrographic sensor, an illumination source, an imaging device, and a processing component.
US09127936B2
Method for measuring an extruded profile using a measuring apparatus, wherein the measuring apparatus is designed to produce and measure at least two laser light sections on a surface of the profile, which is being pulled through the measuring apparatus, by means of at least one laser light section sensor from a respective, different position around the profile, wherein the at least two laser light sections are situated essentially in one plane. By positioning at least two references and/or reference markers from the adjacent positions together with the extruded profile in a respective common measurement capture area, said references or reference markers are used for calibration of respective raw image of the at least one laser light section sensor. Thus, the calibrated raw image data are correctly mapped in a common coordinate system from the respective position.
US09127935B2
A laser centering tool for surface areas used to find the center point of a surface. The laser centering tool uses single or multiple laser sources to project a plurality of lines on a horizontal or vertical surface. It may comprise of multiple lasers, rotational plates, prism, beam splitter, gear housing, and/or a gear mechanism. At least one center laser line remains stationary between at least two edge laser lines. The edge lasers may be moved to outline the edge of a surface. At least one center laser projects a beam that indicates the center point of the edge lasers. The edge laser lines may be moved by rotational plates, a set of mirrors, or prism.
US09127930B2
A distance measurement method comprising: projecting a light beam having a speckle pattern to at least one reference plane to show a plurality of images with the speckle pattern on the at least one reference plane. The speckle pattern has a plurality of speckles, so as to capture the image with the speckle pattern on the reference plane to obtain a plurality of reference image information. When the object enters the area illuminated by a light source module, an image with the speckle pattern on a surface of an object is captured to obtain an object image information. Then, a plurality of brightness relationships among each of the speckles with adjacent speckles rounding each speckle are computed according to the reference image and the object image information to obtain relative brightness information of each speckle, which is used to compute position of the object.
US09127927B2
Provided are optimized scatterometry techniques for evaluating a diffracting structure. In one embodiment, a method includes computing a finite-difference derivative of a field matrix with respect to first parameters (including a geometric parameter of the diffracting structure), computing an analytic derivative of the Jones matrix with respect to the field matrix, computing a derivative of the Jones matrix with respect to the first parameters, and computing a finite-difference derivative of the Jones matrix with respect to second parameters (including a non-geometric parameter). In one embodiment, a method includes generating a transfer matrix having Taylor Series approximations for elements, and decomposing the field matrix into two or more smaller matrices based on symmetry between the incident light and the diffracting structure.
US09127925B2
In one embodiment, an apparatus comprises an optical system with multiple detectors and a processor. The optical system is configured to produce images of an optical source in a first dimension and a second dimension substantially orthogonal to the first dimension at each detector at a given time. Each image from the images is based on an interference of an emission from the optical source in a first direction and an emission from the optical source in a second direction different from the first direction. The processor is configured to calculate a position in a third dimension based on the images. The third dimension is substantially orthogonal to the first dimension and the second dimension.
US09127918B2
A distributed ordnance system comprises a plurality of ordnance controllers and a plurality of firing units. Each ordnance controller of the plurality of ordnance controllers may be operably coupled with at least one firing unit of the plurality of firing units. Each ordnance controller may be configured to provide power signals to the at least one firing unit coupled therewith, and communicate with the at least one firing unit for initiation of an ordnance event. A multiple-stage ordnance system may comprise a first stage and a second stage that each include an ordnance controller configured to control operation of an ordnance event, and at least one firing unit to initiate the ordnance event. Related methods for constructing a multiple-stage ordnance control system and controlling initiation of an energetic material are also disclosed.
US09127914B2
A blast deflecting boot has a V like shaped sole, a layer to reduce and to stop high velocity fragments, a padded core that limits the blast forces transmitted to the lower leg of a soldier, and an upper of high velocity blast fragment reducing fabric. The invention provides the sole within a layer of non-slip urethane that contains energy absorbing foam, a layer of high velocity fragment reducing para-aramid or ultra-high molecular weight polyethylene UHMWPE fabric, and a core of closed cell single or multiple density high energy absorbing foam or silicone that absorbs impact forces. The insole has a high velocity fragment reducing layer system of multiple layers of UHMWPE, or para-aramid. The sole of the present invention may have a unitary form or be assembled from multiple sections.
US09127912B2
A rifle scope having a body and a reticle mounted within the body, an elevation adjustment means for adjusting an elevation sighting of the reticle and including a vertically oriented elevation adjustment knob extending from a side of the body and being rotatable in a vertical plane about a horizontal axis to vertically adjust the elevation sighting of the reticle, and a windage adjustment means for adjusting the windage sighting of the retical and including a horizontally oriented windage adjustment knob extending from the body so as to be rotatable in a horizontal plane about a vertical axis to adjust the windage sighting of the reticle.
US09127911B2
An electro-optic system, e.g., mounted to a weapon, measures down range winds and a range-to-target for compensating the ballistic hit point. The system may include an optical light source, collimated to generate a laser spot on the target. The system may include a wind measurement receiver that captures laser light scattered from the target. The captured light may be modulated by atmospheric scintillation eddies, producing optical patterns which change in time and move with the crosswind. These patterns may be analyzed by a processor using covariance techniques to determine path-integrated crosswinds and associated errors. Ranging is done by measuring the time of flight of the laser pulse to the target collecting the scattered signal from the target. Compensated ballistic hit point, measurement errors and other data may be displayed on a micro-display digital eyepiece, overlaid on the real-time image of the target.
US09127908B2
A system comprising an unmanned aerial vehicle (UAV) configured to transition from a terminal homing mode to a target search mode, responsive to an uplink signal and/or an autonomous determination of scene change.
US09127900B2
A toy launcher that can launch multiple consecutive devices into a spin is described. The toy launcher includes a housing adapted to receive an item to be launched. The housing includes a bunching mechanism to force the item from the launcher. Additionally, a protrusion is positioned in front of the launching mechanism such that art item launched from the launching mechanism engages with the protrusion, forcing the item into a spin as it exits the launcher.
US09127899B2
A multipurpose tool for maintaining a rifle, comprising a planar body including a wider portion and a narrower portion of a first edge and a curved transition portion therebetween, wherein the narrower portion terminates in a hook-shaped element having a flat portion whose dimension is less that the outer diameter of a bolt piston of the rifle; an arm pivotably attached to the planar body and terminating in first and second prongs defining a notch sized to fit over a front sight adjusting screw of an AR or AK type rifle; and a pin pivotably joining the planar body and the arm. The body may further comprise a notch formed in a second edge opposite the first edge for assisting in disengaging a gas tube release lever of the rifle. The body may further comprise a scraper sized to fit within the gas block of the rifle.
US09127897B2
Systems and methods for transporting a hydrocarbon are provided. The method can include introducing a fluid at a first pressure and a first temperature to an inlet of a pump and pressurizing the fluid within the pump to produce a pressurized fluid having a second pressure and a second temperature. The method can also include flowing at least a portion of the pressurized fluid through a first heat exchanger and back to the inlet of the pump. The heat exchanger can include a coil having an inlet and an outlet and a housing at least partially enclosing the coil and having a first opening and a second opening. A first end of the coil can be disposed proximate the first opening. The heat exchanger can also include a foundation for supporting the coil and the housing.
US09127891B2
Methods, systems, and computer-readable and executable instructions are described herein. One method includes combining a plurality of images of a furnace into a composite image of the furnace, revising the composite image of the furnace to an intensity scaling, restoring a portion of the revised composite image of the furnace; and displaying a view of the restored revised composite image of the furnace to a user.
US09127888B2
An industrial oven system for curing composite material parts can include an oven compartment configured to receive a composite material structure therein that extends along a majority of the length and/or width of the compartment, the compartment having an inner wall that defines a cavity between proximal and distal ends of the compartment. A shroud can be disposed circumferentially between the inner wall of the compartment and an outer wall of the composite material structure. The shroud defines a first longitudinal annular channel between the inner wall and an outer surface of the shroud, and defines a second longitudinal annular channel between the outer wall of the composite material structure and an inner surface of the shroud. The shroud is contoured to direct a heated airflow longitudinally along the annular channels and over the composite material structure to cure the composite material structure, the heated airflow generally being at a higher temperature than a surface of the composite material part. One or more contour elements of the shroud can direct more heat to a corresponding thicker portion of the composite material structure generally aligned with the contour element relative to an amount of heat directed to adjacent relatively thinner portions of the composite material structure so as to effect a desired heating rate of the composite material structure to achieve a substantially uniform temperature along substantially the entire length of the composite material structure, thereby inhibiting warping of the composite material structure during a curing process.
US09127866B2
Hybrid heating system including: a heat pump water heating system; sensors, for measuring a system parameter; an input arrangement providing cost data pertaining to a first power cost for supplying power to the heat pump system, and to cost information pertaining to a second power cost for operating a conventional heating system; a processor storing criteria specifying when to operate the heat pump and conventional systems, the processor receiving and processing: cost data; cost information; system parameter data; flow information on a heat exchange system circulation arrangement, and heat pump system power consumption information and concurrently operating, upon demand, the heat pump system and a chiller system in opposite heating modes; wherein, when the chiller system operates in a cooling mode, the processor processes the cost data and information, system parameter data, and flow and power consumption information, and controls the systems based on the criteria.
US09127863B2
A mounting for solar panels has fixings which enable it to be easily attached to other mountings for a solar array and can be made of recycled plastic by vacuum forming.
US09127862B2
A connecting system is accordingly provided for a line tube, which can be pivoted about a rotation axis of a solar-thermal installation, which line tube is filled with a carrier fluid, wherein the line tube extends between two ends and is connected, for transportation of the carrier fluid, at a first end via a flexible tube connection to a fixed-position fixed line and at its second end via at least one connection means to a further line tube. According to the invention, the line tube is supported such that the flexible tube connection experiences only forces acting at right angles to the rotation axis, and the connection means experiences only forces acting parallel to the rotation axis.
US09127857B2
A solar receiver includes a multi-sided central assembly with wing assemblies extending from corners thereof. The central assembly includes one-sided heat absorption panels, while the wing assemblies use two-sided heat absorption panels. Stiffener structures run across the exposed faces of the various heat absorption panels.
US09127855B2
A fan assembly includes a nozzle and a body on which the nozzle is mounted. The nozzle has a first air inlet, a first air outlet, and a first interior passage for conveying air from the first air inlet to the first air outlet. The nozzle also includes a second air inlet, a plurality of second air outlets, and a second interior passage for conveying air from the second air inlet to the second air outlets. The body generates a first air flow through the first interior passage and a second air flow through the second interior passage. A first air passageway conveys the first air flow to the first air inlet and a second air passageway conveys the second air flow to the second air inlet. One of the temperature, humidity, composition and electrical charge of the second air flow is changed before it is emitted from the nozzle.
US09127852B2
Disclosed is an air purifier able to maintain the normal state of drive of a disk-shaped humidification filter by controlling the state of rotation of the humidification filter. The air purifier can maintain the normal state of drive of the humidification filter by using a stepping motor and the control unit in order to vary the state of rotation of the humidification filter and thereby remove extraneous material when the humidification filter is rotating abnormally due to extraneous material.
US09127849B2
Provided is a cooking appliance. Steam generated in a steam generation part is selectively supplied into a cooktop part or an oven chamber. The steam supplied into the cooktop part is used for soaking foreign materials attached to a top surface of the top plate to remove the foreign materials. Thus, the steam generated in one steam generation part may be used in a lot of uses.
US09127848B2
An autonomous ventilation system includes a variable-speed exhaust fan, a controller, an exhaust hood, and a spillage sensor. The exhaust fan removes air contaminants from an area. The controller is coupled to the exhaust fan and adjusts the speed of the exhaust fan. The exhaust hood is coupled to the exhaust fan and directs air contaminants to the exhaust fan. The spillage sensor is coupled to the controller, detects changes in an environmental parameter in a spillage zone adjacent to the exhaust hood, and communicates information relating to detected changes in the environmental parameter to the controller. The controller adjusts the speed of the exhaust fan in response to information relating to detected changes in the environmental parameter.
US09127839B2
A combustion apparatus has a burner, a combustion box containing therein a heat exchanger, an exhaust passage in fluid communication with the combustion box, a fan for supplying the burner with combustion air, and a predetermined length of air suction duct in fluid communication with a suction opening formed in a fan casing. The air suction duct has: on a downstream end thereof, an outlet cylindrical portion which is smaller in diameter than a diameter of the suction opening in the fan casing and which lies opposite to the suction opening; and a flange portion which overhangs radially outward from a perimeter of the air suction duct adjacent to the outlet cylindrical portion into contact with that peripheral portion of the fan casing which forms the suction opening. The flange portion is provided with an auxiliary suction opening in fluid communication with a space surrounding the outlet cylindrical portion.
US09127831B2
A portable light emitting apparatus includes: a tube-like grip held by the hand; a light emitting unit that is attached to one end of the grip, houses LEDs to, and outputs light of at least three different colors individually or in a mixture; and three color switches to that are disposed at positions pressed by a first finger, a second finger, and a third finger on the grip and operate a first function that carries out on/off control of light of the different colors.
US09127830B2
In a surface light source apparatus 1 for irradiating light in a planar form by arranging a plurality of tubular light sources 2 at high density in the middle of a screen so that brightness at the middle of the screen is high, each tubular light source 2 positioned in rows at topmost and bottommost edges is arranged to be closer toward screen corner sections in a plan view so as to compensate for lack of brightness at the screen corner sections in a plan view. In this manner, each tubular light source 2 is arranged by placing each tubular light source 2 in the rows at the topmost and bottommost edges closer in a row direction toward each corner section B of the reflection sheet 5. Thereby, brightness at the middle of a screen is maintained and enhanced, and display quality at corner sections of the screen is improved.
US09127827B2
A lighting device may be provided that includes: a heat sink; a member which has a polygonal pillar shape having at least three sides and is disposed on the heat sink, wherein the sides are inclined at a predetermined angle toward the center of the heat sink; and a light source which is disposed on at least one among the sides of the member, wherein the light source includes: a substrate; at least two light emitting devices which are symmetrically disposed on the substrate with respect to the center of the substrate; and at least two lens units which are disposed on the light emitting devices respectively, and consequently, it is possible to meet U.S. Energy Star and ANSI specifications, to remarkably improve rear light distribution characteristics and to remove a dark portion.
US09127823B2
Lighting devices and methods for illuminating the interior of a building with natural daylight are disclosed. In some embodiments, a daylighting apparatus includes a tube having a sidewall with a reflective interior surface, an at least partially transparent light collector with one or more light turning elements, and a light reflector positioned to reflect daylight into the light collector. The one or more light turning elements can turn direct and indirect daylight into the tube so that it is available to illuminate the building. In some embodiments, the tube is disposed between the light collector and a diffuser positioned inside a target area of a building. In certain embodiments, the tube is configured to direct at least a portion of the daylight transmitted through the light collector towards the diffuser.
US09127819B2
A light-directing apparatus for predominantly forward distribution of light from a light emitter having an emitter axis. The light-directing apparatus includes a forward-reflective surface entirely within a lens member positioned over the light emitter. The lens member has an outer surface and an inner cavity including an emitter-light-receiving void and a light-reflecting void which is contiguous with the emitter-light-receiving void and is different in configuration than the emitter-light-receiving void. The forward-reflective surface is in the light-reflecting void in position in the path of light emitted rearwardly.
US09127818B2
A fluorescent tube retrofit luminaire includes a lamp, a light guide, and a heat dissipating frame. The lamp may include a bi-pin base, middle structure, and outer structure, which may include a light-emitting diode (LED)-based light source in thermal communication with a finned heat sink section of the middle structure. Light emitted from the light source may be distributed generally along the length and/or width of the light guide. A bi-pin connector in the light guide may attach the luminaire to a first fluorescent socket. The bi-pin base may be received by a mounting aperture in the light guide before anchoring the luminaire to a second fluorescent socket using a pin-lock. The heat dissipating frame may be in thermal communication with both the light guide and the heat sink section of the lamp.
US09127810B2
An injection molding machine has a motor power interruption function such that it is determined whether or not the respective contents of preset first and second interruption criterion settings are different from each other. If the contents of the two settings are determined to be different from each other, then a third motor power interrupt signal is output so that at least one of first and second motor power interruption units is cut off in response to the output signal, thereby interrupting power supply to a motor.
US09127805B2
Mounting clips and decorative mounting articles removably engage to vertically disposed mounting surfaces, such as rain gutter downspouts. The mounting clips support arms, hooks, plates, decorations, and brackets for display of banners, flags, security lights, decorative lights, etc., on a downspout or other comparable mounting surface. The mounting clips include a frame having arms with projections separated by channels configured for attachment to a profiled outer surface of the mounting surface. Decorative mounting articles include a rear section forming channels having inner sidewalls with engagement portions configured for direct attachment of the decorative mounting article to a profiled outer surface of the mounting surface.
US09127804B2
The present disclosure relates to a holding device for storing holding rods on a crane, with at least two holders, at least one securing piece and at least one lock, wherein the at least two holders comprise at least one toothed connecting surface each and at least four lead-throughs each, at least one of which each is designed as oblong hole. According to the present disclosure, the at least two holders are connectable with each other via a connector through the one oblong hole each and are connectable with the crane through at least one further lead-through each, wherein the at least two holders together comprise a common U-shaped deposition region for accommodating and horizontally fixing holding rods, and wherein the holding rods are vertically fixable by means of the at least one securing piece and the at least one lock inside the U-shaped deposition region.
US09127795B2
Apparatus for joining a first conduit to a second conduit comprising a first coupler for attachment to an end of the first conduit, a second coupler for attachment to an end of the second conduit and for engagement to the first coupler, and a snap-fit fastener for fastening the first coupler to the second coupler. The snap-fit fastener is arranged in at least two portions to fit around the periphery of the first and second couplers when the first and second couplers are engaged. The apparatus enables relative movement between the first coupler and the second coupler.
US09127787B1
A pipe hanging assembly that includes a single piece of steel having a first upper horizontal section, second and third angled sections coupled to the first section, fourth and fifth vertical sections extending vertically from the second and third sections, respectively, sixth and seventh vertical sections extending vertically and parallel to the fourth and fifth sections, respectively, and eighth and ninth curved sections. The eighth curved section connects the fourth and sixth sections to form a first U-shaped holder, and the ninth curved section connects the fifth and seventh sections to form a second U-shaped holder, with the eighth section disposed at a different elevation than the ninth section. Two different pipes can be supported in the first and second U-shaped holder.
US09127775B2
Flexible seals for process control valves are disclosed. An example disclosed seal includes a seal for use with a butterfly valve. The example seal includes a substantially flexible ring-shaped carrier configured to be moveably fixed within the butterfly valve and to surround a flow control aperture therein. The example seal includes a seal stiffener adjacent the substantially flexible ring-shaped carrier to increase the stiffness of the substantially flexible ring-shaped carrier in a first flow direction. The example seal includes a substantially rigid seal ring to engage an opposing surface.
US09127771B2
In a fluid pressure apparatus, a packing is constituted from an annular seal member made of an elastic rubber material, and support rings made of a material possessing low friction, which are mounted on an outer circumference of the seal member. The seal member includes, on an outer circumference thereof, a sealing projection, shoulder portions formed on both sides of the sealing projection, and concave grooves interposed between the shoulder portions and the sealing projection. The support rings include support surfaces on outer circumferences thereof, and engagement projections on inner circumferences thereof, such that by engagement of the projections in the concave grooves, the support rings are mounted on the seal member so as to surround outer circumferences of the shoulder portions.
US09127766B2
A bicycle derailleur is basically provided with a base member, a movable member and a connecting structure. The base member includes a bicycle mounting portion. The movable member is movable with respect to the base member between a first position and a second position that is farther than the first position from the base member. The connecting structure movably connects the movable member to the base member. The connecting structure moves the movable member with an actuation ratio that descends and then ascends as the movable member moves from the first position towards the second position.
US09127762B2
In one embodiment, an Automatic Transmission Fluid (ATF) reservoir is provided. The reservoir includes housing that is combined with a transmission containing ATF and into/out of which the AFT flows. The reservoir also includes a heating body that is combined with the housing and heats the ATF flowing within the housing by generating heat when power is applied.
US09127756B2
A multistage transmission with eight forward and one reverse gear, including an input and output shafts, planetary gearsets, gear stages, shift elements and shafts. The input shaft couples the carrier of gearset (P1) and, via clutch (15), can couple shaft (5) that couples the sun gear of gearset (P3) and, via clutch (58), can couple shaft (8) connected to the ring gear of gearset (P2). The ring gear of gearset (P1) couples shaft (6) connected to the sun gear of gearset (P2). Shaft (3) couples the sun and ring gears of respective gearsets (P1, P3) and can couple, via brake (03), the housing. The carrier of gearset (P2) couples shaft (4) gear stage (S1) which couples the output shaft. The carrier of gearset (P3) couples shaft (7) gear stage (S2) which couples the output shaft. Clutch (56) can couple shafts (5, 6).
US09127750B2
A control device for an automatic transmission including a hydraulic actuator that is actuated on the basis of a hydraulic pressure supplied and a linear solenoid valve that controls the hydraulic pressure supplied to the hydraulic actuator on the basis of a driving current of a solenoid includes an ECU that executes current feedback control over a current value of the driving current that is flowed to the solenoid using at least a proportional term and an integral term on the basis of a deviation (ΔI) between a target current value (Itgt) and actual current value (Ir) of the solenoid such that the hydraulic pressure supplied to the hydraulic actuator becomes a target hydraulic pressure. The ECU increases a proportional gain (Kp) in the current feedback control as a fluid temperature (To) detected by a fluid temperature sensor increases.
US09127746B2
A power transmission belt having a body with an inside, an outside, and a length. The body has a tension section and a compression section, and teeth and troughs alternating lengthwise of the body. A layer on the body in which the teeth are formed has a surface facing in one of an inside and outside direction on which alternating protrusions and recesses are formed against which another component on the body is placed and conforms.
US09127744B2
A shock and vibration isolator camera includes a top plate is attached to a bottom plate via a universal joint that allows the top plate to pivot about two mutually perpendicular axes relative to the bottom plate. A camera attachment fitting, such a Mitchell mount fitting, may be provided on the top plate, for attaching a camera or camera accessory to the top plate. Springs are compressed between the top and bottom plates. Fluid dampeners between the top and bottom plates are connected to a valve that allows dampening to be adjusted.
US09127741B2
Provided is a colloidal damper capable of harvesting electrical energy—that is, practical electrical power—from mechanical energy acting from the outside. This colloidal damper has: a cylinder; a piston which is guided and supported so as to reciprocate freely within this cylinder, and which combines with the cylinder to form a sealed space; a porous body having many pores and housed within the sealed space; an operating fluid which is housed together with the porous body in the sealed space and flows into the pores of the porous body when pressure is applied, and flows out from the pores of the porous body when the pressure is reduced; and a piezoelectric element installed in the sealed space.
US09127739B2
A method and composition for damping vibration of a substrate as well as a construction configured to achieve dampened vibration transmission. The construction includes a substrate configured to transmit NVH associated vibration in at least one frequency range. The construction also includes a first polymeric layer overlying at least a portion of the substrate element. The first polymeric layer comprises at least one material having elastomeric characteristics in a Tg range between +10 to −10° C. as outlined in ASTM E1640-00 and a hardness of between 5 and 25 as measured with the Shore A methodology outlined in ASTM D2240-00 and a second polymeric layer having elastomeric characteristics less than those exhibited by the first layer.
US09127727B2
A method of searching for a sync start in an automated manual transmission, may include a slip preparing step of operating, in a parked position, a sleeve and a clutch restrained so as not to rotate into a slip state, an actuator operating step of moving the sleeve toward a clutch gear from a neutral position, a clutch speed determination step of determining whether or not a speed of rotation of the clutch has decreased by the actuator operating step, a stop determination step of determining whether or not a movement of the sleeve that was driven by the actuator operating step has stopped, and a first position determination step of determining a point where the clutch speed determination step determines that the speed of the rotation of the clutch has decreased and the stop determination step determines that the movement of the sleeve has stopped as the sync start.
US09127724B2
Electromechanical apparatus for use with a coupling assembly and controllable coupling assembly including such apparatus are provided. The apparatus includes a housing part including an end wall having an outer coupling face with a single pocket defining a load-bearing shoulder in communication with an inner face of the end wall. An electromagnetic source includes at least one excitation coil which is at least partially surrounded by the housing part. An element is received within the pocket in an uncoupling position and is movable outwardly from the pocket to a coupling position characterized by abutting engagement of the element with the load-bearing shoulder. A reciprocating armature is arranged concentrically relative to the at least one excitation coil and is axially movable when the at least one excitation coil is supplied with current. The armature is connected to the element to move the element between the coupling and uncoupling positions.
US09127722B2
A method for producing a resilient force-transmitting member, in particular for transmitting torques for example in a motor vehicle or in an industrial application, wherein the force-transmitting member is provided with at least two receiving openings for connecting to force-transmitting components, an elastomer body and at least one inlay loop embedded in the elastomer body. The method includes positioning the at least one inlay loop in a predetermined desired position in a mold, providing at least one venting mandrel in the mold one free end of which is in contact with the inlay loop, injecting elastomer material into the mold, removing the at least one venting mandrel and vulcanizing the elastomer body.
US09127719B2
A method of manufacturing a bearing assembly includes the steps of providing first (38) and second (42) cage frames, each including a plurality of holes (46) spaced along a circumference of the respective first and second cage frames (38, 42), positioning a plurality of rollers (22) between the first and second cage frames (38, 42), each of the rollers (22) including a bore (26) coaxial with a rotational axis (30) of the respective rollers (22), aligning the bore (26) of a first of the plurality of rollers (22) with a first hole (46) in each of the respective first and second cage frames (38, 42), then sliding a threaded end (54) of a pin (50) through the first hole (46) in the first cage frame (38) and the first roller (22) a sufficient distance to engage the second cage frame (42). The method further includes rotating the pin (50) to form a screw thread in the first hole (46) of the second cage frame (42) with the threaded end (54) of the pin (50).
US09127718B2
A rotation detection set comprises an encoder washer rotatable around a rotation axis, at least one sensor adapted to detect a rotation parameter of the encoder washer through an air gap, a support member for holding the sensor with respect to the rotation axis and a mounting member for immobilizing the support member with respect to a fixed structure. The mounting member is made of one piece of magnetic material and has a first wall located on the same side of the air gap as the encoder washer and a second wall located on the same side of the air gap as the sensor whereas a magnetic body of the encoder washer, the air gap and the sensor are located in a volume defined by the mounting member between the two walls.
US09127710B2
A bearing capable of satisfying demands for cost reduction and further quietness, and stably maintaining high support accuracy. A sliding bearing (4) includes an inner member (5) having a mounting surface (9) with respect to a rotary shaft (2), and an outer member (6) being arranged on a radially outer side of the inner member (5). A radial bearing gap is formed between an outer peripheral surface (5a1) of the inner member (5) and an inner peripheral surface (7a1) of the outer member (6), and a lubricating oil is interposed in the radial bearing gap. Further, between the inner member (5) and the outer member (6), sealing gaps (S, S) for maintaining an oil level of the lubricating oil on both axial sides of the radial bearing gap are formed. At least a part of the mounting surface (9) of the inner member (5) is made of a metal.
US09127703B2
An extendable pole mechanism may be used with a pair of poles that are longitudinally movable to adjust the overall length of both poles. The mechanism may include a collar that receives the poles and a roller sleeve that rotates with respect to the collar to adjust the mechanism between a use condition, where the poles are held in a longitudinally relative fixed position, and an adjustment condition, where the poles are longitudinally moveable with respect to each other.
US09127696B2
A system, in certain embodiments, includes an accumulator. The accumulator includes a first cylinder configured to receive a fluid within an internal volume of the first cylinder. The accumulator also includes a piston configured to move axially within the first cylinder. Axial movement of the piston within the first cylinder adjusts the internal volume of the first cylinder. The accumulator further includes a plurality of shape memory alloy wires configured to cause the axial movement of the piston within the first cylinder.
US09127678B2
A proposed implementation of this present subject matter utilizes a data collection and processing unit and sensors to monitor one or more conditions which can cause damage to a pump. These conditions include differential pressure across the pump, pump flow rate, and the pump rotational speed (RPM). Pump operating curves are analyzed to develop equations indicative of minimum and maximum allowable head for efficient operation within mechanical operation limits of the pump. The equations are used to set a processor for analyzing data inputs. The processor utilizes sensor inputs from the pump, including input and output pressure differential, flow, and pump speed. These values are compared to stored data or may be inserted into an equation to provide a calculated parameter indicative of operation in or out of pump operating limits. Responsive circuits inform users of alarm conditions.
US09127675B2
A vane compressor including plural vanes that perform a compression operation such that the normal to a circular arc formed by each vane tip portion and the normal to the inner peripheral surface of a cylinder are constantly approximately coincident with each other. Each of the plural vanes is held constantly in the normal direction of the inner peripheral surface of the cylinder or is held constantly along a direction having a fixed inclination with respect to the normal direction of the inner peripheral surface of the cylinder so that the compression operation is performed in the state the normal to the circular arc formed by the tip portion of each of the plural vanes and the normal to the inner peripheral surface of the cylinder are constantly approximately coincident with each other. The plural vanes are rotatably and movably supported with respect to a rotor portion.
US09127661B2
A bootstrap accumulator system includes an actuator cylinder that drives an accumulator piston through a multiple of nested actuator sleeves, comprising a multistage actuator cylinder.
US09127660B2
A compressor includes a rotary shaft, a cam, a cylinder block, pistons, a thrust bearing, a rotary valve, and an oil passage. The rotary shaft has an in-shaft passage formed therein. The cam rotates integrally with the rotary shaft. The pistons are coupled to the rotary shaft through the cam. The thrust bearing is provided between the cam and the cylinder block. The thrust bearing includes a first race in contact with the cam, a second race in contact with the cylinder block, and rolling elements retained between the first and second races to form a gap therebetween. The oil passage extends from the gap to the in-shaft passage and includes an oil retaining space formed in at least one of the cam and the cylinder block.
US09127659B2
A multistage reciprocating air compressor compresses air to an elevated pressure level discharge with an intermediate pressure level discharge for use in blow molding of PET bottles and similar products. The air compressor has a first, second and third reciprocating piston stages with first, second and third actuators operable in response to respective sensed discharge pressure levels from the discharges to actuate inlet unloading elements.
US09127656B2
A ring cam for a fluid-working machine is formed from a plurality of segments. The segments comprise a leading cooperating formation which has a piston facing surface which forms part of the working surface, at a trailing end, and which is recessed from the working surface at a leading end, and a trailing cooperating formation which has a piston facing surface which forms part of the working surface at a leading end, and which is recessed from the working surface at a trailing end. The segments having piston facing surfaces which are in compressive stress such as to partially or fully compensate for tensile stress arising from the action of rollers in use. The segments form a wavelike cam surface and attachment means are provided, through the working surface, on whichever of the leading or trailing surfaces thereof is subject to lowest forces from pistons in use.
US09127655B2
The disclosure relates to liquid nitrogen pump equipment load testing and experimenting apparatus, and testing and experimenting method thereof, used for oil-gas fields or coalbed methane nitrogen foam fracturing equipment testing. A hydraulic damping apparatus unit and a pressure regulation unit are provided; the hydro-mechanical damping apparatus unit comprises a water tank, a pump unit apparatus, and a pipe manifold system connected in sequence.
US09127650B2
The present invention relates to a tower assembly system, a method of assembling a wind turbine tower and a wind turbine thereof. Three or more guidance devices may be mounted to a mounting flange in the upper end of a lower tower section and/or in the lower end of an upper tower section. The guidance device comprises a contact surface for contacting a mating contact surface on the opposite tower section. The guidance device comprises a mounting flange for mounting the device to the mounting flange of the tower section using fastening means. This allows the guidance devices to catch and guide the free hanging tower section into the correct position on the stationary tower section. This enables the assembly time to be reduced with up to 50% compared with the present assembly methods. The guidance devices allow the workers to guide the free hanging tower section into position from the ground.
US09127629B2
A fuel injection device (100) includes a control body (40) provided with an injection hole (44), a nozzle needle (60) that opens or closes the injection hole (44), a pressure control chamber (53) controlling a movement of the nozzle needle (60), an inflow channel (52) through which high-pressure fuel is introduced to the pressure control chamber (53), an outflow channel (54) through which the fuel from the pressure control chamber (53) is discharged, and a floating plate (70) that opens or closes the inflow channel (52). In the fuel injection device (100), the control body (40) includes a cylinder (56) defining the pressure control chamber (53) in a radial direction thereof, and an inner wall portion (56a) of the cylinder (56) includes a communication groove (57a) which causes an inflow chamber (53a) that is provided within the pressure control chamber (53) at a side of the inflow channel (52) relative to the floating plate (70), to communicate with a back pressure chamber (53b) that is provided within the pressure control chamber (53) at a side of the nozzle needle (60) relative to the floating plate (70).
US09127628B2
A flange fastening structure includes a first flange made of metal and a second flange made of plastic. Stepped nuts are provided in the second flange and each have a large-diameter portion and a small-diameter portion. The second flange has at least one raised portion on a surface of the second flange facing the large-diameter portion. The at least one raised portion is made of plastic. A height of the at least one raised portion is set such that the at least one raised portion pressed with the large-diameter portion is deformed when the first flange and the second flange are fastened together with bolts and the nuts. The small-diameter portion of each of the nuts contacts the first flange to limit fastening positions of the nuts and the bolts when the first flange and the second flange are fastened together with the bolts and the nuts.
US09127616B2
An improved piston for an opposed piston internal combustion engine is provided. The piston includes a piston body that extends along an axis from a crown portion to a skirt portion with a full piston skirt and to a pin boss portion. The piston body includes a plurality of ring grooves in the crown portion and at least one ring groove in the skirt portion. A wrist pin which has a length that is longer than a maximum diameter of the piston body is joined with the piston body at the pin boss portion and extends past the pin boss portion for receiving a pair of connecting rods on opposite sides of the piston body. The piston body is a monobloc piston body which is made of one integral piece or of multiple pieces that are welded or adhered together.
US09127615B2
A control system (12) for an engine (10) having a combustion chamber (22) is disclosed. The control system may have a fuel injector (40) configured to selectively inject fuel into the combustion chamber, and a controller (54) in communication with the fuel injector. The controller may be configured to activate the fuel injector during a first compression stroke to initiate fuel injection in an amount and at a timing that results in a stratified lean air/fuel mixture within the combustion chamber during a first combustion event of a six-stroke cycle. The controller may also be configured to activate the fuel injector during a first power stroke to initiate fuel injection in an amount and at a timing that results in a homogenous lean air/fuel mixture within the combustion chamber during a second combustion event of the same six-stroke cycle.
US09127601B2
A control system for an engine includes an valve actuator, a cylinder pressure module, and a valve control module. The valve actuator opens a valve of a cylinder at a first target opening timing during a first combustion cycle of the cylinder. The cylinder pressure module receives a cylinder pressure measured by a cylinder pressure sensor of the cylinder and, at a predetermined crankshaft angle after the valve opens during the first combustion cycle, sets a valve opening pressure equal to the cylinder pressure. The valve control module receives a reference cylinder pressure and generates a second target opening timing for a second combustion cycle of the cylinder based on the valve opening pressure and the reference cylinder pressure. The second combustion cycle is after the first combustion cycle. During the second combustion cycle, the valve actuator opens the valve at the second target opening timing.
US09127597B2
Concepts and technologies are disclosed herein for a sensor system for detecting, characterizing, monitoring, and analyzing data. According to some embodiments disclosed herein, a monitoring system is configured to obtain data from a sensor system. The sensor system includes two or more sensors and can indicate an operating state detected at a monitored structure by the sensors. The monitoring system also obtains operational data including a threshold value for the sensors and an expected value for the sensors. The monitoring system is configured to adjust the thresholds based, at least partially, upon the operational data to obtain an adjusted threshold value, and to compare the data value to the adjusted threshold. The monitoring system can determine if the monitored structure is operating in an alarm condition.
US09127596B2
A fuel control system having a combustive energy value evaluator determining a combustive energy value of the fuel, and a controller calculating a desired flow rate based at least on the combustive energy value and controlling a fuel metering device such that the fuel flow rate corresponds to the desired fuel flow rate.
US09127591B2
A supercharger drive device (1) for a combustion engine (E) includes a gear carrier shaft (6) operable to rotate in unison with a crankshaft (2) of the combustion engine (E), a high speed gear (8) and a low speed gear (10) provided in the gear carrier shaft (6), a drive shaft (14) of a supercharger (12) which is rotatable when coupled with either one of the high speed gear (8) and the low speed gear (10), a gear shifter (16) for selecting one of the high speed gear (8) and the low speed gear (10) for transmitting a motive force from the gear carrier shaft (6) to the drive shaft (14) through the selected one of the high and low speed gears (8) and (10), and a shifter drive unit (18) for actuating the gear shifter (16) in dependence on the rotational speed of the combustion engine (E).
US09127590B2
Turbocharger provided with a bypass valve device comprising a valve element having a shaft movably connected to a valve element support, with a spindle between the valve element support and an adjusting lever extending transversely to the spindle, and an adjusting lever actuating element pivotably connected to the adjusting lever; an annular spring element is provided in at least one of a first position between the valve element and the valve element support and a second position between the adjusting lever and the adjusting lever actuating element, the spring element comprising at least one annular spring steel disc with a bead being configured and dimensioned so as to minimize play between the valve element and its support or between the adjusting lever and its actuating element.
US09127584B2
A recovery control system that allows a dosing valve to recover from a malfunction to a normal state, or a liquid feed line through which urea solution is fed to recover from clogging to a normal state. An abnormality detector detects an abnormality of the dosing valve and a recovery controller controls a supply module to feed urea solution in the dosing valve back to an urea tank when the abnormality detector detects the abnormality.
US09127583B2
A device for providing a liquid reducing agent includes a reducing agent tank for storing a reducing agent. The reducing agent tank has a tank bottom including a separate chamber. A dosing or metering unit extracts reducing agent from the reducing agent tank at an extraction point disposed at the separate chamber. The dosing unit is disposed within the separate chamber. A motor vehicle having the device is also provided.
US09127579B2
A fluid management system and a method for managing fluid include a removable cartridge, a fluid reservoir, a fluid exchange pump, and a conduit. The conduit provides fluid communication between the removable cartridge and the fluid reservoir. The fluid exchange pump transfers a first fluid from the fluid reservoir to the removable cartridge in a first direction, and permits a flow of a second fluid from the removable cartridge to the fluid reservoir in a second direction.
US09127571B2
Systems and methods are provided for the use of systems that recover mechanical power from waste heat energy using multiple working expanders with a common working fluid. The system accepts waste heat energy at different temperatures and utilizes a single closed-loop circuit of organic refrigerant flowing through all expanders in the system where the distribution of heat energy to each of the expanders allocated to permit utilization of up to all available heat energy. In some embodiments, the system maximizes the output of the waste heat energy recovery process. The expanders can be operatively coupled to one or more generators that convert the mechanical energy of the expansion process into electrical energy.
US09127570B2
Provided is a machine unit layout system that simplifies the layout of a compressor unit and an expander unit and is extremely effective in terms of not only the reliability of the entire machine but also maintainability. Two separate compressors, a low-pressure-side compressor and a high-pressure-side compressor (11A, 11b), are disposed on either side of a steam turbine (10). Two separate expanders, a low-pressure-side expander and a high-pressure-side expander (12A, 12B), are disposed outside the low-pressure-side and high-pressure-side compressors (11A, 11b). The steam turbine (10), the low-pressure-side and high-pressure-side compressors (11A, 11b), and the low-pressure-side and high-pressure-side expanders (12A, 12B) are coupled by rotor shafts comprising a single shaft. The torque distribution between rotator shafts is optimized.
US09127560B2
A cooled turbine blade comprises a root for fixing the blade to rotor, an airfoil extending along a radial axis from the root, and a tip shroud disposed at a radially outward end of the airfoil. The tip shroud extends in a circumferential direction from the airfoil and defines, within itself, a core plenum and a peripheral plenum. The airfoil defines an aft airfoil cooling passage that extends radially through the airfoil proximate a trailing edge portion of the airfoil. The airfoil also defines an aft cooling inlet for providing an aft stream of cooling fluid to the aft airfoil cooling passage. The airfoil also defines at least one aft cooling exit for discharging the aft stream of cooling fluid from the aft airflow cooling passage to the peripheral plenum. The tip shroud defines at least one peripheral plenum vent for discharging the aft stream of cooling fluid.
US09127553B2
Disclosed herein are apparatuses, methods, and systems for transition piece contouring. In an embodiment, a high thermal stress section of a transition piece and a low thermal stress section of a transition piece is a determined. The low thermal stress section of the transition piece may be contoured to intercept hot gas flow.
US09127519B2
A centralizer assembly having a tubular body member with upper and lower channels extending around the external surface of said central tubular body member. A bow spring assembly having bow spring members is installed around the outer surface of the tubular body member and can rotate about the outer surface of the central tubular body member. Bow spring heel supports prevent the bow spring members from contacting the outer surface of the central tubular member when compressed. Non-abrasive materials prevent damage to wellhead or other polished bore receptacles. A robust bolster frame protects the centralizer assembly during shipping, storage or other periods of non-use.
US09127494B2
In a hinge device 1, a door-side mounting member 6 is rotatably connected to a housing-side mounting member 3 via an inner link 4 and an outer link 5. To prevent the inner link 4 and the outer link 5 from being rattled, one protrusion 72 of a torsion coil spring 7 as a rotationally biasing mechanism is pressed against one side plate 41 of the inner link 4 via a cam member 91 and the other protrusion 73 of the torsion coil spring 7 is pressed against the other side plate 52 of the outer link 5.
US09127489B2
A door stop includes a body having a longitudinal axis and a rotating toggle operably connected to the body. The toggle is rotatable such that a longitudinal axis of the toggle aligns with the longitudinal axis of the body in an insertion position and the longitudinal axis of the toggle is transverse to the longitudinal axis of the body in a locked position. The door stop includes a lock assembly operably mounted to the body to lock the toggle. Monitoring circuitry provides indication of a location of the door stop and/or an alarm mode.
US09127475B2
An umbrella mount, and optional adaptor, a receiver for an umbrella pole and at least two pressure points that at least one strap and fastener can urge against a base support to securely position the mount.
US09127474B2
A railing system for mounting a panel or series of panels to form a railing. The railing system is comprised of the following base components: a shoe, which may be secured to the floor, having a slot for receiving a glass panel, a sleeve that holds the glass panel within the shoe, an arm that is adjustable to provide the force necessary to hold the glass panel in the desired position, and at least one set screw that adjusts the arm and holds the arm in place, in turn bracing the glass panel in the desired position.
US09127471B1
A spa cover is described that is comprised of a plurality of inflatable drop stitch bladders and a slipcover comprising a plurality of separate chambers. Each chamber corresponds to a respective one of the plurality of inflatable bladders, and each chamber is constructed to house a corresponding one of the inflatable bladders therein. The slipcover has a hinge between at least two separate chambers.
US09127460B2
A flashing laminate includes a non-reinforced thermoplastic sheet having a bottom surface, a first longitudinal edge, and a second longitudinal edge. The flashing laminate also includes an adhesive layer on a longitudinally extending portion of the bottom surface adjacent to one of the longitudinal edges. In one or more embodiments, the laminate also includes a release liner positioned over the adhesive tape.
US09127458B2
The present invention involves the provision of a truss assembly and method which includes components that have segments pre-connected in a manner that allows the connected parts to be collapsed for packaging and shipping with the other components of a shed or the like.
US09127457B2
A machine for deforming and cutting plastic strands of recycled plastic for use as a secondary reinforcement in concrete includes a multi-strand supply of recycled plastic and a mechanism for advancing the multi-strands into and through the machine. The advancing mechanism may be several sets of motor driven roller sets each of which is connected to a common motor by a belt. The machine includes three sets of deformation mechanisms, a heater for softening the deformed strands and a cutter powered by a separate motor for cutting the softened plastic strands.
US09127444B2
An apparatus and method are shown for installing a metal transition end on an open end of a length of plastic pipe having an outer diameter and an inner diameter by placing a stiffener sleeve within the inner diameter of the plastic pipe at a point which is circumscribed by the metal transition end. An actuating sleeve, carried on the draw rod, allows the stiffener sleeve to be installed in a desired location within the open plastic pipe end by using the draw rod to first position the stiffener sleeve in the desired location. The metal transition end is provided with an internal relief groove which accepts any excess plastic material forced past the stiffener sleeve during the installation process.
US09127428B2
A sheathing arrangement for a soil-working roller (10), in particular for a soil compactor, comprises a plurality of immediately consecutive sheathing members (22) that are connected or connectable in chain-type fashion in longitudinal direction of an arrangement (L).
US09127420B2
An intelligent construction cone includes a light pervious body rotatable relative to a body. A rotating device is mounted to the light pervious body and driven by a driving device to rotate the light pervious body. A distance detector sends a distance signal to a controller coupled to the driving device. The distance detector is jointly rotatable with the light pervious body to eliminate detection dead angle. A warning device is coupled to the controller and generates a warning message responsive to the distance signal. A lighting device is coupled to the controller and provides illumination. A light sensor and a humidity sensor are coupled to the controller and detect environmental brightness and environmental humidity, respectively. The warning message and intensity of the illumination are adjusted according to a distance between an object and the distance detector, the environmental brightness, and the environmental humidity.
US09127413B2
A method for repairing an aged asphalt pavement is provided. The method involves passing an emitter over the aged asphalt pavement, wherein the emitter generates electromagnetic radiation having a wavelength of from 20 microns to 1 mm that penetrates into the pavement to a depth of at least 2 inches. The asphalt pavement is repaired by disturbing voids and interstices in the damaged pavement without dehydrogenation of the asphalt, such that oligomers present in the aged asphalt are linked together into longer polymer chains to improve ductility of the aged asphalt.
US09127408B2
It has now been discovered that the sheet bulk of a tissue web may be increased, with little or no degradation in tensile strength, by forming the web with at least a portion of cellulosic fiber that has been reacted with a water soluble cellulose reactive agent such as a cyanuric halide or a vinyl sulfone and then reacting the fiber with monochloroacetic acid, or salts thereof, in the presence of a caustic.
US09127406B2
The instant disclosure relates to a surface coating composition for inkjet media, including: a binder including at least one of water soluble polymers, water dispersible polymers, or combinations thereof; a pigment including at least one of low surface area inorganic pigments, organic pigments, porous inorganic pigments, or combinations thereof; an optical brightening agent; a metallic salt; and a chemical chelant.
US09127403B2
A flash tank including: an interior chamber having a interior surface formed by a sidewall of the flash tank; a vapor exhaust port coupled to an upper portion of the chamber; a liquid discharge port coupled to a lower portion of the chamber; an insert inlet tube having an insert outlet and inserted into an inlet port of the chamber, wherein the insert inlet tube extends inward of the sidewall and the insert outlet has an elongated cross-sectional shape oriented substantially parallel to a center vertical axis of the flash tank and substantially perpendicular to a radial line of the flash tank, such that the insert outlet is substantially tangential to the sidewall.
US09127398B2
A method for controlling a washing machine includes comparing a command value of a motor with a predetermined limit value, during spin-drying, to determine whether the motor is overloaded, and controlling driving of the motor in response to the determination. It may be possible to determine a water filling state, an excessive bubble state, or a drainage error state, which may be caused during a spin-drying operation, and to take a proper measure. That is, in the drainage error state, a user is informed of the drainage error. In the water filling state, the spin-drying is normally completed by re-performing the spin-drying operation. In the excessive bubble state, a rinsing or spin-drying operation is added to remove the bubbles. When the bubbles are not removed by the added rinsing or spin-drying operation, the excessive bubble message is displayed to inform a consumer of the excessive bubble state.
US09127396B2
A washing machine includes a casing constituting the appearance, a support bar having one end connected to the casing and a suspension for connecting the other end of the support bar to the outer tub so as to suspend the outer tub within the casing, and for absorbing vibrations from the outer tub. The suspension includes an air cap through which the second end of the support bar passes. The air cab is installed on the outer circumference of the outer tub and moves along the support bar according to vibrations from the outer tub. A first friction member fitted on the support bar and disposed within the air cap to contact the inner surface of the air cap. A second friction member contacts the support bar and generates greater frictional force with the support bar than the force generated between the first friction member and the inner surface of the air cap to effectively decrease vibrations.
US09127385B2
A sewing machine includes an embroidery frame moving portion, a sewing portion, a communication portion, a processor, and a memory. The memory is configured to store computer-readable instructions that cause the processor to perform the steps of specifying an embroidery pattern and a size of the embroidery pattern, outputting the size of the embroidery pattern through the communication portion to a device provided with an image capture portion, acquiring positioning data through the communication portion, setting at least one of a position and the angle of a embroidery pattern on a sewing workpiece based on the positioning data, acquiring embroidery data, and causing the embroidery frame moving portion and the sewing portion to form stitches that make up the embroidery pattern on the sewing workpiece based on the embroidery data. The positioning data have been computed by the device based on image data and output to from the device.
US09127379B2
A multi-layer ballistic woven fabric, including an upper woven layer having upper warp yarns and upper weft yarns that are interwoven together to form the upper woven layer. The multi-layer ballistic woven fabric also includes a lower woven layer having lower warp yarns and lower weft yarns that are interwoven together, and a plurality of securing yarns, each securing yarn interwoven with at least some of the upper yarns and some of the lower yarns so as to secure the upper and lower woven layers together. At least one of the securing yarns is woven underneath a first lower weft yarn, then above a second upper weft yarn adjacent the first lower weft yarn, then underneath a third lower weft yarn adjacent the second upper weft yarn and then above a fourth upper weft yarn adjacent the third lower weft yarn. The multi-layer ballistic woven fabric is formed by interweaving the securing yarns with the warp yarns and weft yarns as the upper woven layer and lower woven layer are made.
US09127371B2
A moth-eye mold fabrication method of an embodiment of the present invention includes the steps of: (a) anodizing a surface of an aluminum film to form a porous alumina layer which has a plurality of minute recessed portions; (b) after step (a), bringing the porous alumina layer into contact with an etching solution, thereby enlarging the plurality of minute recessed portions of the porous alumina layer; and (c) after step (b), further anodizing the surface to grow the plurality of minute recessed portions, wherein a voltage applied in step (c) is higher than a voltage applied in step (a). According to an embodiment of the present invention, a mold fabrication method is provided which is capable of preventing formation of a plurality of tiny pores in one micropore.
US09127370B2
An apparatus and method for generating low pressure hydrogen gas from fuel solutions (i.e., alcohols) without the use of an external power source or external heat source. The apparatus comprises (a) a first chamber for fuel storage having an aperture, (b) a second chamber for the temporary storage of hydrogen gas generated having an aperture, (c) a first electrochemical cell (Cell-1) and (d) a second electrochemical cell (Cell-2). Cell-2 is disposed between the first chamber and the second chamber so that its anode is in fluid communication with the first chamber and its cathode is in fluid communication with the second chamber. Cell-1 is disposed on the opposite side of the first chamber from Cell-2 so that the anode therein is in fluid communication with the first chamber, and the cathode therein is in fluid communication with an oxidizing agent. The first chamber is sandwiched between Cell-1 and Cell-2. An air convection window or like device making ambient air available to the apparatus via Cell-1 is positioned on the side of Cell-1 opposite the fuel chamber. In operation, fuel is provided to the first chamber, the anode of Cell-1 is connected to the cathode of Cell-2, and the cathode of Cell-1 is connected to the anode of Cell-2, and hydrogen gas is continuously generated from the hydrogen chamber. The present invention may be used at room temperature.
US09127362B2
A process kit comprises a ring assembly that is placed about a substrate support in a substrate processing chamber to reduce deposition of process deposits on the chamber components and on an overhang edge of the substrate. The process kit includes a deposition ring, cover ring, and anti-lift bracket, and can also include a unitary shield. A target is also described.
US09127359B2
A liquid vaporizer is configured to vaporize a liquid reagent and mix the vaporized liquid reagent with a gaseous medium. The liquid vaporizer is equipped with a main vaporizer body having a mixed gas generating space, and a vaporizing unit disposed inside the mixed gas generating space. The vaporizing unit has a vaporizing unit main body having a vaporization surface and a net-shaped body formed in a planar shape by knitting wires regularly in a net-like shape. The net-shaped body forms a plurality of mesh spaces surrounded by the wires and arranged regularly in the in-plane direction. The vaporizing unit forms a plurality of liquid reagent supply spaces surrounded by the wires and the vaporization surface as a result of the net-shaped body and the vaporization surface being abutted against each other. The liquid reagent supply spaces are arranged regularly in the in-plane direction of the net-shaped body.
US09127358B2
A film forming apparatus for forming a polyimide film on a substrate installed within a film forming container. The apparatus includes: a first vaporizer configured to vaporize a first raw material in a solid state, and supply the vaporized first raw material gas to the substrate; a second vaporizer configured to vaporize a second raw material in a liquid state, and supply the vaporized second raw material gas to the substrate; a first pressure measurement unit configured to measure the internal pressure of the first vaporizer; a second pressure measurement unit configured to measure the internal pressure of the second vaporizer; and a controller configured to calculate a supply amount of the first and second raw material gases by the first and second pressure measurement units, respectively, and control the first and second vaporizers to supply the first and second raw material gases in a uniform amount.
US09127353B2
Provided are a film-forming apparatus and a film-forming method capable of preventing complication of an apparatus mechanism in formation of a thin film of multiple materials by sputtering to simplify the apparatus mechanism and preventing an increase in an apparatus cost. The film-forming apparatus includes a vacuum chamber, a substrate holder for holding a substrate, cathode mechanisms for supporting targets respectively so that the targets can be opposed to the substrate in the vacuum chamber, and shutters movable forward and backward individually between the targets made of different materials and the substrate to block or pass film-forming particles generated from the targets. At least one of the shutters is formed of a target material different from those for the targets so that the at least one of the shutters is configured as a shutter that also functions as a target.
US09127352B2
Provided is a cylindrical sputtering target which attains a high production yield in a film-forming process even when a film is formed by sputtering with a long cylindrical sputtering target constituted by a plurality of cylindrical target materials.A multi-divided cylindrical sputtering target formed by bonding a cylindrical base and a plurality of cylindrical target materials together with a bonding material has a divided portion where adjacent cylindrical target materials are arranged with a gap therebetween, while outer peripheral faces of the adjacent cylindrical target materials have a step of 0.5 mm or less therebetween in the divided portion. Such a target is obtained by fixing the cylindrical target materials with reference to the outer peripheral faces of the cylindrical target materials when arranging the cylindrical target materials with reference to the cylindrical base.
US09127351B2
Methods of producing metal-containing thin films with low impurity contents on a substrate by atomic layer deposition (ALD) are provided. The methods preferably comprise contacting a substrate with alternating and sequential pulses of a metal source chemical, a second source chemical and a deposition enhancing agent. The deposition enhancing agent is preferably selected from the group consisting of hydrocarbons, hydrogen, hydrogen plasma, hydrogen radicals, silanes, germanium compounds, nitrogen compounds, and boron compounds. In some embodiments, the deposition-enhancing agent reacts with halide contaminants in the growing thin film, improving film properties.
US09127349B2
The present invention refers to a method as well as an apparatus for depositing a layer at a substrate, the layer containing at least two components co-deposited by at least two evaporation sources, wherein the mixture of the components regarding the content of the components is set by tilting the evaporation sources to predetermined angle and/or by positioning the evaporation sources at a predetermined distance with respect to the substrate and/or wherein evaporation plumes of the evaporation sources are arranged such that the maxima of the evaporation plumes are separated locally with respect to the substrate.
US09127344B2
A method for manufacturing a solid-state battery device. The method can include providing a substrate within a process region of an apparatus. A cathode source and an anode source can be subjected to one or more energy sources to transfer thermal energy into a portion of the source materials to evaporate into a vapor phase. An ionic species from an ion source can be introduced and a thickness of solid-state battery materials can be formed overlying the surface region by interacting the gaseous species derived from the plurality of electrons and the ionic species. During formation of the thickness of the solid-state battery materials, the surface region can be maintained in a vacuum environment from about 10-6 to 10-4 Torr. Active materials comprising cathode, electrolyte, and anode with non-reactive species can be deposited for the formation of modified modulus layers, such a void or voided porous like materials.
US09127324B2
Disclosed is an O-phosphoserine sulfhydrylase (OPSS) mutant which has a Mycobacterium smegmatis-derived amino acid sequence corresponding to that of SEQ ID NO: 1 which is devoid of three to seven C-terminal amino acid residues. Also, a nucleic acid molecule encoding the OPSS mutant, an expression vector carrying the nucleic acid molecule, and a transformant transformed with the expression vector are disclosed. In addition, a method is provided for producing cysteine in which O-phospho-L-serine (OPS) is reacted with a sulfide in the presence of the OPSS mutant. The OPSS mutant has improved enzymatic activity and can be applied to the environmentally friendly production of L-cysteine through a simple enzymatic conversion reaction.
US09127319B2
An in vitro diagnostic method for determining invasive potential of cancer comprising measuring MLK4 gene expression in a cancer cell sample, wherein MLK4 gene overexpression is indicative of an invasive cancer, preferably a colorectal, bladder, breast, gastric, melanoma, lung, ovary or GMB cancer.
US09127313B2
An analysis instrument comprises plural modules connected together over a data network, each module comprising an analysis apparatus operable to perform biochemical analysis of a sample. Each module comprises a control unit that controls the operation of the analysis apparatus. The control units are addressable to select an arbitrary number of modules to operate as a cluster for performing a common biochemical analysis. The control units communicate over the data network, repeatedly during the performance of the common biochemical analysis, to determine the operation of the analysis apparatus of each module required to meet the global performance targets, on the basis of measures of performance derived from the output data produced by the modules. The arrangement of the instrument as modules interacting in this manner provides a scalable analysis instrument.
US09127310B2
The invention generally relates to droplet based digital PCR and methods for analyzing a target nucleic acid using the same. In certain embodiments, methods of the invention involve forming sample droplets containing, on average, a single target nucleic acid, amplifying the target in the droplets, excluding droplets containing amplicon from the target and amplicon from a variant of the target, and analyzing target amplicons.
US09127306B2
Methods and kits for preparing nucleic acid fragments from a sample of purified nucleic acid are provided. Alternatively, chromatin or other long polymers can be sheared with similar methods and kits.
US09127304B2
The present invention provides methods of making polymer-based biosensors and the biosensors made by said methods, wherein the biosensors comprise conducting polymers and negatively charged nanoparticles comprising a capture moiety. The present invention also provides methods of detecting analytes in a solution by contacting the solution with said polymer-based biosensors.
US09127300B2
The disclosure provides culture devices and methods for a microorganism in a sample. The devices include a base member, a cover sheet, an adhesive layer coupled to the base member or the cover sheet, and a cold water-soluble gelling agent disposed on the base member; wherein the devices are substantially optically transmissive when the gelling agent is hydrated with a clear liquid. Methods of use include detecting or enumerating microorganisms. The methods further provide for detecting a microorganism by detecting the presence or size of an abiogenic gas bubble in a culture device.
US09127292B2
Genetically modified non-human animals and methods and compositions for making and using the same are provided, wherein the genetic modification comprises a humanization of an endogenous signal-regulatory protein gene, in particular a humanization of a SIRPα gene. Genetically modified mice are described, including mice that express a human or humanized SIRPα protein from an endogenous SIRPα locus.
US09127290B2
A three-step screening of selection for resistance against pathogenic bacteria infection, selection for resistance against pathogenic fungi infection, and selection for sensitivity to salicylic acid was carried out on Arabidopsis thaliana lines highly expressing rice full-length cDNA (rice-FOX Arabidopsis lines) which were prepared by using a FOX hunting system. As a result, one Arabidopsis thaliana line (line K15424) selected in all of the three types of screening was successfully selected. Line K15424 carries a rice full-length cDNA. Rice overexpressing AK070024 was produced, and resistance against rice bacterial leaf blight was assayed using the T1 generation. As a result, it was confirmed that AK070024-overexpressing rice is resistant against bacterial leaf blight and blast.
US09127284B2
Described herein is a method of treatment of cancer or tumor using a modified bacteria or composition comprising the modified bacteria. In certain embodiments, the method is in combination with other treatment. In certain embodiments, the treatment is chemotherapy, radiation therapy, gene therapy, surgery or a combination thereof. The method makes modified facultative anaerobic bacteria into a conditional obligate anaerobe. The modified bacteria are strictly hypoxia regulated and comprise an essential gene expressing cassette. The vectors of this method comprise the essential gene expressing cassette. Also described herein are therapeutic and prophylactic compositions comprising the modified bacteria. The therapeutic and prophylactic compositions contain a purified form of the modified bacteria, while in certain embodiments, they do not contain other strain of microorganisms. The modified bacteria grow within the solid tumor/cancer, retarding its growth and are rapidly eliminated from normal tissues. The solid tumor/cancer includes breast cancer, liver cancer or neuroblastoma.
US09127278B2
Disclosed herein are antisense compounds and methods for decreasing HBV mRNA, DNA and protein expression. Such methods, compounds, and compositions are useful to treat, prevent, or ameliorate HBV-related diseases, disorders or conditions.
US09127276B2
Provided herein are oligomeric compounds with conjugate groups. In certain embodiments, the oligomeric compounds are conjugated to N-Acetylgalactosamine.
US09127264B2
The present invention relates to recombinant furin (rFurin) and methods for producing rFurin. More specifically, the invention relates to substantially animal protein-free rFurin and methods for producing substantially animal protein-free rFurin.
US09127257B2
The present invention relates to a polypeptide that is modified to have homoserine O-acetyltransferase activity, and in particular, the present invention provides a modified polypeptide having homoserine O-acetyltransferase activity, in which the amino acid at position 111 of a polypeptide having homoserine succinyltransferase activity is substituted with other amino acid.
US09127249B2
Provided is a novel method for preparing metabolites of atorvastatin using bacterial cytochrome P450, and a composition therefor, and more particularly, a composition for preparing 2-hydroxylated product of 4-hydroxylated product from atorvastatin including bacterial cytochrome P 450 BM3 (CYP102A1), CYP102A1 mutants, and chimeras derived from the CYP102A1 mutants, a kit therefor, and a method for preparing thereof.
US09127246B2
A method for processing a fluid includes sparging a fluid within the compartment of a container with an initial gas so that the initial gas passes through a portion of the fluid to form a humid gas within the compartment. The humid gas is passed out of the compartment of the container and into a flexible condenser bag. The humid gas within the condenser bag is cooled so as to separate the humid gas within the condenser bag into a condensed fluid and a dehumidified gas. The condensed fluid and the dehumidified gas is then removed from the condenser bag.
US09127238B2
The invention involves foam stabilization compositions that rely upon an electrostatic charge interaction. According to the invention, the positively charged class of polymers such as polyethyleneimine (PEI) polymers are used to provide a long range electrostatic interaction with detersive anionic or amphoteric surfactants present in the same. The interaction must be of sufficient character so that the components do not precipitate out, instead causing longer lasting and increased foam production. The system provides an environmentally friendly alternative for traditional foaming enhancers such as cocamide DEA.
US09127225B2
High octane unleaded aviation fuel composition having high aromatics content and CHN content of at least 97.8 wt %, less than 2.2 wt % of oxygen content, a T10 of at most 75° C., T40 of at least 75° C., a T50 of at most 105° C., a T90 of at most 135° C., a final boiling point of less than 190° C., an adjusted heat of combustion of at least 43.5 MJ/kg, a vapor pressure in the range of 38 to 49 kPa is provided.
US09127224B2
The present disclosure generally relates to methods to reduce the external steam supplied to a fluidized catalytic cracker by injecting a stream comprising a water-containing renewable fuel oil into a riser of a fluidized catalytic cracker.
US09127207B2
Described is a pyrolysis system including an entrained flow pyrolyzer having an opening through which biomass can be added. The pyrolyzer also has an inlet for hot exhaust gas, an outlet for pyrolyzed biomass and an outlet for syngas. The system has a burner for producing hot exhaust gas and a conduit between the burner and the hot exhaust gas inlet. A syngas extraction means for extracting syngas from the pyrolyzer. The syngas extraction means extracts syngas from the pyrolyzer at a rate such that the internal pressure within the pyrolyzer never exceeds the pressure external to the pyrolyzer.
US09127206B2
An apparatus for synergistically combining a plasma with a comminution means such as a fluid kinetic energy mill (jet mill), preferably in a single reactor and/or in a single process step is provided by the present invention. Within the apparatus of the invention potential energy is converted into kinetic energy and subsequently into angular momentum by means of wave energy, for comminuting, reacting and separation of feed materials. Methods of use of the apparatus in the practice of various processes are also provided by the present invention.
US09127205B2
An apparatus for synergistically combining a plasma with a comminution means such as a fluid kinetic energy mill (jet mill), preferably in a single reactor and/or in a single process step is provided by the present invention. Within the apparatus of the invention potential energy is converted into kinetic energy and subsequently into angular momentum by means of wave energy, for comminuting, reacting and separation of feed materials. Methods of use of the apparatus in the practice of various processes are also provided by the present invention.
US09127201B2
An electro-optical device includes: (1) a first electrode layer; (2) a second electrode layer; and (3) a middle layer disposed between the first electrode layer and the second electrode layer. The middle layer includes a material having the formula: [AaBbXxX′x′X″x″], where A is selected from potassium, rubidium, and cesium; B is selected from germanium, tin, and lead; X, X′, and X″ are independently selected from fluorine, chlorine, bromine, and iodine; a is in the range of 1 to 9; b is in the range of 1 to 5; a sum of x, x′, and x″ is in the range of 1 to 9; and the material is at least one of n-doped and p-doped.
US09127199B2
A liquid crystal composition including a first liquid crystal monomer, and a second liquid crystal monomer, wherein the ratio of the first liquid crystal monomer is 5 wt % to 10 wt % and the ratio of the second liquid crystal monomer is 90 wt % to 95 wt %, based on the total weight of the first liquid crystal monomer and the second liquid crystal monomer. The first liquid crystal monomer is selected from the group consisting of tetra-cyclic compounds represented by formula 1 to formula 6: wherein R is C3-C12 alkyl group, X is —COO—, —C≡C—, or —N═N—, and Y is —CN. The second liquid crystal monomer includes a bicyclic structure or a tricyclic structure.
US09127195B1
A quantity of insoluble solid particles is coated with a hydratable gelling agent to produce a composition comprised of a mass of discrete solid particles which is dry and flowable. The composition is made by placing a binder on the insoluble solid particles and then, while the binder is sticky, placing a hydratable gelling agent on the sticky binder to thereby form the composition. The hydratable gelling agent on the composition, upon contact with an aqueous liquid, operates to increase the viscosity of the aqueous liquid.
US09127185B2
Composition comprising a polyester resin (A) made waterborne by adding 7-20 mass %, based on resin solids content of (A), of (a) a C1-3 alkoxy group-containing glycol monoalkyl ether to a polyester resin of resin acid value 25-35 mgKOH/g and neutralizing with a secondary amine and/or tertiary amine; a melamine resin (B) comprising methylated melamine resin and methyl/butyl mixed alkylated melamine resin, the content ratio based on resin solids content by mass of the methylated melamine resin to the methyl/butyl mixed alkylated melamine resin from 50/50 to 90/10, and the content ratio based on resin solids content by mass of component (A) to component (B) is 70/30 to 90/10, and a polypropylene glycol (C) comprising a number average molecular weight between 400 and 1,200, and in a mass percentage between 1 and 10 mass % in terms of the combined resin solids contents by mass of component (A) and component (B).
US09127178B2
A process for printing a substrate comprising applying thereto an ink by means of an ink jet printer, wherein the ink comprises a latex binder, a liquid medium comprising water and organic solvent, and polymer-encapsulated pigment particles comprising a carboxy-functional dispersant crosslinked around a pigment core by a crosslinking agent, wherein the ink has a minimum film-forming temperature below 70° C. Inks are also claimed. The process and inks are useful for printing temperature-sensitive substrates, e.g. foil balloons and wrapping materials for special occasions.
US09127177B2
A water-based ink for use in a computer-to-plate inkjet printing and a preparation method therefor. A polymer of 5 to 40 wt %, an additive of 0.01 to 10 wt %, a dye or pigment of 0.01 to 10 wt %, an organic solvent of 1 to 30 wt %, an anti-foaming agent of 0 to 5 wt %, and deionized water are stirred and mixed at room temperature. When the polymer is dissolved, the mixed solution is filtered. The filtrate is the water-based ink. The water-based ink is sprayed via a computer-to-plate machine onto a surface of a metal substrate (which may be an aluminum plate, a zinc plate, or a copper plate) to form a graphic region. A printing plate allowing for computer-to-plate printing is acquired after solidification. The printing plate acquired is allowed to achieve a halftone dot reproduction rate between 2 and 99% and a recognition rate of 175 lpi.
US09127176B2
A cationic electrodeposition coating is provided having excellent covering power (clearance application properties), edge anticorrosion properties, and finish properties. The cationic electrodeposition coating composition comprises a specific amino-group-containing epoxy resin; blocked polyisocyanate obtained by reacting an active hydrogen-containing component containing propylene glycol, and a polyisocyanate compound; and 0.1-20 mass parts of a cationic electrodepositing gelled microparticulate polymer obtained by crosslinking an acrylic copolymer containing hydrolyzable alkoxysilane groups and cationic groups, per a total of 100 mass parts of the solids fraction of the amino-group-containing epoxy resin and the blocked polyisocyanate compound.
US09127164B2
The present invention relates to fluorescent dyes based on acridine derivatives and use of such dyes, for example, in biochemical and/or cell based assays. A preferred feature of some of the dyes described is their long fluorescence lifetimes and their use to label biological molecules.
US09127159B2
An object of the present invention is to provide a curable resin composition capable of giving a cured product which is excellent in mechanical properties (such as elastic modulus) and toughness. The curable resin composition contains 60 to 99 parts by mass of an unsaturated ester resin, 0.5 to 20 parts by mass of an epoxy resin, and 0.1 to 20 parts by mass of crosslinked rubber particles having a number average particle diameter of 20 nm to 600 nm. The crosslinked rubber particles are obtained by polymerizing a vinyl monomer in the presence of one or more rubber polymers selected from the group consisting of a butadiene rubber, a butadiene-styrene rubber, a butadiene-butyl acrylate rubber, a butyl acrylate rubber and an organosiloxane rubber.
US09127142B2
A method for injection molding a thermoplastic composition that contains a polyarylene sulfide and an aromatic amide oligomer is provided. Due to the improved crystallization properties imparted by the oligomer, the present inventors have discovered that the thermoplastic composition can be molded at lower temperatures to still achieve the same degree of crystallization. In addition to minimizing the energy requirements for the molding operation, such low mold temperatures may be accomplished using heating mediums that are less corrosive and expensive than some conventional techniques.
US09127137B2
The invention relates to an energy efficient, environmentally favorable process for the preparation of brominated butyl rubbers, that uses a bromination agent and a oxidizing agent in order to enhance the utilization of bromine contained in the bromination agent. In a preferred embodiment a common medium for both solution polymerization and subsequent bromination of the rubber is employed.
US09127136B1
A method of recycling bis(hydroxyalkyl) terephthalate monomer from a composition comprising a terephthalate-containing polymer includes depolymerizing the terephthalate-containing polymer to provide the bis(hydroxyalkyl) terephthalate; and separating the bis(hydroxyalkyl) terephthalate from the composition comprising the depolymerized terephthalate-containing polymer by continuous multi-column liquid chromatography.
US09127125B2
The present invention relates to a new process for preparing polyurethane-polyacrylate hybrid dispersions, and to the resulting dispersions and their use.
US09127109B2
A method for preparing a functionalized polymer, the method comprising: polymerizing conjugated diene monomer, optionally together with comonomer, using a phosphorus-containing organometal initiator.
US09127102B2
A rheology modifier copolymer of formula (I) wherein A is a macromonomer, B is an acrylic or methacrylic acid or salt thereof, C is a C1-C8 ester of (meth)acrylic acid, D is an associative monomer, and when present E is a crosslinking monomer.
US09127090B2
A fibronectin type III (Fn3) polypeptide monobody, a nucleic acid molecule encoding said monobody, and a variegated nucleic acid library encoding said monobody, are provided by the invention. Also provided are methods of preparing a Fn3 polypeptide monobody, and kits to perform said methods. Further provided is a method of identifying the amino acid sequence of a polypeptide molecule capable of binding to a specific binding partner (SBP) so as to form a polypeptide:SSP complex, and a method of identifying the amino acid sequence of a polypeptide molecule capable of catalyzing a chemical reaction with a catalyzed rate constant, kcat, and an uncatalyzed rate constant, kuncat, such that the ratio of kcat/kuncat is greater than 10.
US09127087B2
The present invention relates to a Yeast Surface Display (YSD) vector for expression of VLR proteins by yeast, wherein the vector includes nucleotide sequences encoding segments of yeast flocculation proteins Flo1p, such as the leader and C-terminal segments, a homologous recombinant cassette and a geneticin/kanamycin resistance gene. The vector can be used for expression of VLR that may be effective in diagnostic applications (e.g., protein chip, immunohistochemistry, flow cytometry), immunoaffinity purification, and for engineering novel fusion proteins.
US09127082B2
The present invention discloses a novel neurotrophic factor protein, MANF2 and a genetic sequence encoding the same. The molecule will be useful in the development of a range of therapeutics and diagnostics useful in the treatment, prophylaxis and/or diagnosis of MANF2 dependent conditions. The molecule of the present invention is also a useful effector of primary and central neurons, especially dopaminergic neurons at the central nervous system and growth factor genes.
US09127077B2
The present invention relates to polypeptides, nucleic acids and pharmaceutical compositions suitable for use in the treatment of ErbB2 dependent-cancers, in particular of tumors overexpressing ErbB2 or expressing mutated forms of the ErbB2 gene.
US09127076B2
This invention relates in part to modifying BtBooster (BtB) peptides, in part to increase their stability in insect midgut digestive juices. Some preferred embodiments of BtB have removed proteinase cleavage sites resulting in increased stability of the modified BtB in the insect gut, while retaining the ability to enhance B.t. proteins for improved insect control. In some preferred embodiments, the protease-stable BtB is used in combination with B.t. spores and/or crystals comprising a Cry protein. Also reported herein is the significant and increased enhancement of Bt toxins against relatively Bt-tolerant insects (Helicoverpa zea, Spodoptera exigua and Agrotis ipsilon), when used with BtBs. We also describe increased toxin enhancement with cadherin fragments that are stabilized against over-digestion by insect midgut proteinases. We also report enhancement of Bt Cry1F toxin by cadherin fragments.
US09127075B2
The present invention provides an active peptide purified from scorpions, and derivatives, analogs and active fragment which are produced by using genetic engineering technology. The analgesic active peptide VGG is extracted, separated and purified from scorpion, and its amino acid sequence is shown as below: VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCY KLPDDARIMKPGRCNGG. The present invention further provides a use of the peptides in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.
US09127074B2
The invention refers to TFEB related molecules, as variants, mutants, truncated proteins, chimeras etc. that are constitutively localized in the nucleus of a eukaryote cell. Such molecules have a therapeutic applicability in all of disorders that need of an induction of the cell authophagic/lysosomal system, as lysosomal storage disorders, neurodegenerative diseases, hepatic diseases, muscle diseases and metabolic diseases.
US09127073B2
The present invention relates to two new gain of function variants of the cytokinin receptor proteins AHK2 and AHK3, namely rock2 and rock3, to transgenic organisms comprising at least one of said new gain-of-function cytokinin receptor variants and to a method for the manufacturing of a transgenic plant comprising at least one of the new gain-of-function variants.
US09127066B2
Treating a disorder (e.g., osteoporosis, renal failure, or diabetic nephropathy) associated with a signaling pathway mediated by IL-20 receptor with an agent that suppresses IL-20 receptor activity, e.g., an antibody that neutralizes IL-20 receptor via binding to IL-20R1, an antisense nucleic acid that suppresses expression of IL-20R1, a small molecule that inhibits IL-20 receptor activity, or a dominant negative mutant of IL-19, IL-20, or IL-24.
US09127056B2
Monoclonal antibodies (mAbs), antigen binding fragments and engineered antibody domains (eAds) that specifically bind IGF-II are disclosed herein. In some embodiments, these mAbs and eAds are included in a bispecific mAb. In some embodiments, the bispecific antibody specifically binds two different epitopes of IGF-II. Methods of using these mAbs, antigen binding fragments, and eAds, bispecific antibodies, and nucleic acids encoding these mAbs, antigen binding fragments, and eAds, bispecific antibodies are also disclosed.
US09127054B2
An object of the present invention is to realize an antibody or a fragment thereof specifically recognizing a cofilin 1 protein, and a method for detecting and testing gastrointestinal cancer with high detection performance, which comprises performing immunoassay of the cofilin 1 protein using the antibody or a fragment thereof. An immunoassay of cofilin 1 protein is characterized by measuring cofilin 1 or a fragment thereof in a sample using 2 or more types of anti-cofilin 1 monoclonal antibody or fragments thereof specifically recognizing different peptide regions in the amino acid sequence constituting the cofilin 1 protein.
US09127049B2
The invention relates to neutralizing antibodies, and antibody fragments thereof, having high potency in neutralizing hCMV, wherein said antibodies and antibody fragments are specific for one, or a combination of two or more, hCMV gene UL products. The invention also relates to immortalized B cells that produce, and to epitopes that bind to, such antibodies and antibody fragments. In addition, the invention relates to the use of the antibodies, antibody fragments, and epitopes in screening methods as well as in the diagnosis, prevention, and therapy of disease.
US09127048B2
The present invention discloses positive control material for nucleic acid amplification based detection of microorganisms in biological samples. The control material comprises purified microorganism that is rendered non-infectious but is amenable to nucleic acid amplification. Also disclosed is a process for making and using the control material.
US09127045B2
Methods for selectively manipulating a growth rate of a selected bacterium comprising the step of contacting the selected bacterium with a predetermined amount of a quorum sensing molecule to affect a change in the growth rate of the selected bacterium, wherein the quorum sensing molecule is species specific, and the change in the growth rate is dependent on the amount of quorum sensing molecule in a dose-dependent fashion. Also provided are methods for treating or protecting against bacterial infections by utilizing the dose-dependent response of bacterial quorum sensing systems. The methods can be applied to a wide range of bacteria species including Streptococci, Staphylococci, and Bacilli. Compositions, medicaments and oral formulations for use with the methods are also disclosed.
US09127038B2
The invention relates to kisspeptide-pentasaccharide conjugates having the general formula (I) wherein Z1 is Tyr or D-Tyr; Z3 is Trp, Hyp, Phe or Lys(R2); Z5 is Thr, Aib or Ala; Z7 is Gly or azaGly; Z8 is Leu; or Z7 and Z8 together represent; Z10 is Phe or Trp; n is 0 or 1; or R2, when present, represents a pentasaccharide derivative having the formula (II) wherein R is methyl or SO3X; X is a positively charged counterion; with the proviso that when R2 is present, R1 is H or (C1-6) alkylcarbonyl; R3 is H or (C1-3)alkyl; and L represents a pharmacologically inactive linker moiety having 10-50 atoms; or a pharmaceutically acceptable salt thereof; to pharmaceutical compositions comprising the same as well as to the use of said kisspeptide-pentasaccharide conjugates in the treatment of female infertility.
US09127032B2
As a novel substance having a novel skeleton, an organometallic complex with high emission efficiency which achieves improved color purity by a reduction of half width of an emission spectrum is provided. One embodiment of the present invention is an organometallic complex in which a β-diketone and a six-membered heteroaromatic ring including two or more nitrogen atoms inclusive of a nitrogen atom that is a coordinating atom are ligands. In General Formula (G1), X represents a substituted or unsubstituted six-membered heteroaromatic ring including two or more nitrogen atoms inclusive of a nitrogen atom that is a coordinating atom. Further, R1 to R4 each represent a substituted or unsubstituted alkyl group having 1 to 6 carbon atoms.
US09127031B2
Methods for deposition of elemental metal films on surfaces using metal coordination complexes comprising bisamineazaallylic ligands are provided. Also provided are bisamineazaallylic ligands useful in the methods of the invention and metal coordination complexes comprising these ligands.
US09127028B2
Embodiments of substrates and processes for chromogenic detection, and in particular pyrazolyl dihydrogen phosphate compounds, are disclosed.
US09127004B2
Compounds of Formula (I), their preparation and use in preventing or treating bacterial infections are disclosed.
US09127003B2
Compounds of formula (I): wherein; R1 is hydrogen or C1-6alkyl; R2 is hydrogen, C1-6alkyl, perhalomethylC0-5alkyl-O—, or C1-6alkoxy; R3 is hydrogen, C1-6alkyl, or C1-6alkoxyC1-6alkyl; R4 is hydrogen, C1-6alkyl, perhalomethylC1-6alkyl; or unsubstituted C3-6cycloalkylC1-6 alkyl; A is C—R5 or N; B is C—R6 or N; D is C—R7 or N; with the proviso that at least one of A, B, and D, is N; R5 is hydrogen or C1-6alkyl; R6 is hydrogen or C1-6alkyl; R7 is hydrogen, C1-6alkyl, C1-6alkoxy, or hydroxy; R8 is hydrogen or C1-6alkyl, with the proviso that one of R4 and R8 is hydrogen; R9 is hydrogen or hydroxy; R10 is hydrogen or C1-6alkyl; and salts thereof are PAD4 inhibitors and may be useful in the treatment of various disorders, for example rheumatoid arthritis, vasculitis, systemic lupus erythematosus, ulcerative colitis, cancer, cystic fibrosis, asthma, cutaneous lupus erythematosis, and psoriasis.
US09126998B2
The present application relates to novel substituted imidazo[1,2-a]pyridine-3-carboxamides, to processes for their preparation, to their use alone or in combinations for the treatment and/or prophylaxis of diseases and to their use for preparing medicaments for the treatment and/or prophylaxis of diseases, in particular for the treatment and/or prophylaxis of cardiovascular disorders.
US09126982B2
The present invention relates to compounds of general formula (I) and the tautomers and the salts thereof, particularly the pharmaceutically acceptable salts thereof with inorganic or organic acids and bases, which have valuable pharmacological properties, particularly an inhibitory effect on epithelial sodium channels, and the use thereof for the treatment of diseases, particularly diseases of the lungs and airways.
US09126979B2
The present invention relates to compounds of formula I: in which R1, R2, R3 and R4 are as defined in the Summary of the Invention. Compounds of formula I are capable of disrupting the BCL-2 interations with proteins containing a BH3 domain. Disrupting this interaction can restore the anti-apoptotic function of BCL-2 in cancer cells and tumor tissue expressing BCL-2. The invention further provides a process for the preparation of compounds of the invention, pharmaceutical preparations comprising such compounds and methods of using such compounds in the treatment of cancerous diseases.
US09126978B2
The present invention provides novel chemical compounds characterized as Rho kinase (ROCK) inhibitors, methods for their discovery, and their therapeutic, research, and diagnostic use. In particular, the present invention provides 1,4-benzodiazepine-2,5-dione compounds and related compounds having ROCK inhibitory activity, and methods of using such compounds as therapeutic agents to treat a number of conditions associated with ROCK activity.
US09126977B2
The present invention relates to the discovery of a novel opioid modulator effective in reducing pharmacologically induced weight gain associated with atypical antipsychotic use. The present invention provides methods of reducing antipsychotic induced weight gain, methods for suppressing food intake and reducing ghrelin levels induced by atypical antipsychotic medications in a patient.
US09126970B2
The present invention describes indenocarbazole derivatives having electron- and hole-transporting properties, in particular for use in the emission and/or charge-transport layer of electroluminescent devices or as matrix material. The invention furthermore relates to a process for the preparation of the compounds according to the invention and to electronic devices comprising same.
US09126964B2
The present disclosure provides methods to produce substituted furans (e.g., halomethylfurfural, hydroxymethylfurfural, and furfural), by acid-catalyzed conversion of biomass using a gaseous acid in a multiphase reactor, such as a fluidized bed reactor.
US09126958B2
The present disclosure relates to compounds effective as human protein tyrosine phosphatase beta (HPTP-β) inhibitors thereby regulating angiogenesis. The present disclosure further relates to compositions comprising said human protein tyrosine phosphatase beta (HPTP-β) inhibitors, and to methods for regulating angiogenesis.
US09126951B2
Described herein are inhibitors of FGFR, pharmaceutical compositions including such compounds, and methods of using such compounds and compositions to inhibit the activity of tyrosine kinases.
US09126943B2
A nitrogen-containing heterocyclic derivative represented by the following formula (1): wherein any “12-a” groups of R1 to R12 are independently a hydrogen atom, a fluorine atom, a substituted or unsubstituted aryl group having 6 to 30 ring carbon atoms or a substituted or unsubstituted heterocyclic group having 5 to 30 ring atoms; any “a” groups of R1 to R12 are independently a single bond which is bonded to L1; L1 is a single bond, a “b+1” valent substituted or unsubstituted hydrocarbon ring group having 6 to 30 ring carbon atoms or a “b+1” valent substituted or unsubstituted heterocyclic group having 5 to 30 ring atoms; HAr is a substituted or unsubstituted nitrogen-containing heterocyclic group; and “a” and “b” are independently an integer of 1 to 4, and at least one of “a” and “b” is 1. Also disclosed is a nitrogen-containing heterocyclic derivative represented by the following formula (21) or (31):
US09126940B2
Provided are compositions and methods useful for modulation of signaling through the Toll-like receptors TLR7 and/or TLR8. The compositions and methods have use in treating or preventing disease, including cancer, autoimmune disease, infectious disease, inflammatory disorder, graft rejection, and graft-verses-host disease.
US09126937B2
Pharmaceutical compositions of the invention comprise alkylated imino sugars derivatives having a disease-modifying action in the treatment of diseases associated with glucosidase activity that include Viral hemorrhagic fevers, and any other diseases involving glucosidase activity.
US09126927B2
The present invention relates to inhibitors of 11-β hydroxyl steroid dehydrogenase type 1, antagonists of the mineralocorticoid receptor (MR), and pharmaceutical compositions thereof. The compounds of the invention can be useful in the treatment of various diseases associated with expression or activity of 11-β hydroxyl steroid dehydrogenase type 1 and/or diseases associated with aldosterone excess.
US09126918B2
A process for preparing cyclohexanol and cyclohexanone from cyclohexane includes steps of: (1) non-catalyticly oxidizing cyclohexane with molecular oxygen to obtain an oxidized mixture liquid containing cyclohexyl hydroperoxide (CHHP) as a main product; (2) performing a homogenous catalytic decomposition with an oil-soluble transitional metal compound serving as a catalyst, and serving as a scale inhibitor by 1-hydroxy ethidene-1,1-diphosphonic acid (di)octyl ester, or a combination of 1-hydroxy ethidene-1,1-diphosphonic acid (di)octyl ester and phosphoric acid octyl ester, to decompose the CHHP in the oxidized mixture liquid into cyclohexanol and cyclohexanone; and (3) rectifying to obtain products of the cyclohexanol and the cyclohexanone.
US09126907B2
A sulphur-containing and sulphonated aromatic perfluoroalkane monomer is provided that can be used for the manufacture of a polymer membrane for a PEM-type fuel cell. The perfluoroalkane monomer is a functionalized polymer that has a structure corresponding to a formula (I): E1-Ar1—X1—(CF2)n—X2—Ar2-E2 (I) in which: n is in a range from 1 to 20; X1 and X2, which are identical or different, represent S, SO, or SO2; Ar1, Ar2, which are identical or different, represent a phenylene group, at least one of Ar1 and Ar2 bearing a sulphonic (—SO3H) group or a sulphonate (—SO3M) group, in which M represents an alkali metal cation; and E1 and E2, which are identical or different, represent an electrophilic group such as a halogen, specifically fluorine or chlorine.
US09126904B2
The present invention relates to a process for preparing isocyanates by reacting amines with phosgene in the liquid phase, where phosgene, hydrogen chloride and isocyanates are separated with stripping columns operated at different pressures.
US09126902B1
A class of modified single-ring cyanate esters which have shown the ability to tailor and control the glass-transition (Tg) of the cured resins as well as the water uptake.
US09126897B2
The invention relates to a method for the synthesis of a compound according to formula I comprising the following steps: a) reacting a N-carboxyanhydride according to formula II and a N-carboxy-anhydride according to formula III with a diamine according to formula IV and b) adding an acid to the reaction to adjust the pH value of the reaction to <7; wherein L represents a C2-C20 alkyl group, a C6-C20 aryl group, or a C7-C20 alkylaryl group; and R1 and R2 can be identical or different and represent a hydrogen atom, a C1-C4 alkyl group, a C1-C4 hydroxyalkyl group, a C1-C4 thioether group, a C6-C20 aryl group, a C7-C20 alkylaryl group, a C7-C20 alkylhydroxyaryl group, a C4-C20 alkylheteroaryl group with 1 to 4 heteroatoms; or a C1-C4 alkylcarboxylic moiety, which may be an acid, an amide, or which may be esterified with a C1-C6 alkyl group or a C7-C20 alkylaryl group.
US09126896B2
The invention relates to a method for the synthesis of a compound according to formula I comprising the following steps: a) reacting a Dane salt according to formula II and a Dane salt according to formula III with a coupling reagent; b) adding a diamine according to formula IV to the reaction mixture; and c) adding an acid to the reaction mixture to adjust the pH value of the reaction to <7; wherein L represents a C2-C20 alkyl group, a C6-C20 aryl group, or a C7-C20 alkylaryl group; R1 and R2 can be identical or different and represent a hydrogen atom, a C1-C4 alkyl group, a C1-C4 hydroxyalkyl group, a C1-C4 thioether group, a C6-C20 aryl group, a C7-C20 alkylaryl group, a C7-C20 alkylhydroxyaryl group, a C4-C20 alkylheteroaryl group with 1 to 4 heteroatoms; or a C1-C4 alkylcarboxylic moiety, which may be an acid, an amide, or which may be esterified with a C1-C6 alkyl group or a C7-C20 alkylaryl group; R3 represents a C1-C4 alkyl group; R4 represents a hydrogen atom, or a C1-C4 alkyl group; R5 represents a C1-C4 alkyl group; and X represents an alkali metal.
US09126888B2
Provided are azeotropic and azeotrope-like compositions of trans-1,3,3,3-tetrafluoropropene (HFO-1234ze(E)) and water. Such azeotropic and azeotrope-like compositions are useful in isolating trans-1,3,3,3-tetrafluoropropene from impurities during production. Azeotropes of the instant invention are similarly useful in final compositions or for the manufacture of final compositions, such as blowing agent, propellants, refrigerants, diluents for gaseous sterilization and the like.
US09126883B2
A method of making alkylaromatics is described. The process includes recycling a portion of the alkylation reaction zone effluent back to the alkylation zone to maintain the product quality while reducing energy usage.
US09126876B2
Effect Fischer-Tropsch synthesis of lower olefins by converting a syngas feedstream at a temperature within a range of from 300° C. to no more than 400° C. using a supported, iron-based catalyst under a total system pressure of at least 2 megapascals with a volumetric ratio of hydrogen to carbon monoxide of at least 3:1 with markedly lower coking rates than attainable at a total system pressure of less than 2 megapascals.
US09126874B2
The invention relates to nutrient compositions for agricultural applications, and methods for plant or crop growth and care. The nutrient composition comprises a potassium-based nutrient solution enriched by electrochemical treatment. In various embodiments, the potassium-based nutrient composition comprises hypochlorous acid. The present invention involves the use of the nutrient compositions or solutions, among other things, in pre-harvest and post-harvest treatments and in environmental and soil disinfection.
US09126870B2
An article with a sintered decorative part obtained from a particulate mixture having the following chemical composition: zirconia ZrO2: complement to 100%; 0.5% to 10.0% of oxide(s) with a perovskite structure; 2.0% to 20.0% of a stabilizer for zirconia selected from Y2O3, Sc2O3, MgO, CaO, CeO2, and mixtures thereof, the quantity MgO+CaO being less than 5.0%; less than 2.0% of a sintering additive selected from Al2O3, ZnO, TiO2, and mixtures thereof; and less than 2.0% of other oxides.
US09126869B1
A method for manufacturing a ceramic honeycomb structure includes kneading titania particles, alumina particles and binder ingredient such that raw material paste including the titania particles, alumina particles and binder ingredient is prepared, forming a body made of the raw material paste and having a honeycomb structure such that the body has the honeycomb structure having multiple through-holes extending in the longitudinal direction of the body and multiple partition portions formed between the through-holes, drying the body made of the raw material paste and having the honeycomb structure such that the body maintains temperature difference of 20° C. or lower between surface temperature at an outer surface of the body and temperature at a central portion of the body and a dried body having the honeycomb structure is formed, and sintering the dried body having the honeycomb structure such that a ceramic body having the honeycomb structure is formed.
US09126864B2
A concrete mix for producing freeze-thaw durable concrete having enhanced strength properties, like compressive strength, abrasion resistance, impact strength, toughness, is disclosed. The novel concrete mix contains deformable solid elements in place of 4-8% entrained air for good durability of concrete under freeze-thaw cycles.
US09126849B2
A container containing a cobalt carbonyl complex and a gas that contains carbon monoxide, and a cobalt carbonyl complex composition comprising a cobalt carbonyl complex and a solvent, wherein the concentration of carbon monoxide dissolved in the solvent is 0.001 to 1 wt %.Since the cobalt carbonyl complex contained in the above container or the above composition can retain its sublimation properties for a long time without being converted into a stable complex, when a cobalt film is formed by chemical vapor deposition using the container and the composition, a high-quality film can be formed by a simple process, and the production cost of the cobalt film can be reduced due to high use efficiency of the precursor.
US09126848B2
A method for producing nanoscale particles by means of ionic liquids produces highly crystalline particles. The ionic liquids can be easily regenerated.
US09126846B2
A method of synthesizing metal composite oxide, the method including: a step of separately introducing into a high-speed stirring apparatus a ceria composite oxide microparticle colloid having a mean particle diameter of 10 nm or less after adding a dispersant and an alumina microparticle colloid having a mean particle diameter of 10 nm or less after adding a dispersant; a step of synthesizing alumina-ceria composite oxide microparticles by allowing the ceria composite oxide microparticles and the alumina microparticles that have been introduced into the high-speed stirring apparatus to react in a microscopic space; and a step of applying a shearing force of 17000 sec−1 or more to the alumina-ceria composite oxide microparticles.
US09126844B2
A positive electrode is disclosed for a non-aqueous electrolyte lithium rechargeable cell or battery. The electrode comprises a lithium containing material of the formula NayLixNizMn1-z-z′Mz′Od, wherein M is a metal cation, x+y>1, 0
US09126834B2
A hydrogen storage material has been developed that comprises a metal hydride material embedded into a carbon microstructure that generally exhibits a greater bulk thermal conductivity than the surrounding bulk metal hydride material.
US09126833B2
A method for the rapid and continuous production of crystalline mixed-metal oxides from a precursor solution comprised of a polymerizing agent, chelated metal ions, and a solvent. The method discharges solution droplets of less than 500 μm diameter using an atomizing or spray-type process into a reactor having multiple temperature zones. Rapid evaporation occurs in a first zone, followed by mixed-metal organic foam formation in a second zone, followed by amorphous and partially crystalline oxide precursor formation in a third zone, followed by formation of the substantially crystalline mixed-metal oxide in a fourth zone. The method operates in a continuous rather than batch manner and the use of small droplets as the starting material for the temperature-based process allows relatively high temperature processing. In a particular embodiment, the first zone operates at 100-300° C., the second zone operates at 300-700° C., and the third operates at 700-1000° C., and fourth zone operates at at least 700° C. The resulting crystalline mixed-metal oxides display a high degree of crystallinity and sphericity with typical diameters on the order of 50 μm or less.
US09126831B2
The present invention relates to a compact, concentric auto thermal hydrogen/syngas generator for production of hydrogen/syngas without any external heating. Further, the auto thermal hydrogen/syngas generator of the present invention involves combination of reactions such as partial oxidation, steam reforming, dry reforming, auto thermal reforming, dry autothermal reforming, water gas shift, preferential oxidation or methanation that takes place without external heating, for converting air, steam and fuel into a reformate mainly containing CO, CO2, N2, CH4 and H2O which is subsequently converted to hydrogen/syngas as a feed for fuel cell or syngas applications.
US09126826B2
The micro-electromechanical semiconductor component is provided with a first silicon semiconductor substrate having an upper face, into which a cavity delimited by side walls and a floor wall is introduced, and having a second silicon semiconductor substrate comprising a silicon oxide layer and a polysilicon layer applied thereon having a defined thickness. The polysilicon layer of the second silicon semiconductor substrate faces the upper side of the first silicon semiconductor substrate, the two silicon semiconductor substrates are bonded, and the second silicon semiconductor substrate covers the cavity in the first silicon semiconductor substrate. Grooves that extend up to the polysilicon layer are arranged in the second silicon semiconductor substrate in the region of the section thereof that covers the cavity.
US09126823B2
A microphone has a base substrate comprising a main surface, an acoustic sensor mounted on the main surface, and a circuit element stacked on the acoustic sensor. A hollow space is formed between the acoustic sensor and the circuit element. The acoustic sensor has a sensor substrate having a first surface opposed to the base substrate, a second surface on a side opposite to the first surface, and a cavity formed while recessed with respect to the second surface, and a movable electrode that covers the cavity from the second surface side. A through-hole is formed in the base substrate while piercing the base substrate in a thickness direction. A communication hole is formed in the sensor substrate while piercing the sensor substrate from the first surface to the second surface. The communication hole causes the through-hole and the hollow space to communicate with each other.
US09126822B2
Methods and systems for no-glue pocketed spring unit construction. Rows of pocketed springs, preferably arranged into modules of more than two pocketed springs surrounding a central hole, are ultrasonically welded together when paired vibrating probes and anvils press layers of pocketed spring fabric from the rows of pocketed springs together and a welding pulse is transmitted to the vibrating probe.
US09126814B2
A funnel body comprising a base plate, pull rod, and an outer wall. The outer wall may comprise a plurality of overlapping leaves or a membrane joined to a frame, with the outer wall movable between a collapsed position and an extended position and optionally biased towards the extended position. The funnel body may be moved into an extended position for use as a funnel and moved into a collapsed position and further retracted into a receptacle for storage within the receptacle when not in use. Also provided is a funnel assembly, comprising the funnel body and a housing, wherein the base plate of the funnel body is housed within the housing and positioned between upper and lower stops that engage the base plate and thereby prevent the base plate from exiting the housing. Further provided is a receptacle in combination with the funnel assembly and a method for modifying a receptacle to include a funnel assembly.
US09126802B2
A payout spool for a cable includes a base, a spool, and a disconnect/reconnect device. The cable extends between a first and a second end. The payout spool pays out the cable when the first end of the cable is pulled away from the payout spool. The base includes a terminal for transmitting and/or receiving a signal to and/or from the cable. The spool is rotatably mounted to the base about an axis. The spool is adapted to unwrap the cable about a wrapping area of the spool when the spool is rotated about the axis. The disconnect/reconnect device may be adapted to disconnect the second end of the cable from the terminal when the payout spool pays out the cable and reconnect the same when the payout spool is not paying out the cable.
US09126798B2
A knife folding machine comprises: a support surface (4) for supporting a lower surface of a sheet (S); a knife blade (5); a pair of folding rollers (6a, 6b) opposed to the knife blade (5) at a fold position with the support surface (4) therebetween. The knife blade (5) is reciprocated between first and second positions by a knife drive unit 7. The first position is away from an upper surface of the support surface, and the second position is adjacent a gap between the folding rollers. The reciprocal movement of the knife blade (5) effects a folding operation every time the sheet (S) is set at the fold position. The sheet (S) is conveyed to the fold position by the conveyer belt (13). The conveyer belt (13) is driven by a first servomotor (11). The control unit (12) controls the rotation of the first servomotor (11) so as to decelerate the sheet (S) before its abutment against the stopper (14) without its rebounding against the stopper (14).
US09126792B2
Coreless rolls of tissue, such as rolls of bath tissue or paper towels, are produced by winding tissue logs on a mandrel having retractable pins. During winding, the pins extend and penetrate the first several windings of the log as it is initially wound, which prevents slippage. After the winding is complete, the pins retract to allow the tissue log to slide off of the mandrel for subsequent slitting into individual product rolls and packaging. The penetration of the pins into the first several windings of the log tends to mechanically entangle and structurally unify those windings to create a “soft core”. At the same time, the properties of the tissue sheets within the soft core are the same as the other sheets within the roll and are therefore usable by the consumer.
US09126786B2
An image processing apparatus includes a supplying section from which a sheet placed thereon is supplied into the image processing apparatus, a processing section configured to execute an image processing on an image formed on a sheet, a first storing section configured to store a sheet, a second storing section configured to store a sheet, a first conveying section configured to convey a sheet placed on the supplying section to the first storing section through the processing section, and a second conveying section configured to convey a sheet passing through the processing section to the second storing section and convey a sheet stored in the second storing section to a position at which the sheet from the supplying section enters the processing section.
US09126769B2
An apparatus for distributing a stream of products comprises an ingoing conveyor and an outgoing conveyor which are configured to convey the products along a conveying direction and which are arranged behind one another viewed in the conveying direction. At least two distributor conveyors which are arranged behind one another viewed in the conveying direction between the ingoing conveyor and the outgoing conveyor and which are each configured to convey the products along the conveying direction are displaceable independently of one another transverse to the conveying direction.
US09126768B2
A conveyor which allows the formation and movement of at least one batch of products from a line of products in single file, in at least one passage at an upstream station. The conveyor includes, at an upstream station, a rug for moving said products, and a movement device for moving a predetermined quantity of products from said line of products, between the upstream station and a downstream station. The movement device has engaging elements able to be placed in contact with the products. The rug has a through hole. The movement device is arranged under said at least one passage. The engaging elements are mounted to be movable, relative to said movement device, between a retracted position and an engaged position.
US09126763B2
Transport chain for transporting objects along a transport path in a transport direction, which transport chain comprises a plurality chain links that is interconnected using a joint segment between each chain link, which joint segment comprises a bearing element. Each chain link in the part that is located at the back in the transport direction comprises a cavity that is arranged to receive the bearing element. The bearing element is substantially spherical and comprises a plurality of through holes. The joint segment also comprises a plurality of pins that is arranged in the through holes in the bearing element and in openings in the chain link and in openings in the following chain link.
US09126741B2
A collective vertical tank has a plurality of tanks and stabilizing and weight-distributing connectors. The connectors are adjustable to provide an adjustable footprint of the collective tank. A stabilizing and weight-distributing connector for vertical hydraulic tanks includes a first connecting member attached to a first vertical tank and extending away therefrom, and a second connecting member attached to a second vertical tank and extending away therefrom. The second connecting member defines a central passage adapted to receive the first connecting member therein. A locking mechanism secures the first connecting member within the second connecting member.
US09126736B1
A combined trash receptacle and condiment holding apparatus includes a base member having a plurality of side walls configured in such a manner that an orifice as well as a plurality of recessed receptacles are formed in the base member, a plurality of vessels removably positioned within the receptacles, respectively, and supported at the base member, and a container removably positioned within the orifice and intermediately juxtaposed between the vessels respectively. The container is adapted to receive and segregate the trash therein while the vessels are adapted to receive the foodstuff therein. The orifice and the receptacles extend downwardly from an uppermost surface of the base member and remain supported on a lowermost surface of the base member. In this manner, the container and the vessels remain at a static and fixed upright position when the base member is transported.
US09126729B2
A tea bag string securable to a lid for a cup enables the bag to be positioned into the cup liquid for removal therefrom and thereafter for storage within the lid underside. A string holding tab on the lid comprises a slotted notch in the tab or a hook formation extending from the lid and enables the string to be secured to the lid. A bag-holding strip extending over the lid underside retains the bag therewithin. The strip may be integral with or separate from the lid. If separate, the strip has a cup-engaging rim that can snap the strip over the container lip.
US09126728B1
A tamper resistant cap for a container includes an inner cap and an outer cap. The inner cap has a threaded inner surface, and an upper surface with a plurality of upwardly extending teeth. The outer cap houses the inner cap and defines a central bore thereabove with an inner engagement surface. On an intermediate layer of the outer cap, below the upper bore, there are a plurality of downwardly extending teeth. The tamper resistant cap is releasably securable onto a neck of the container by engagement with the threaded inner surface and removable therefrom by applying a downward force to the outer cap to mesh the upwardly and downwardly extending teeth. The central bore is engageable with a frangible post of the container to effect removal thereof.
US09126726B2
A plastic closure includes a top wall portion, and an annular depending skirt portion having at least one internal thread formation. In order to facilitate high-speed closure application to an associated container, the closure includes an application guide feature positioned in circumferentially spaced relationship to a thread start of the internal thread formation of the closure. The application guide feature is configured to engage the lower surface of an external thread formation of the associated container, whereby cocking, tilting, and other misalignment of the closure is avoided as it is applied to the container with high-speed application equipment.
US09126725B1
An insert for use with a closed loop system, a dispensing system, a gravity draining system or other systems. The insert is designed to be inserted into the throat of a container such as a bottle. The insert includes a cylindrical seal which has a hardness which is less than the other components of the insert. The seal compensates for varying inside diameters of the throat of the container. The seal may be overmolded into a cylindrical recess formed in the insert or may be separately molded and then positioned in the cylindrical recess.
US09126709B2
There is described a labelling machine for applying labels onto articles, comprising a protective wall; one first labelling group which may move between an operative position in which it applies a plurality of labels onto corresponding articles, and a rest position; wall comprises at least one first opening which is at least partially engaged, in use, by first labelling group when it is set in operative position; first labelling group is arranged completely on a first side of wall as it is arranged in rest position, and is arranged at least partially on a second side, opposite to first side, of wall when it is arranged in operative position; wall comprises at least one first panel which may be moved between a closed position in which it covers opening, and an open position in which it leaves free opening; labelling machine comprises connecting means for connecting first panel to first labelling group at least when first labelling group moves, in use, between rest position and an intermediate position, which is arranged between operative and rest positions; the movement of first labelling group between intermediate position and rest position causing, in use, the movement of first panel between open and closed position.
US09126692B2
A remote actuation system for de-manning a human/machine interface emulates the interface protocol to interact with the interface at a mechanical level. The system may function autonomously or with a remote human operator. At least one imaging module and at least one switch module with the same relative positions as and a complementary relief to the interface's gauge(s) and mechanical switch(es) are mounted on the instrument panel. The modules may be individually mounted or provided on a remote actuation panel that fits over the instrument panel. A data cable connects the imaging and switch modules to a processing module having at least one computer processor configured to execute an image-processing sub-module and a switch sub-module to emulate the protocol to interact with the interface at a mechanical level. The estimate of the measured value may be fed back to generate the switch command to control the remote switch actuator.
US09126689B2
A seating arrangement for location at the longitudinal center line of a commercial passenger vehicle that has a longitudinally extending passenger seating area. The seating arrangement includes a pair of seats disposed alongside and secured to each other. Each seat comprising a backrest portion, and a seat pan portion, wherein the seats face at an acute angle to each other, and wherein the backrest portions of the respective seats are nearest the vertex of the acute angle than the seat pan portions.
US09126686B2
A draining system having an odor seal for a vacuum toilet drain system in which a flexible hose acts as an odor seal. As a result of the flexible hose, propagation of odors can be prevented when the hose collapses flat, for example as a result of its intrinsic weight, and consequently there is no longer a flow-through cross section, wherein, however, drainage of liquids remains possible.
US09126684B2
A habitation and sleeping module, in an aircraft, for accommodating at least one member of a flight crew, with the module having a first sleeping area. Furthermore, an ascent region is provided for ascending from a lower level into the module, wherein the ascent region includes an ascent device that is laterally arranged on the module.
US09126671B2
A stiffened panel includes a panel at least one of whose surfaces is equipped with stiffeners each of which includes a base that is pressed against the surface of panel, as well as a core that is oriented orthogonally relative to the base and whose first longitudinal edge is integral to the latter. At least one of the stiffeners includes a multitude of notches that cross over a second longitudinal edge of the core opposite the first edge, so that they extend towards the outside of the stiffener.
US09126670B2
In an embodiment of the disclosure, there is provided a panel assembly for joining to a structure and method of making the same. The assembly has a first panel element having at least one first panel nonlinear edge, and has a second panel element having at least one second panel nonlinear edge, wherein the second panel nonlinear edge is designed to interlace with the first panel nonlinear edge to form a panel assembly with interlaced panel edgebands for joining to a structure. A width of the interlaced panel edgebands is reduced as compared to a width of adjacent panel edgebands formed by adjacent panel elements having linear edges, and the reduced width results in an overall reduced weight of the panel assembly and the structure to which the panel assembly is joined.
US09126665B2
An outboard motor for a marine vessel application, and related methods of making and operating same, are disclosed herein. In at least one embodiment, the outboard motor includes a horizontal-crankshaft engine in an upper portion of the outboard motor, positioned substantially positioned above a trimming axis of the outboard motor. In at least another embodiment, first, second and third transmission devices are employed to transmit rotational power from the engine to one or more propellers at a lower portion of the outboard motor. In at least a further embodiment, the outboard motor is made to include a rigid interior assembly formed by the engine, multiple transmission devices, and a further structural component. In further embodiments, the outboard motor includes numerous cooling, exhaust, and/or oil system components, as well as other transmission features.
US09126664B1
A watercraft comprising a bow, a stern, a hull, a transom, and a deck. The transom is located at the stern of the watercraft and the deck extends forward from the transom. One or more cavities are disposed through the deck adjacent to the transom wherein the cavities are each configured to receive an outboard motor. An enclosure is disposed over each of the cavities, providing a means to hide and enclose the outdoor motor. Multiple enclosures can be provided where the watercraft is powered by multiple outboard motors. The top of the enclosure includes a seating surface, providing a sun deck for boaters. The enclosures are hingeably mounted to the deck to provide selective access to the enclosure's respective cavity and motor therein. The interior of the enclosures defines a curved surface to promote air turnover inside the enclosures, optimizing engine performance.
US09126657B2
A portable boat enclosure includes a plurality of separable panels formed of a lightweight material and a storage bag. The panels are connectable into a boat enclosure, and the panels are sized and shaped to be overlaid, folded and rolled to fit in the storage bag.
US09126654B1
An electric bicycle motor power control apparatus performs a linear program for a compensation signal through a linear computation module according to the data such as exercise strength and pedaling angle of a user pedaling a bicycle, and transmits the signal to a proportion and integration module for computation to provide a stable input power to a motor, so as to achieve the effects of controlling the motor output, minimizing the change of periodical output while the user is pedaling the pedal, and providing a mild and consistent motor output.
US09126647B2
The present invention relates to a bicycle seat post structure, and more particularly, to a structure provided with a hydraulic actuator within which is configured with an upper oil compartment, an intermediate oil compartment, and a lower oil compartment; the three oil compartments intercommunicate. It is characterized in that the bicycle seat post structure provides an upper valve moving simultaneously with the pin and configured between the upper oil compartment and the intermediate oil compartment; the upper valve will be closed to disconnect the upper oil compartment from the intermediate oil compartment when the pin is in a state of locking. Thus, the valve will stop moving up because it is positioned above the upper and the intermediate oil compartments and consequently controlled by the oil within the compartments, so as to stop the seat sliding upward and further to be combined with the bicycle frame as a whole.
US09126644B2
A powered converter trolley for movement and attachment of trailers is provided. The trolley comprises a conventional converter trolley having a drawbar. The trolley has a power supply and operates as a towing device. The trolley connects to a freight trailer and can be raised or lowered from a stored position to a ground-engaging, working position. Alternatively, the wheels of the trolley may be powered for providing motion to the trolley. The trolley further comprises several attachment devices for securing the trolley to an intermodal railcar, including alternative hydraulic, mechanical, and electrically-powered tie down devices. A trolley movable along a railcar is provided for securing the trolley or trailer to the railcar and includes a hitch component for selectively interconnecting to a hitch component on the trolley or trailer.
US09126642B2
A vehicle having a tailgate attached by hinge assemblies. The hinge assemblies have a pair of first hinge halves secured to a rear sill with a hinge leaf extending rearwardly, and a pair of second hinge halves, each secured to the tailgate with a pair of double hinge plates extending therefrom. Each of the second hinge halves include a hinge pin mounted thereto that is selectively slidable between a removal position, a locked position where each of the hinge pins extends into hinge pin holes in the second hinge halves and hinge pin holes of the first hinge halves to pivotally secure the tailgate to the vehicle, and an install position where a tapered end of each of the hinge pins is located in a gap. A latch secures the tailgate in a closed position and releases the tailgate for pivoting about the hinge pins.
US09126640B2
An air guiding device (10) for a motor vehicle, with a spoiler lip (12) extending in the transverse direction (FQ) of the vehicle, and with a pneumatic actuating device (28) for the spoiler lip (12), with the aid of which actuating device the spoiler lip (12) is shiftable between a retracted rest position and an extended position, wherein the pneumatic actuating device (28) has a pneumatic actuator (30) which is fillable with or is emptiable of air, wherein the pneumatic actuator (30) is divided in the transverse direction (FQ) of the vehicle into a plurality of zones (40, 42, 44), wherein the pneumatic actuator (30) has a plurality of air-fillable chambers (46, 48, 50) in each zone (40, 42, 44), and wherein the chambers (46, 48, 50) are fillable with or are emptiable of air in a manner individual to the zones.
US09126639B2
An air guiding device (10) for a motor vehicle has a spoiler lip (12) mountable on a front part (8) of the motor vehicle via an adapter (32) and extends in the transverse direction (FQ) of the vehicle. A pneumatic actuating device (28) shifts the spoiler lip (12) between a retracted rest position and an extended position. A flexurally elastic rod (24) is guided in a guide (26) near the free end of the spoiler lip (12). The spoiler lip (12) is mounted on the adapter (32) so that the spoiler lip (12), even in the retracted rest position, is under a prestress that opposes the shifting of the spoiler lip (12) out of the rest position into an extended position.
US09126631B2
A connecting arrangement is provided for connecting at least two body components of a motor vehicle. The connecting arrangement includes, but is not limited to a pulling device, an elastic clamping element and a pressure distributor provided with a passage opening, which pressure distributor with its passage opening, can be supportingly brought to bear against a surface portion of the body component overlapping with a passage opening of the body component and the clamping element can be interactingly arranged on an outside of the pressure distributor facing away from the body component with the pulling device extending through the passage openings of the body component and of the pressure distributor.
US09126630B1
A corner node for reinforcing a portion of a truck box of a pickup truck is provided. The corner node may be disposed within a cavity defined by a cross member and a corner box pillar of the truck box. The corner node may include a lateral portion and a pillar portion extending vertically from the lateral portion. The lateral portion may be secured within the cross member. The pillar portion may have a plurality of sidewalls secured to the pillar and may define a plurality of web supports spaced apart along a height of the pillar portion to reinforce a corner region of the truck box. The corner node may be five or six thousand series aluminum.
US09126626B1
Apparatus for steering a boom support vehicle includes a boom support vehicle which has a front section which is rotatably connected at a pivot to a rear section. The one side of the rear end of the front section is connected to the same side of the front end of the rear section by a variable length mechanism. Steering is effected by changing the length of the variable length mechanism thereby causing the rear section to rotate about the pivot with respect to the front section.
US09126623B2
A steering shaft for a steering system of a motor vehicle, comprises an inner shaft mounted axially displaceably in a hollow shaft, wherein a rolling bearing having multiple metallic rolling elements, which are disposed axially in at least two rows, is disposed between the hollow shaft and the inner shaft. Previously known steering shafts cannot reliably present vibrations from being transmitted from the inner shaft to the hollow shaft. Therefore, the diameters of the metallic rolling elements decreases proceeding from the center of the rolling bearing toward the end faces thereof, wherein multiple mutually adjacent metallic rolling elements have identical and/or different diameters.
US09126621B1
A lever for a drive-by-wire system installed in a vehicle, may include a lever body that is rotatably mounted on a console surface of the vehicle, and an acceleration lever and a steering roller that are installed in the lever body, such that it is possible to control a change of a gear shift stage, acceleration, and a change of a proceeding direction of the vehicle in a unified manner, and there is no risk of erroneous manipulations of an accelerator pedal and a brake pedal, and acceleration and a proceeding direction may be changed using a finger, thereby improving performance in manipulating the vehicle.
US09126619B2
An operation unit provided on a grip part of a steering wheel, and having an operation panel in which contact operations are possible by the fingers of an operator; an operation detection unit that detects contact operations with respect to the operation panel with a predetermined coordinate system as a reference; a display control unit that controls the display of a display device according to the contact operations detected by the operation detection unit; a correction unit that corrects a coordinate system according to a steering angle detected by a steering angle detection device; and a correction prohibition device that, based on at least one from among contact operations detected by the operation detection device, a steering angle detected by a steering angle sensor, and a speed detected by a speed sensor, prohibits correction of the coordinate system by the correction unit.
US09126617B1
A chair including a fold down seat which is closed against the side or rear of a stroller or wheelchair for transit or storage, but which is deployable to rotate outwardly therefrom for sitting upon when desired.
US09126616B2
A shopping cart attachment is mounted to the handlebar of a shopping cart to facilitate fast and easy installation and removal of a multi-page booklet, such as may be used to provide advertisements and/or informational material to a customer. In addition, the attachment may include a raised ledge that may be used to retain a customer's mobile phone, tablet, shopping list, coupons and/or writing utensil while shopping.
US09126612B2
A cable reel trolley includes a main body fixed with a carrying unit, and a wheel frame and a third wheel at the bottom, with the third wheel parallel to the wheel frame. The wheel frame has two ends respectively installed with a first wheel and a second wheel. A direction-swaying member is fixed between the wheel frame and the first wheel, able to shift the axial direction of the first wheel so that the trolley can move with the first wheel and the second wheel or with the first wheel and the third wheel optionally. That is, the trolley can travel forward and backward or leftward and rightward, turning vertically in a narrow space.
US09126610B1
A collapsible shopping cart apparatus allows a person to load and unload items from a vehicle without having to remove the items from a shopping cart. The apparatus includes a plurality of panels including a back panel, a bottom panel, a front panel and a pair of side panels. A frame is coupled to and extends around a perimeter edge of the bottom panel. The frame and the plurality of panels define a basket. A plurality of legs is coupled to the frame. Each of the legs is pivotable relative to the frame between a use position and a storage position. A plurality of swivelable casters is configured for contacting a ground surface when the legs are in the use position. Each of the casters is coupled to a bottom end of an associated one of the legs.
US09126598B2
The invention relates to power management of a off-highway vehicle. A power management apparatus is described as a vehicle control unit coupled to a vehicle and the vehicle control unit is in communication with an engine and a transmission controller. In response to power management input, the vehicle control unit sends a message to the transmission controller commanding a maximum torque limit based on the maximum drivetrain torque. The maximum torque limit is configured to optimize power to the vehicle implement.
US09126587B2
A vehicle control system including a combustion engine and an electric motor selectively provided torque to a transmission separately or in combination to meet driver torque demand. The engine has a maximum torque output value and a torque increase delay response function spanning a predetermined time period. A motor torque boost signal requests an increase in torque provided from an electric motor if the engine torque request signal exceeds the maximum torque output of the engine or the torque increase delay response function of the engine. The motor torque boost signal is time limited and a second level of motor torque boost may be provided for a second limited time period.
US09126586B2
An antiskid apparatus for a hybrid vehicle includes a generator control section that adjusts a deceleration torque of a driving wheel by controlling a power generator to change from an operation of decreasing a generation amount of the power generator to an operation of assisted driving of a crankshaft when an engine rotation speed is higher than a predetermined rotation speed during rapid deceleration in which a vehicle deceleration speed is at a predetermined value or more or during deceleration associated with shift-down through a transmission.
US09126585B2
A control device for a hybrid vehicle, including a mode whereby the vehicle runs using a motor only, and a mode whereby the vehicle uses both the motor and an engine. When the motor temperature of an MG(2) exceeds a threshold temperature, an ECU moves from a running mode that uses the MG(2) only, to a running mode that limits the load on the MG(2). When the charging state of a battery for running exceeds a threshold value, the ECU performs control such that in addition to the system voltage for driving the MG(2) being reduced, the threshold temperature is increased, and the running mode whereby only the MG(2) is used is maintained.
US09126578B2
A machine includes an engine and an engine cooling system, which is associated with and configured to remove heat from the engine. A transmission is connected to the engine and configured to transmit engine power from the engine to a driven load. The transmission controls an amount of engine power transmitted to the driven load in response to a transmission command signal. A controller associated with the engine and the transmission provides the transmission control signal. The controller is disposed to determine an engine operating condition, determine a transmission operating condition, and adjust the transmission command signal to reduce the amount of engine power transmitted to the driven load when the engine operating condition indicates that the engine cooling system removes insufficient heat from the engine.
US09126577B2
A vehicle braking system includes (a) a rotary machine that functions at least as an electricity generator and that is capable of generating braking torque based on regenerative torque, (b) a first braking control apparatus that electrically controls the braking torque of a mechanical brake that is provided for a wheel, and (c) a second braking control apparatus that replaces one of the braking torque provided by the rotary machine and the braking torque provided by the mechanical brake with another one of the braking torque provided by the rotary machine and the braking torque provided by the mechanical brake while maintaining a target braking torque, the second braking control apparatus correcting the braking torque provided by the rotary machine so that the deviation lessens, if the braking torque of a vehicle has deviation from the target braking torque at time of replacement transition.
US09126571B2
A patient support apparatus includes a frame, with a barrier, and a patient support surface supported in the frame. The apparatus further includes a control system with a controller, which is incorporated into the surface or the frame, and which is in communication with at least one functional component associated with the surface or the frame for controlling or monitoring the functional component. The control system further includes a touch-screen display in communication with the controller for controlling the functional component, which is positioned in the barrier between the exterior and interior side of the barrier wherein the display is incorporated into the barrier and accessible at the exterior or interior side for access by a user. The display is configured to allow the user to select the functional component and control or monitor a function associated with the selected functional component and includes a touch-selectable icon at the display representative of a function associated with the selected component, and with the icon operable to adjust the function of the selected component.
US09126569B2
The invention relates to a wiper blade (10) for cleaning vehicle windows, with a wiper blade body (22) connected with a wiper blade adapter (11), wherein the wiper blade adapter (11) consists of an adapter element (12) on the wiper arm side and of an adapter element (13) on the wiper blade side, which are connected with one another and are arranged pivotably with respect to one another in an axis (14), and with at least one distributor element (35) arranged pivotably in the axis (14) for the hydraulic and/or electrical supply of the wiper blade body (22), wherein the distributor element (35) is arranged substantially between two side walls (29, 30) of the adapter element (13) on the wiper blade side, that an aperture (31, 32) is formed respectively on the two side walls (29, 30) of the adapter element (13) on the wiper blade side aligned to the axis (14), and that the distributor element (35) has respectively a peg-like bearing extension (55, 56) on the side facing the side walls (29, 30).
US09126568B1
An integrated jacking system includes built-in jacks for each wheel of the vehicle. Electric motor-driven screw or worm-gear jacks are welded to the vehicle frame or unibody aft of the front wheels and forward of the rear wheels. The four jack screws each terminate on the lower end in a rotatable ball-jointed footing adaptable to uneven drive surfaces beneath the vehicle wheels. The integrated jacking system is controlled by the vehicle computer through a passcode-accessible central jacking control interface. The vehicle computer is programmed to implement safety protocols: allowing only one wheel at a time to be jacked up, limiting jacking height of a wheel to not more than six inches (6″) off the ground, and disabling the jacking system if the grade of the underlying surface exceeds twenty percent (20%) or if the parking brake is not set.
US09126562B2
The present invention relates to an airbag including: an inflator; and an airbag cushion which is deployed by gas flowing into the airbag cushion from the inflator, in which the airbag cushion has a burst portion at least a part of which is torn from the airbag cushion so as to form a burst hole through which gas flowing into the airbag cushion is discharged to the outside.
US09126553B2
The present invention relates to a vehicle bunk restraint system that includes a padded ladder restraint member and at least one other restraint member. The padded ladder restraint member provides access to an upper bunk. The padded ladder restraint member and at least one other restraint member may cooperate to obstruct the entrance to the lower bunk, whereby ejection from the lower bunk via the entrance is obstructed via the padded ladder restraint member and the at least one other restraint member.
US09126551B2
A shock absorber for motor vehicles, comprising: a deforming body (2) comprising a first portion (3) and a second portion (4) which are fixed to one another such as to identify a tubular member (5) which has a first axis and comprises a first wall (6) and a second wall (7) adjacent to one another, which intersect to identify an edge (8), each portion (3, 4) comprising a half-shell (9) and two fixing tabs (10) arranged respectively at opposite ends of the half-shell (9), at least a portion (3, 4) comprising at least a bead (11, 12) which develops along a perpendicular development with respect to the first axis. The bead (11, 12) develops continuously at least along a part of the first wall (6) and at least along a part of the second wall (7) of the tubular member (5), following at least the edge (8) identified between the first wall (6) and the second wall (7), the bead (11, 12), when it follows the first wall (6), being orientated projecting with respect to the zone of the external surface of the first wall (6) which surrounds the bead (11, 12), the bead (11, 12), when following the second wall (7), being orientated retracted with respect to the zone of the external surface of the second wall (7) which surrounds the bead (11, 12), the bead (11, 12), at the edge (8), varying orientation thereof between projecting and retracted.
US09126549B2
It is intended to provide a sound insulation structure for a vehicle, which is capable of adequately retaining an elongated line component, such as a wiring harness, a pipe or a cable, while suppressing deterioration in sound insulation performance by a sound insulator. In the sound insulation structure, a sound insulator is provided in a void space surrounded by: a front fender panel; a cowl side member disposed on a vehicle inward side with respect to the front fender panel to extend in a vehicle front-rear direction; and a mud guard disposed just below the front fender panel and the cowl side member to form a wheel housing. The sound insulator is formed using an elastically-deformable urethane foam. The sound insulator is formed with a slit capable of clamping a regenerative brake wiring harness laid to extend in the vehicle front-rear direction and pass through the void space.
US09126536B2
An apparatus for providing safe access to the upper surface of a mobile container. The apparatus includes a pivoting handrail system having a walk surface, a first set of rails and a second set of rails both capable of being raised and lowered between a raised access position and a lowered stored position, a first pull for raising and lowering the first set of rails, a second pull for raising and lowering the second set of rails, and a support device for supporting the walk surface and attaching to the mobile container. An access such as a ladder may be attached to the pivoting handrail system to provide access to the pivoting handrail system.
US09126534B2
A system to remove debris from a vehicle camera lens using washer fluid from the vehicle's washer system is disclosed. The system analyzes a captured image and determines if the image is obstructed by debris. If the image is determined to be obstructed, the system automatically sprays the camera lens with fluid to remove the debris. The system includes a method of determining obstruction by comparing an image with a reference image. The system includes a method of determining obstruction by analyzing relative movement within a reference area of the image. The system also prevents the draining of the washer fluid due to a false obstruction reading or debris that does not come off after a few sprayings.
